F452951

General Info

Members Datasets Scaffolds Average Seq Length
484 291 968 108

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10698400|Ga0207661_106984002
Length 119
Sequence MLASLRFRRGPRMTYLRVCGVADVAPGSAIQVDVGDKDVAVVRDGDDWYAVDDECSHANIPLSEGDVEGCEIECWLHGSRFDLRTGKPTGPPATEPVAIYPVKVEGDDVLVDPAAPLNS

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
222 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
258 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 2626541554 Frankia sp. AvcI.1 Isolate Nodule
287 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
288 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
289 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
290 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
291 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 90.29
Metatranscriptomes 8.47
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 2.48
Nodule 0.21
Rhizoplane 9.71
Rhizosphere 85.33
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10698400 3300025944 Bacteria 933
2 JGI24743J22301_10003335 3300001991 Bacteria 2530
3 JGI24738J21930_10003289 3300002075 Bacteria 4107
4 JGI24744J21845_10006044 3300002077 Bacteria 2510
5 Ga0007410J51695_1049598 3300003574 Bacteria 1450
6 Ga0007429J51699_1048047 3300003579 Bacteria 1751
7 Ga0058863_10012766 3300004799 Bacteria 881
8 Ga0058862_12274282 3300004803 Bacteria 635
9 Ga0070658_11248073 3300005327 Bacteria 646
10 Ga0070683_100163525 3300005329 Bacteria 2111
11 Ga0070683_100219405 3300005329 Bacteria 1807
12 Ga0070683_100841795 3300005329 Bacteria 880
13 Ga0070683_101000970 3300005329 Bacteria 802
14 Ga0070677_10052900 3300005333 Bacteria 1649
15 Ga0070680_100305767 3300005336 Bacteria 1349
16 Ga0070682_100054234 3300005337 Bacteria 2514
17 Ga0070682_100211892 3300005337 Bacteria 1373
18 Ga0070682_100541188 3300005337 Bacteria 909
19 Ga0070682_101273400 3300005337 Bacteria 623
20 Ga0068868_100100492 3300005338 Bacteria 2340
21 Ga0070660_100496960 3300005339 Bacteria 1014
22 Ga0070660_100593102 3300005339 Bacteria 926
23 Ga0070691_10026886 3300005341 Bacteria 2684
24 Ga0070687_100155223 3300005343 Bacteria 1348
25 Ga0070687_100647458 3300005343 Bacteria 732
26 Ga0070661_100149916 3300005344 Bacteria 1762
27 Ga0070661_100682465 3300005344 Bacteria 836
28 Ga0070692_10005419 3300005345 Bacteria 5441
29 Ga0070675_100236268 3300005354 Bacteria 1596
30 Ga0070675_100727409 3300005354 Bacteria 905
31 Ga0070674_100027985 3300005356 Bacteria 3699
32 Ga0070688_100392118 3300005365 Bacteria 1026
33 Ga0070659_100038079 3300005366 Bacteria 3749
34 Ga0070659_100307223 3300005366 Bacteria 1324
35 Ga0070659_100579383 3300005366 Bacteria 963
36 Ga0070713_100359917 3300005436 Bacteria 1352
37 Ga0070710_11359223 3300005437 Bacteria 530
38 Ga0070711_101217152 3300005439 Bacteria 652
39 Ga0070705_100904999 3300005440 Bacteria 710
40 Ga0070700_100004014 3300005441 Bacteria 7652
41 Ga0070700_101091307 3300005441 Bacteria 661
42 Ga0070694_101237738 3300005444 Bacteria 626
43 Ga0070663_100284449 3300005455 Bacteria 1319
44 Ga0070678_100313749 3300005456 Bacteria 1337
45 Ga0070662_101660379 3300005457 Bacteria 552
46 Ga0070662_101924907 3300005457 Bacteria 511
47 Ga0070681_10256024 3300005458 Bacteria 1662
48 Ga0068867_100005752 3300005459 Bacteria 8795
49 Ga0068867_100931053 3300005459 Bacteria 784
50 Ga0068867_101454560 3300005459 Bacteria 637
51 Ga0070685_10062743 3300005466 Bacteria 2180
52 Ga0070685_10460428 3300005466 Bacteria 893
53 Ga0070684_100046193 3300005535 Bacteria 3773
54 Ga0070684_100226368 3300005535 Bacteria 1707
55 Ga0070684_100243180 3300005535 Bacteria 1644
56 Ga0070684_100281459 3300005535 Bacteria 1524
57 Ga0070684_100704231 3300005535 Bacteria 941
58 Ga0068853_100033108 3300005539 Bacteria 4384
59 Ga0068853_101995867 3300005539 Bacteria 563
60 Ga0070672_100287907 3300005543 Bacteria 1390
61 Ga0070672_100708112 3300005543 Bacteria 882
62 Ga0070672_100842693 3300005543 Bacteria 808
63 Ga0070686_100329017 3300005544 Bacteria 1142
64 Ga0070686_101009191 3300005544 Bacteria 683
65 Ga0070693_100118231 3300005547 Bacteria 1640
66 Ga0068855_100373071 3300005563 Bacteria 1568
67 Ga0070664_100045200 3300005564 Bacteria 3719
68 Ga0070664_100216736 3300005564 Bacteria 1712
69 Ga0070664_100303649 3300005564 Bacteria 1443
70 Ga0070664_100483232 3300005564 Bacteria 1140
71 Ga0070664_100906156 3300005564 Bacteria 827
72 Ga0070664_101737292 3300005564 Bacteria 592
73 Ga0068854_100176495 3300005578 Bacteria 1666
74 Ga0068856_100541248 3300005614 Bacteria 1186
75 Ga0068856_100911815 3300005614 Bacteria 898
76 Ga0070702_100005872 3300005615 Bacteria 5760
77 Ga0070702_100188063 3300005615 Bacteria 1357
78 Ga0068852_100010251 3300005616 Bacteria 6989
79 Ga0068852_100217170 3300005616 Bacteria 1817
80 Ga0068852_100369093 3300005616 Bacteria 1405
81 Ga0068852_101573906 3300005616 Bacteria 680
82 Ga0068852_102518279 3300005616 Bacteria 535
83 Ga0068859_100764373 3300005617 Bacteria 1055
84 Ga0068864_100229378 3300005618 Bacteria 1717
85 Ga0068864_100426354 3300005618 Bacteria 1264
86 Ga0068864_101783492 3300005618 Bacteria 620
87 Ga0068866_11114944 3300005718 Bacteria 566
88 Ga0068861_100019601 3300005719 Bacteria 4831
89 Ga0068851_10405715 3300005834 Bacteria 802
90 Ga0068870_10219543 3300005840 Bacteria 1163
91 Ga0068863_100236929 3300005841 Bacteria 1761
92 Ga0068863_101363074 3300005841 Bacteria 717
93 Ga0068858_100693528 3300005842 Bacteria 991
94 Ga0070717_10907466 3300006028 Bacteria 802
95 Ga0075365_10425665 3300006038 Bacteria 937
96 Ga0075363_100156877 3300006048 Bacteria 1287
97 Ga0075364_10789133 3300006051 Bacteria 648
98 Ga0070716_100645429 3300006173 Bacteria 802
99 Ga0070712_100850512 3300006175 Bacteria 785
100 Ga0070712_100861309 3300006175 Bacteria 780
101 Ga0068871_101809578 3300006358 Bacteria 580
102 Ga0075428_101295157 3300006844 Bacteria 766
103 Ga0075434_100285859 3300006871 Bacteria 1669
104 Ga0075429_100755229 3300006880 Bacteria 852
105 Ga0075429_101057836 3300006880 Bacteria 709
106 Ga0068865_100297497 3300006881 Bacteria 1290
107 Ga0068865_101141158 3300006881 Bacteria 688
108 Ga0075436_100859729 3300006914 Bacteria 677
109 Ga0097620_100764261 3300006931 Bacteria 1055
110 Ga0075435_101437071 3300007076 Bacteria 605
111 Ga0105240_10000850 3300009093 Bacteria 54972
112 Ga0105240_10064371 3300009093 Bacteria 4556
113 Ga0111539_10083467 3300009094 Bacteria 3757
114 Ga0111539_10656190 3300009094 Bacteria 1222
115 Ga0105245_10117386 3300009098 Bacteria 2482
116 Ga0105245_10331716 3300009098 Bacteria 1502
117 Ga0105245_10448938 3300009098 Bacteria 1297
118 Ga0105245_11430180 3300009098 Bacteria 742
119 Ga0105245_13252665 3300009098 Bacteria 503
120 Ga0105247_11313788 3300009101 Bacteria 581
121 Ga0114129_10285387 3300009147 Bacteria 2204
122 Ga0114129_10296049 3300009147 Bacteria 2158
123 Ga0114129_10608674 3300009147 Bacteria 1415
124 Ga0114129_11360862 3300009147 Bacteria 877
125 Ga0105243_10006135 3300009148 Bacteria 9294
126 Ga0105243_10743746 3300009148 Bacteria 961
127 Ga0105242_10157849 3300009176 Bacteria 1983
128 Ga0105248_10067785 3300009177 Bacteria 4006
129 Ga0105248_10139960 3300009177 Bacteria 2730
130 Ga0105237_10739979 3300009545 Bacteria 990
131 Ga0105237_10787747 3300009545 Bacteria 957
132 Ga0105237_11853736 3300009545 Bacteria 611
133 Ga0105238_10029965 3300009551 Bacteria 5539
134 Ga0105238_11035442 3300009551 Unclassified 842
135 Ga0105238_11109312 3300009551 Bacteria 814
136 Ga0105238_11531507 3300009551 Bacteria 696
137 Ga0105249_10212197 3300009553 Bacteria 1900
138 Ga0105249_11539342 3300009553 Bacteria 737
139 Ga0105239_10232600 3300010375 Bacteria 2068
140 Ga0105239_10744725 3300010375 Bacteria 1121
141 Ga0105239_11451120 3300010375 Bacteria 792
142 Ga0105239_12800789 3300010375 Bacteria 569
143 Ga0105246_10315603 3300011119 Bacteria 1268
144 Ga0105246_10619940 3300011119 Bacteria 937
145 Ga0105246_10716498 3300011119 Bacteria 879
146 Ga0157371_10365321 3300013102 Bacteria 1052
147 Ga0157369_10397422 3300013105 Bacteria 1430
148 Ga0157374_10451104 3300013296 Bacteria 1287
149 Ga0157374_10897792 3300013296 Bacteria 904
150 Ga0157374_11733535 3300013296 Bacteria 649
151 Ga0157378_12392570 3300013297 Bacteria 580
152 Ga0157372_10161372 3300013307 Bacteria 2591
153 Ga0157372_10218379 3300013307 Bacteria 2210
154 Ga0157372_12774937 3300013307 Bacteria 562
155 Ga0163163_10187477 3300014325 Bacteria 2116
156 Ga0163163_12177382 3300014325 Bacteria 614
157 Ga0157380_10346444 3300014326 Bacteria 1388
158 Ga0157380_11012442 3300014326 Bacteria 865
159 Ga0157380_11466689 3300014326 Bacteria 734
160 Ga0157377_10307132 3300014745 Bacteria 1049
161 Ga0157377_10388231 3300014745 Bacteria 947
162 Ga0157379_10089847 3300014968 Bacteria 2756
163 Ga0157379_10578545 3300014968 Bacteria 1047
164 Ga0157379_12346208 3300014968 Bacteria 532
165 Ga0157376_10610181 3300014969 Bacteria 1087
166 Ga0197907_10671537 3300020069 Bacteria 508
167 Ga0206356_10181786 3300020070 Bacteria 727
168 Ga0206356_10439904 3300020070 Bacteria 1243
169 Ga0206356_11161419 3300020070 Bacteria 1368
170 Ga0206349_1390947 3300020075 Bacteria 3192
171 Ga0206351_10415200 3300020077 Bacteria 1474
172 Ga0206352_10503881 3300020078 Bacteria 908
173 Ga0206352_11174157 3300020078 Bacteria 2487
174 Ga0206350_11157620 3300020080 Bacteria 3558
175 Ga0206354_10189804 3300020081 Bacteria 819
176 Ga0206354_10689340 3300020081 Bacteria 2378
177 Ga0206354_10856493 3300020081 Bacteria 904
178 Ga0206353_11204907 3300020082 Bacteria 1615
179 Ga0206353_11817219 3300020082 Bacteria 1182
180 Ga0154015_1642176 3300020610 Bacteria 750
181 Ga0213876_10603966 3300021384 Bacteria 584
182 Ga0224712_10015763 3300022467 Bacteria 2466
183 Ga0224712_10266907 3300022467 Bacteria 794
184 Ga0207656_10266385 3300025321 Bacteria 842
185 Ga0207682_10076374 3300025893 Bacteria 1427
186 Ga0207642_10324618 3300025899 Bacteria 900
187 Ga0207688_10032415 3300025901 Bacteria 2888
188 Ga0207685_10536175 3300025905 Bacteria 621
189 Ga0207643_10225341 3300025908 Bacteria 1149
190 Ga0207705_10418550 3300025909 Unclassified 1037
191 Ga0207707_10214379 3300025912 Bacteria 1676
192 Ga0207695_10012241 3300025913 Bacteria 10304
193 Ga0207671_11115375 3300025914 Bacteria 619
194 Ga0207693_10794319 3300025915 Bacteria 730
195 Ga0207693_11345426 3300025915 Bacteria 532
196 Ga0207663_10192738 3300025916 Bacteria 1464
197 Ga0207660_10159265 3300025917 Bacteria 1740
198 Ga0207662_10062077 3300025918 Bacteria 2245
199 Ga0207662_10983083 3300025918 Bacteria 599
200 Ga0207657_10049422 3300025919 Bacteria 3665
201 Ga0207657_10156515 3300025919 Bacteria 1853
202 Ga0207657_10173974 3300025919 Bacteria 1743
203 Ga0207649_10193170 3300025920 Bacteria 1433
204 Ga0207649_10724473 3300025920 Bacteria 772
205 Ga0207652_10805101 3300025921 Bacteria 834
206 Ga0207652_10955319 3300025921 Bacteria 755
207 Ga0207694_10164488 3300025924 Bacteria 1793
208 Ga0207694_10697766 3300025924 Bacteria 856
209 Ga0207694_11474799 3300025924 Bacteria 574
210 Ga0207659_10429043 3300025926 Bacteria 1110
211 Ga0207659_10640049 3300025926 Bacteria 908
212 Ga0207687_10138455 3300025927 Bacteria 1844
213 Ga0207687_10175539 3300025927 Bacteria 1656
214 Ga0207687_10323265 3300025927 Unclassified 1249
215 Ga0207700_10543686 3300025928 Bacteria 1030
216 Ga0207664_10976391 3300025929 Bacteria 759
217 Ga0207644_10940260 3300025931 Bacteria 725
218 Ga0207690_10084864 3300025932 Bacteria 2221
219 Ga0207690_10119414 3300025932 Bacteria 1912
220 Ga0207690_10571021 3300025932 Bacteria 921
221 Ga0207706_10959062 3300025933 Bacteria 720
222 Ga0207706_11005005 3300025933 Bacteria 701
223 Ga0207686_10044931 3300025934 Bacteria 2715
224 Ga0207686_10843462 3300025934 Bacteria 737
225 Ga0207709_10036555 3300025935 Bacteria 2911
226 Ga0207709_10623198 3300025935 Bacteria 856
227 Ga0207670_10714054 3300025936 Bacteria 831
228 Ga0207669_10038648 3300025937 Bacteria 2750
229 Ga0207669_10215238 3300025937 Bacteria 1406
230 Ga0207704_10321127 3300025938 Bacteria 1194
231 Ga0207691_10008053 3300025940 Bacteria 10125
232 Ga0207711_10027650 3300025941 Bacteria 4766
233 Ga0207711_10566054 3300025941 Bacteria 1060
234 Ga0207689_10699421 3300025942 Bacteria 855
235 Ga0207661_10014851 3300025944 Bacteria 5712
236 Ga0207661_10191550 3300025944 Bacteria 1793
237 Ga0207661_10438520 3300025944 Bacteria 1188
238 Ga0207661_10695091 3300025944 Bacteria 935
239 Ga0207679_10091704 3300025945 Bacteria 2352
240 Ga0207679_10105027 3300025945 Bacteria 2218
241 Ga0207679_10123497 3300025945 Bacteria 2065
242 Ga0207679_10578818 3300025945 Bacteria 1010
243 Ga0207679_10845802 3300025945 Bacteria 836
244 Ga0207667_10351210 3300025949 Bacteria 1504
245 Ga0207712_10153607 3300025961 Bacteria 1780
246 Ga0207712_10868404 3300025961 Bacteria 796
247 Ga0207640_10451827 3300025981 Bacteria 1059
248 Ga0207640_11604147 3300025981 Bacteria 586
249 Ga0207677_10062369 3300026023 Bacteria 2585
250 Ga0207677_10604915 3300026023 Bacteria 962
251 Ga0207703_10910452 3300026035 Bacteria 842
252 Ga0207703_11573997 3300026035 Bacteria 632
253 Ga0207639_10843816 3300026041 Bacteria 855
254 Ga0207639_10951851 3300026041 Bacteria 803
255 Ga0207678_10332796 3300026067 Bacteria 1308
256 Ga0207708_10000683 3300026075 Bacteria 25782
257 Ga0207708_10364982 3300026075 Bacteria 1188
258 Ga0207708_10492132 3300026075 Bacteria 1027
259 Ga0207702_10519392 3300026078 Bacteria 1162
260 Ga0207702_10828780 3300026078 Bacteria 915
261 Ga0207702_11155228 3300026078 Bacteria 768
262 Ga0207702_12206831 3300026078 Bacteria 539
263 Ga0207641_10776756 3300026088 Bacteria 947
264 Ga0207641_11881469 3300026088 Bacteria 600
265 Ga0207648_10001487 3300026089 Bacteria 25804
266 Ga0207648_11394719 3300026089 Bacteria 659
267 Ga0207648_12095965 3300026089 Bacteria 526
268 Ga0207676_10232634 3300026095 Bacteria 1648
269 Ga0207676_10396035 3300026095 Bacteria 1289
270 Ga0207676_10474845 3300026095 Bacteria 1183
271 Ga0207674_10057435 3300026116 Bacteria 3945
272 Ga0207674_11101271 3300026116 Bacteria 764
273 Ga0207675_100001951 3300026118 Bacteria 20596
274 Ga0207683_11317889 3300026121 Bacteria 668
275 Ga0207698_10660526 3300026142 Bacteria 1036
276 Ga0207698_10685122 3300026142 Bacteria 1019
277 Ga0207698_11666642 3300026142 Bacteria 653
278 Ga0307408_100059527 3300031548 Bacteria 2780
279 Ga0307405_10005608 3300031731 Bacteria 6071
280 Ga0307405_10672031 3300031731 Bacteria 854
281 Ga0307413_10184268 3300031824 Bacteria 1492
282 Ga0307410_10220312 3300031852 Bacteria 1459
283 Ga0307410_10323445 3300031852 Bacteria 1224
284 Ga0307406_10009565 3300031901 Bacteria 5443
285 Ga0307406_10101507 3300031901 Bacteria 1961
286 Ga0307407_10082726 3300031903 Bacteria 1946
287 Ga0307407_10192612 3300031903 Bacteria 1360
288 Ga0307412_10368129 3300031911 Bacteria 1160
289 Ga0307412_10982035 3300031911 Bacteria 745
290 Ga0307409_100007024 3300031995 Bacteria 6694
291 Ga0307409_100055339 3300031995 Bacteria 3062
292 Ga0307409_100439370 3300031995 Bacteria 1256
293 Ga0307409_101380350 3300031995 Bacteria 731
294 Ga0307416_100014939 3300032002 Bacteria 5342
295 Ga0307416_100232780 3300032002 Bacteria 1778
296 Ga0307416_100357840 3300032002 Bacteria 1480
297 Ga0307414_10192393 3300032004 Bacteria 1652
298 Ga0307414_10732422 3300032004 Bacteria 897
299 Ga0307411_11012800 3300032005 Bacteria 744
300 Ga0307411_11088592 3300032005 Bacteria 720
301 Ga0307411_11542803 3300032005 Bacteria 611
302 Ga0307415_100000024 3300032126 Bacteria 64415
303 Ga0307415_100070730 3300032126 Bacteria 2451
304 Ga0307507_10525146 3300033179 Bacteria 631
305 Ga0373926_0112357 3300035083 Bacteria 1024
306 Ga0373952_0091980 3300035092 Bacteria 789
307 Ga0373943_0034108 3300035170 Bacteria 2427
308 Ga0373931_0127018 3300035691 Bacteria 1464
309 Ga0373935_0809395 3300035692 Bacteria 692
310 Ga0373925_0393155 3300037068 Bacteria 1130
311 Ga0395901_0250088 3300038443 Bacteria 1847
312 Ga0436365_0362837 3300039437 Bacteria 1024
313 Ga0451793_0741369 3300041452 Bacteria 815
314 Ga0451797_0975874 3300041453 Bacteria 507
315 Ga0451833_1250704 3300041491 Bacteria 685
316 Ga0451833_1390094 3300041491 Bacteria 2478
317 Ga0451841_0795765 3300041498 Bacteria 614
318 Ga0466965_0107095 3300044683 Bacteria 1434
319 Ga0466965_0185114 3300044683 Bacteria 1100
320 Ga0466963_0246328 3300044694 Bacteria 1254
321 Ga0466964_0066054 3300044706 Bacteria 1517
322 Ga0466971_0018508 3300044719 Bacteria 3085
323 Ga0466968_0667734 3300044735 Bacteria 529
324 Ga0466970_0727014 3300044765 Bacteria 580
325 Ga0466957_0018276 3300044842 Bacteria 4116
326 Ga0466957_0117882 3300044842 Bacteria 1690
327 Ga0466957_0416487 3300044842 Bacteria 921
328 Ga0466957_0626045 3300044842 Bacteria 755
329 Ga0466957_0720173 3300044842 Bacteria 705
330 Ga0466960_0018026 3300044901 Bacteria 3088
331 Ga0466960_0024809 3300044901 Bacteria 2708
332 Ga0466959_0523500 3300045049 Bacteria 801
333 Ga0466958_0002768 3300045836 Bacteria 8909
334 Ga0466967_0018767 3300045976 Bacteria 5539
335 Ga0466967_0028907 3300045976 Bacteria 4634
336 Ga0466967_0228954 3300045976 Bacteria 1769
337 Ga0466967_0489357 3300045976 Bacteria 1206
338 Ga0466967_0590336 3300045976 Bacteria 1096
339 Ga0466967_0952273 3300045976 Bacteria 854
340 Ga0495629_0030719 3300046459 Bacteria 3807
341 Ga0495651_0501597 3300046462 Bacteria 777
342 Ga0495662_0270134 3300046476 Bacteria 837
343 Ga0495664_0065146 3300046477 Bacteria 2172
344 Ga0495630_0423138 3300046517 Bacteria 1020
345 Ga0495652_0908978 3300046529 Bacteria 580
346 Ga0495621_0159827 3300046539 Bacteria 891
347 Ga0495646_0504961 3300046680 Bacteria 621
348 Ga0495658_1093682 3300046683 Bacteria 508
349 Ga0495593_0082289 3300047673 Bacteria 1664
350 Ga0496100_0131450 3300048903 Bacteria 1764
351 Ga0496100_0306581 3300048903 Bacteria 1189
352 Ga0496101_0028171 3300048904 Bacteria 3920
353 Ga0496102_0009177 3300048905 Bacteria 8482
354 Ga0496102_1501837 3300048905 Bacteria 592
355 Ga0496103_0005755 3300048906 Bacteria 7398
356 Ga0496104_0029438 3300048907 Bacteria 5094
357 Ga0496104_0128133 3300048907 Bacteria 2437
358 Ga0496104_1331980 3300048907 Bacteria 621
359 Ga0496105_0043523 3300048908 Bacteria 3703
360 Ga0496105_0694499 3300048908 Bacteria 782
361 Ga0496105_0712237 3300048908 Bacteria 770
362 Ga0496106_0031239 3300048909 Bacteria 3967
363 Ga0496107_0106580 3300048910 Bacteria 2058
364 Ga0496107_0164703 3300048910 Bacteria 1644
365 Ga0496108_0021321 3300048911 Bacteria 5325
366 Ga0496108_0047013 3300048911 Bacteria 3607
367 Ga0496108_0199201 3300048911 Bacteria 1737
368 Ga0496108_0482412 3300048911 Bacteria 1083
369 Ga0496108_1262287 3300048911 Bacteria 623
370 Ga0496109_0019048 3300048912 Bacteria 6045
371 Ga0496109_0056203 3300048912 Bacteria 3591
372 Ga0496109_0064690 3300048912 Bacteria 3347
373 Ga0496109_0741389 3300048912 Bacteria 920
374 Ga0496109_0799932 3300048912 Bacteria 881
375 Ga0496109_1221529 3300048912 Bacteria 688
376 Ga0496110_0090060 3300048913 Bacteria 2743
377 Ga0496110_0098988 3300048913 Bacteria 2614
378 Ga0496110_0143327 3300048913 Bacteria 2160
379 Ga0496111_0022830 3300048914 Bacteria 4384
380 Ga0496111_0219283 3300048914 Bacteria 1413
381 Ga0496111_0220268 3300048914 Bacteria 1410
382 Ga0496111_0239162 3300048914 Bacteria 1348
383 Ga0496112_0183015 3300048915 Bacteria 2059
384 Ga0496112_0200282 3300048915 Bacteria 1956
385 Ga0496112_0390685 3300048915 Bacteria 1331
386 Ga0496112_1387258 3300048915 Bacteria 617
387 Ga0496113_0004003 3300048916 Bacteria 8961
388 Ga0496113_0169342 3300048916 Bacteria 1729
389 Ga0496113_0549064 3300048916 Bacteria 927
390 Ga0496113_0760554 3300048916 Bacteria 771
391 Ga0496114_0148770 3300048917 Bacteria 2031
392 Ga0496114_0245174 3300048917 Bacteria 1576
393 Ga0496114_0277253 3300048917 Bacteria 1478
394 Ga0496115_0077625 3300048918 Bacteria 2701
395 Ga0501306_006070 3300049127 Bacteria 1406
396 Ga0501309_027439 3300049129 Bacteria 826
397 Ga0501310_005568 3300049130 Bacteria 1296
398 Ga0501304_006126 3300049160 Bacteria 962
399 Ga0501305_037078 3300049161 Bacteria 781
400 Ga0501307_006394 3300049162 Bacteria 1272
401 Ga0501298_019874 3300049521 Bacteria 1247
402 Ga0501311_005008 3300049527 Bacteria 1433
403 Ga0501312_007791 3300049528 Bacteria 1374
404 Ga0501313_008735 3300049529 Bacteria 1133
405 Ga0501314_003853 3300049530 Bacteria 1223
406 Ga0501315_004116 3300049531 Bacteria 1500
407 Ga0501316_003837 3300049532 Bacteria 1483
408 Ga0501317_004301 3300049533 Bacteria 1475
409 Ga0501318_000215 3300049534 Bacteria 3141
410 Ga0501318_022430 3300049534 Bacteria 809
411 Ga0501319_004138 3300049535 Bacteria 999
412 Ga0501320_008764 3300049536 Bacteria 1002
413 Ga0501321_000565 3300049537 Bacteria 2459
414 Ga0501321_054976 3300049537 Bacteria 590
415 Ga0501324_003725 3300049540 Bacteria 1183
416 Ga0501031_1016371 3300049568 Bacteria 530
417 Ga0501032_0051987 3300049569 Bacteria 2761
418 Ga0501033_0167295 3300049570 Bacteria 1580
419 Ga0501036_0245941 3300049572 Bacteria 1499
420 Ga0501037_0008775 3300049573 Bacteria 7412
421 Ga0501038_0150948 3300049574 Bacteria 1894
422 Ga0501038_0976233 3300049574 Bacteria 623
423 Ga0501039_0014688 3300049575 Bacteria 5990
424 Ga0501040_0064161 3300049576 Bacteria 2528
425 Ga0501041_0326265 3300049577 Bacteria 968
426 Ga0501042_0069337 3300049578 Bacteria 2521
427 Ga0501043_0255027 3300049579 Bacteria 1350
428 Ga0501046_0253726 3300049580 Bacteria 1294
429 Ga0501048_0049835 3300049582 Bacteria 2983
430 Ga0501067_0049061 3300049583 Bacteria 2340
431 Ga0501067_0482291 3300049583 Bacteria 693
432 Ga0501069_0184716 3300049585 Bacteria 1206
433 Ga0501070_0348510 3300049586 Bacteria 1202
434 Ga0501071_0062198 3300049587 Bacteria 2704
435 Ga0501072_0012894 3300049588 Bacteria 6393
436 Ga0501073_0277521 3300049589 Bacteria 1156
437 Ga0501074_0114640 3300049590 Bacteria 1928
438 Ga0501075_0219160 3300049591 Bacteria 1451
439 Ga0501076_0121447 3300049592 Bacteria 2115
440 Ga0501077_0268357 3300049593 Bacteria 1085
441 Ga0501256_044843 3300049685 Bacteria 533
442 Ga0501259_039610 3300049688 Bacteria 922
443 Ga0501080_0096815 3300049742 Bacteria 2740
444 Ga0501081_0037711 3300049743 Bacteria 3299
445 Ga0501083_0390074 3300049744 Bacteria 906
446 Ga0501271_025082 3300049768 Bacteria 710
447 Ga0501035_0067343 3300049822 Bacteria 3178
448 Ga0501044_0614136 3300049823 Bacteria 979
449 Ga0501045_0024171 3300049824 Bacteria 4361
450 nmdc:mga0yw44_115570_c1 3300050492 Bacteria 1724
451 nmdc:mga0yw44_253046_c1 3300050492 Bacteria 1173
452 nmdc:mga0yw44_829975_c1 3300050492 Bacteria 627
453 nmdc:mga06z11_108429_c1 3300050494 Bacteria 1534
454 nmdc:mga05p37_1860510_c1 3300050507 Bacteria 577
455 nmdc:mga05p37_85139_c1 3300050507 Bacteria 3895
456 nmdc:mga09592_531598_c1 3300050508 Bacteria 1011
457 nmdc:mga0qj67_242136_c1 3300050509 Bacteria 1463
458 nmdc:mga08y16_192550_c1 3300050511 Bacteria 2115
459 nmdc:mga08y16_729838_c1 3300050511 Bacteria 988
460 nmdc:mga0n895_510756_c1 3300050512 Bacteria 1210
461 nmdc:mga0rr50_826454_c1 3300050513 Bacteria 790
462 nmdc:mga08x19_652354_c1 3300050514 Bacteria 746
463 Ga0495601_0306425 3300053077 Bacteria 1034
464 Ga0495619_0385333 3300053085 Bacteria 969
465 Ga0495619_0397605 3300053085 Bacteria 952
466 Ga0500646_0000329 3300053090 Bacteria 14259
467 Ga0500641_0044963 3300053096 Bacteria 1797
468 Ga0500650_0486579 3300053098 Bacteria 526
469 Ga0500568_0196413 3300053139 Bacteria 740
470 Ga0500588_0000316 3300053146 Bacteria 7246
471 Ga0501084_0171282 3300054114 Bacteria 1832
472 Ga0501082_0076752 3300060353 Bacteria 2880
473 Ga0466962_0026397 3300061719 Bacteria 2789
474 Ga0466962_0131784 3300061719 Bacteria 1208
475 Ga0530510_0023933 3300061734 Bacteria 4355
476 Ga0530510_0106974 3300061734 Bacteria 2047
477 Ga0530510_0340481 3300061734 Bacteria 1126
478 Ga0530510_1331394 3300061734 Bacteria 551
479 2626638253 2626541554 Bacteria 7741902
480 2644457261 2643221681 Bacteria 3707866
481 2644537660 2643221697 Bacteria 3575694
482 2855387109 2855386786 Bacteria 4752232
483 2867511923 2867507094 Bacteria 6506033
484 2984594717 2984592036 Bacteria 3670284
485 Ga0207661_10698400
486 JGI24743J22301_10003335
487 JGI24738J21930_10003289
488 JGI24744J21845_10006044
489 Ga0007410J51695_1049598
490 Ga0007429J51699_1048047
491 Ga0058863_10012766
492 Ga0058862_12274282
493 Ga0070658_11248073
494 Ga0070683_100163525
495 Ga0070683_100219405
496 Ga0070683_100841795
497 Ga0070683_101000970
498 Ga0070677_10052900
499 Ga0070680_100305767
500 Ga0070682_100054234
501 Ga0070682_100211892
502 Ga0070682_100541188
503 Ga0070682_101273400
504 Ga0068868_100100492
505 Ga0070660_100496960
506 Ga0070660_100593102
507 Ga0070691_10026886
508 Ga0070687_100155223
509 Ga0070687_100647458
510 Ga0070661_100149916
511 Ga0070661_100682465
512 Ga0070692_10005419
513 Ga0070675_100236268
514 Ga0070675_100727409
515 Ga0070674_100027985
516 Ga0070688_100392118
517 Ga0070659_100038079
518 Ga0070659_100307223
519 Ga0070659_100579383
520 Ga0070713_100359917
521 Ga0070710_11359223
522 Ga0070711_101217152
523 Ga0070705_100904999
524 Ga0070700_100004014
525 Ga0070700_101091307
526 Ga0070694_101237738
527 Ga0070663_100284449
528 Ga0070678_100313749
529 Ga0070662_101660379
530 Ga0070662_101924907
531 Ga0070681_10256024
532 Ga0068867_100005752
533 Ga0068867_100931053
534 Ga0068867_101454560
535 Ga0070685_10062743
536 Ga0070685_10460428
537 Ga0070684_100046193
538 Ga0070684_100226368
539 Ga0070684_100243180
540 Ga0070684_100281459
541 Ga0070684_100704231
542 Ga0068853_100033108
543 Ga0068853_101995867
544 Ga0070672_100287907
545 Ga0070672_100708112
546 Ga0070672_100842693
547 Ga0070686_100329017
548 Ga0070686_101009191
549 Ga0070693_100118231
550 Ga0068855_100373071
551 Ga0070664_100045200
552 Ga0070664_100216736
553 Ga0070664_100303649
554 Ga0070664_100483232
555 Ga0070664_100906156
556 Ga0070664_101737292
557 Ga0068854_100176495
558 Ga0068856_100541248
559 Ga0068856_100911815
560 Ga0070702_100005872
561 Ga0070702_100188063
562 Ga0068852_100010251
563 Ga0068852_100217170
564 Ga0068852_100369093
565 Ga0068852_101573906
566 Ga0068852_102518279
567 Ga0068859_100764373
568 Ga0068864_100229378
569 Ga0068864_100426354
570 Ga0068864_101783492
571 Ga0068866_11114944
572 Ga0068861_100019601
573 Ga0068851_10405715
574 Ga0068870_10219543
575 Ga0068863_100236929
576 Ga0068863_101363074
577 Ga0068858_100693528
578 Ga0070717_10907466
579 Ga0075365_10425665
580 Ga0075363_100156877
581 Ga0075364_10789133
582 Ga0070716_100645429
583 Ga0070712_100850512
584 Ga0070712_100861309
585 Ga0068871_101809578
586 Ga0075428_101295157
587 Ga0075434_100285859
588 Ga0075429_100755229
589 Ga0075429_101057836
590 Ga0068865_100297497
591 Ga0068865_101141158
592 Ga0075436_100859729
593 Ga0097620_100764261
594 Ga0075435_101437071
595 Ga0105240_10000850
596 Ga0105240_10064371
597 Ga0111539_10083467
598 Ga0111539_10656190
599 Ga0105245_10117386
600 Ga0105245_10331716
601 Ga0105245_10448938
602 Ga0105245_11430180
603 Ga0105245_13252665
604 Ga0105247_11313788
605 Ga0114129_10285387
606 Ga0114129_10296049
607 Ga0114129_10608674
608 Ga0114129_11360862
609 Ga0105243_10006135
610 Ga0105243_10743746
611 Ga0105242_10157849
612 Ga0105248_10067785
613 Ga0105248_10139960
614 Ga0105237_10739979
615 Ga0105237_10787747
616 Ga0105237_11853736
617 Ga0105238_10029965
618 Ga0105238_11035442
619 Ga0105238_11109312
620 Ga0105238_11531507
621 Ga0105249_10212197
622 Ga0105249_11539342
623 Ga0105239_10232600
624 Ga0105239_10744725
625 Ga0105239_11451120
626 Ga0105239_12800789
627 Ga0105246_10315603
628 Ga0105246_10619940
629 Ga0105246_10716498
630 Ga0157371_10365321
631 Ga0157369_10397422
632 Ga0157374_10451104
633 Ga0157374_10897792
634 Ga0157374_11733535
635 Ga0157378_12392570
636 Ga0157372_10161372
637 Ga0157372_10218379
638 Ga0157372_12774937
639 Ga0163163_10187477
640 Ga0163163_12177382
641 Ga0157380_10346444
642 Ga0157380_11012442
643 Ga0157380_11466689
644 Ga0157377_10307132
645 Ga0157377_10388231
646 Ga0157379_10089847
647 Ga0157379_10578545
648 Ga0157379_12346208
649 Ga0157376_10610181
650 Ga0197907_10671537
651 Ga0206356_10181786
652 Ga0206356_10439904
653 Ga0206356_11161419
654 Ga0206349_1390947
655 Ga0206351_10415200
656 Ga0206352_10503881
657 Ga0206352_11174157
658 Ga0206350_11157620
659 Ga0206354_10189804
660 Ga0206354_10689340
661 Ga0206354_10856493
662 Ga0206353_11204907
663 Ga0206353_11817219
664 Ga0154015_1642176
665 Ga0213876_10603966
666 Ga0224712_10015763
667 Ga0224712_10266907
668 Ga0207656_10266385
669 Ga0207682_10076374
670 Ga0207642_10324618
671 Ga0207688_10032415
672 Ga0207685_10536175
673 Ga0207643_10225341
674 Ga0207705_10418550
675 Ga0207707_10214379
676 Ga0207695_10012241
677 Ga0207671_11115375
678 Ga0207693_10794319
679 Ga0207693_11345426
680 Ga0207663_10192738
681 Ga0207660_10159265
682 Ga0207662_10062077
683 Ga0207662_10983083
684 Ga0207657_10049422
685 Ga0207657_10156515
686 Ga0207657_10173974
687 Ga0207649_10193170
688 Ga0207649_10724473
689 Ga0207652_10805101
690 Ga0207652_10955319
691 Ga0207694_10164488
692 Ga0207694_10697766
693 Ga0207694_11474799
694 Ga0207659_10429043
695 Ga0207659_10640049
696 Ga0207687_10138455
697 Ga0207687_10175539
698 Ga0207687_10323265
699 Ga0207700_10543686
700 Ga0207664_10976391
701 Ga0207644_10940260
702 Ga0207690_10084864
703 Ga0207690_10119414
704 Ga0207690_10571021
705 Ga0207706_10959062
706 Ga0207706_11005005
707 Ga0207686_10044931
708 Ga0207686_10843462
709 Ga0207709_10036555
710 Ga0207709_10623198
711 Ga0207670_10714054
712 Ga0207669_10038648
713 Ga0207669_10215238
714 Ga0207704_10321127
715 Ga0207691_10008053
716 Ga0207711_10027650
717 Ga0207711_10566054
718 Ga0207689_10699421
719 Ga0207661_10014851
720 Ga0207661_10191550
721 Ga0207661_10438520
722 Ga0207661_10695091
723 Ga0207679_10091704
724 Ga0207679_10105027
725 Ga0207679_10123497
726 Ga0207679_10578818
727 Ga0207679_10845802
728 Ga0207667_10351210
729 Ga0207712_10153607
730 Ga0207712_10868404
731 Ga0207640_10451827
732 Ga0207640_11604147
733 Ga0207677_10062369
734 Ga0207677_10604915
735 Ga0207703_10910452
736 Ga0207703_11573997
737 Ga0207639_10843816
738 Ga0207639_10951851
739 Ga0207678_10332796
740 Ga0207708_10000683
741 Ga0207708_10364982
742 Ga0207708_10492132
743 Ga0207702_10519392
744 Ga0207702_10828780
745 Ga0207702_11155228
746 Ga0207702_12206831
747 Ga0207641_10776756
748 Ga0207641_11881469
749 Ga0207648_10001487
750 Ga0207648_11394719
751 Ga0207648_12095965
752 Ga0207676_10232634
753 Ga0207676_10396035
754 Ga0207676_10474845
755 Ga0207674_10057435
756 Ga0207674_11101271
757 Ga0207675_100001951
758 Ga0207683_11317889
759 Ga0207698_10660526
760 Ga0207698_10685122
761 Ga0207698_11666642
762 Ga0307408_100059527
763 Ga0307405_10005608
764 Ga0307405_10672031
765 Ga0307413_10184268
766 Ga0307410_10220312
767 Ga0307410_10323445
768 Ga0307406_10009565
769 Ga0307406_10101507
770 Ga0307407_10082726
771 Ga0307407_10192612
772 Ga0307412_10368129
773 Ga0307412_10982035
774 Ga0307409_100007024
775 Ga0307409_100055339
776 Ga0307409_100439370
777 Ga0307409_101380350
778 Ga0307416_100014939
779 Ga0307416_100232780
780 Ga0307416_100357840
781 Ga0307414_10192393
782 Ga0307414_10732422
783 Ga0307411_11012800
784 Ga0307411_11088592
785 Ga0307411_11542803
786 Ga0307415_100000024
787 Ga0307415_100070730
788 Ga0307507_10525146
789 Ga0373926_0112357
790 Ga0373952_0091980
791 Ga0373943_0034108
792 Ga0373931_0127018
793 Ga0373935_0809395
794 Ga0373925_0393155
795 Ga0395901_0250088
796 Ga0436365_0362837
797 Ga0451793_0741369
798 Ga0451797_0975874
799 Ga0451833_1250704
800 Ga0451833_1390094
801 Ga0451841_0795765
802 Ga0466965_0107095
803 Ga0466965_0185114
804 Ga0466963_0246328
805 Ga0466964_0066054
806 Ga0466971_0018508
807 Ga0466968_0667734
808 Ga0466970_0727014
809 Ga0466957_0018276
810 Ga0466957_0117882
811 Ga0466957_0416487
812 Ga0466957_0626045
813 Ga0466957_0720173
814 Ga0466960_0018026
815 Ga0466960_0024809
816 Ga0466959_0523500
817 Ga0466958_0002768
818 Ga0466967_0018767
819 Ga0466967_0028907
820 Ga0466967_0228954
821 Ga0466967_0489357
822 Ga0466967_0590336
823 Ga0466967_0952273
824 Ga0495629_0030719
825 Ga0495651_0501597
826 Ga0495662_0270134
827 Ga0495664_0065146
828 Ga0495630_0423138
829 Ga0495652_0908978
830 Ga0495621_0159827
831 Ga0495646_0504961
832 Ga0495658_1093682
833 Ga0495593_0082289
834 Ga0496100_0131450
835 Ga0496100_0306581
836 Ga0496101_0028171
837 Ga0496102_0009177
838 Ga0496102_1501837
839 Ga0496103_0005755
840 Ga0496104_0029438
841 Ga0496104_0128133
842 Ga0496104_1331980
843 Ga0496105_0043523
844 Ga0496105_0694499
845 Ga0496105_0712237
846 Ga0496106_0031239
847 Ga0496107_0106580
848 Ga0496107_0164703
849 Ga0496108_0021321
850 Ga0496108_0047013
851 Ga0496108_0199201
852 Ga0496108_0482412
853 Ga0496108_1262287
854 Ga0496109_0019048
855 Ga0496109_0056203
856 Ga0496109_0064690
857 Ga0496109_0741389
858 Ga0496109_0799932
859 Ga0496109_1221529
860 Ga0496110_0090060
861 Ga0496110_0098988
862 Ga0496110_0143327
863 Ga0496111_0022830
864 Ga0496111_0219283
865 Ga0496111_0220268
866 Ga0496111_0239162
867 Ga0496112_0183015
868 Ga0496112_0200282
869 Ga0496112_0390685
870 Ga0496112_1387258
871 Ga0496113_0004003
872 Ga0496113_0169342
873 Ga0496113_0549064
874 Ga0496113_0760554
875 Ga0496114_0148770
876 Ga0496114_0245174
877 Ga0496114_0277253
878 Ga0496115_0077625
879 Ga0501306_006070
880 Ga0501309_027439
881 Ga0501310_005568
882 Ga0501304_006126
883 Ga0501305_037078
884 Ga0501307_006394
885 Ga0501298_019874
886 Ga0501311_005008
887 Ga0501312_007791
888 Ga0501313_008735
889 Ga0501314_003853
890 Ga0501315_004116
891 Ga0501316_003837
892 Ga0501317_004301
893 Ga0501318_000215
894 Ga0501318_022430
895 Ga0501319_004138
896 Ga0501320_008764
897 Ga0501321_000565
898 Ga0501321_054976
899 Ga0501324_003725
900 Ga0501031_1016371
901 Ga0501032_0051987
902 Ga0501033_0167295
903 Ga0501036_0245941
904 Ga0501037_0008775
905 Ga0501038_0150948
906 Ga0501038_0976233
907 Ga0501039_0014688
908 Ga0501040_0064161
909 Ga0501041_0326265
910 Ga0501042_0069337
911 Ga0501043_0255027
912 Ga0501046_0253726
913 Ga0501048_0049835
914 Ga0501067_0049061
915 Ga0501067_0482291
916 Ga0501069_0184716
917 Ga0501070_0348510
918 Ga0501071_0062198
919 Ga0501072_0012894
920 Ga0501073_0277521
921 Ga0501074_0114640
922 Ga0501075_0219160
923 Ga0501076_0121447
924 Ga0501077_0268357
925 Ga0501256_044843
926 Ga0501259_039610
927 Ga0501080_0096815
928 Ga0501081_0037711
929 Ga0501083_0390074
930 Ga0501271_025082
931 Ga0501035_0067343
932 Ga0501044_0614136
933 Ga0501045_0024171
934 nmdc:mga0yw44_115570_c1
935 nmdc:mga0yw44_253046_c1
936 nmdc:mga0yw44_829975_c1
937 nmdc:mga06z11_108429_c1
938 nmdc:mga05p37_1860510_c1
939 nmdc:mga05p37_85139_c1
940 nmdc:mga09592_531598_c1
941 nmdc:mga0qj67_242136_c1
942 nmdc:mga08y16_192550_c1
943 nmdc:mga08y16_729838_c1
944 nmdc:mga0n895_510756_c1
945 nmdc:mga0rr50_826454_c1
946 nmdc:mga08x19_652354_c1
947 Ga0495601_0306425
948 Ga0495619_0385333
949 Ga0495619_0397605
950 Ga0500646_0000329
951 Ga0500641_0044963
952 Ga0500650_0486579
953 Ga0500568_0196413
954 Ga0500588_0000316
955 Ga0501084_0171282
956 Ga0501082_0076752
957 Ga0466962_0026397
958 Ga0466962_0131784
959 Ga0530510_0023933
960 Ga0530510_0106974
961 Ga0530510_0340481
962 Ga0530510_1331394
963 2626638253
964 2644457261
965 2644537660
966 2855387109
967 2867511923
968 2984594717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

14

101

0.96

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

14

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9852 2 101
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9784 1 102
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9728 2 105
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9691 1 102
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9687 1 99
ID Description Score Start End Superfamily
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9784 1 102 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9691 1 102 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9687 1 99 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9612 1 101 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9606 4 100 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A3L8P311-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9978 1 101 GO:0046872
GO:0051537
AF-A0A6I3DSL0-F1-model_v4 deleted 0.9952 12 101
AF-A0A3M1MIM4-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9934 2 101 GO:0046872
GO:0051537
AF-A0A4Q5TE56-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9931 2 106 GO:0046872
GO:0051537
AF-A0A2C9BKM6-F1-model_v4 deleted 0.9931 2 101

Map