F452890

General Info

Members Datasets Scaffolds Average Seq Length
484 308 968 453

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100002136|Ga0070705_1000021362
Length 488
Sequence MSQALPPVSVAERLAERIAALQAGTAALKSERGQNRAVPSPLVGEGQGGGESRRCGGEGRAQLSGAARQTCENLVLDVIGLCVAARNQPYMQAALAAWDDEGPCTAIGHGRTLSAAGAAFVNGTAAHGEDFDDTFEGGPVHAGAVVVPAVLAACERYARTGEAALLGIAVGAETLCRLSLVAPRLIHRAGFHPTAVLGAVGAAVGLDRRQIVDALGIAGSMASGIIEYLAEGAWTKRLHPGWAAQAGLRAALLAKHGFVGPRTVIEGTHGLFNAFAHTTAVDYDSLTEGFGERWLIETLAFKPYPCGTMTHPYIDCARRLAARGVAPGEIREMVCEAGEGTVHRLWEPLADKQRPPNGYAGKFSQPYCIARAFVRGNVGLDAFTDEAVRDSLVLELARKVSYVVDPANPYPRAFTGHIRVVLIDGRVVEERQPHIRGGAQEPLTRAEIEDKFRLCGRYGGWDDARTDAAVALARRLFDGESDLGVLRG

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
282 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
283 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
284 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
296 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
297 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
298 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
299 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
300 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
301 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
302 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
303 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
304 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
305 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
306 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
307 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
308 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.64
Nodule 0.62
Rhizoplane 7.02
Rhizosphere 83.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100002136 3300005440 Bacteria 10059
2 JGI25153J46596_10000010 3300003215 Bacteria 337769
3 JGI25160J50197_1000018 3300003354 Bacteria 239933
4 JGI25161J50226_1000020 3300003374 Bacteria 164844
5 Ga0055524_1003148 3300003775 Bacteria 8128
6 Ga0055528_1000721 3300003790 Bacteria 23354
7 Ga0055543_1000004 3300004625 Bacteria 239971
8 Ga0065165_1000065 3300005262 Bacteria 174075
9 Ga0070690_100019427 3300005330 Bacteria 4123
10 Ga0070690_100025142 3300005330 Bacteria 3666
11 Ga0070670_100125149 3300005331 Bacteria 2219
12 Ga0070670_100171971 3300005331 Bacteria 1879
13 Ga0068869_100028381 3300005334 Bacteria 3909
14 Ga0068868_100036161 3300005338 Bacteria 3820
15 Ga0070689_100022884 3300005340 Bacteria 4671
16 Ga0070691_10001323 3300005341 Bacteria 10537
17 Ga0070687_100056927 3300005343 Bacteria 2048
18 Ga0070692_10048226 3300005345 Bacteria 2206
19 Ga0070668_100084123 3300005347 Bacteria 2498
20 Ga0070669_100070123 3300005353 Bacteria 2591
21 Ga0070675_100046883 3300005354 Bacteria 3540
22 Ga0070688_100018515 3300005365 Bacteria 4020
23 Ga0070659_100077319 3300005366 Bacteria 2654
24 Ga0070714_100010606 3300005435 Bacteria 7290
25 Ga0070713_100058585 3300005436 Bacteria 3212
26 Ga0070701_10061068 3300005438 Bacteria 1987
27 Ga0070711_100013485 3300005439 Bacteria 5133
28 Ga0070700_100013806 3300005441 Bacteria 4544
29 Ga0070694_100006148 3300005444 Bacteria 7288
30 Ga0070708_100000142 3300005445 Bacteria 49401
31 Ga0070663_100051932 3300005455 Bacteria 2922
32 Ga0070678_100032389 3300005456 Bacteria 3618
33 Ga0070678_100045899 3300005456 Bacteria 3129
34 Ga0070678_100200102 3300005456 Bacteria 1648
35 Ga0070685_10118106 3300005466 Bacteria 1643
36 Ga0070706_100108083 3300005467 Bacteria 2588
37 Ga0070707_100068960 3300005468 Bacteria 3404
38 Ga0070699_100003531 3300005518 Bacteria 13822
39 Ga0070699_100005255 3300005518 Bacteria 11370
40 Ga0070699_100169789 3300005518 Bacteria 1932
41 Ga0070679_100081126 3300005530 Bacteria 3233
42 Ga0070679_100122432 3300005530 Bacteria 2585
43 Ga0070697_100007169 3300005536 Bacteria 8673
44 Ga0070697_100126423 3300005536 Bacteria 2142
45 Ga0070697_100220492 3300005536 Bacteria 1616
46 Ga0068853_100058533 3300005539 Bacteria 3326
47 Ga0070672_100087235 3300005543 Bacteria 2511
48 Ga0070695_100005494 3300005545 Bacteria 7467
49 Ga0070695_100024759 3300005545 Bacteria 3701
50 Ga0070696_100004630 3300005546 Bacteria 9185
51 Ga0070665_100141860 3300005548 Bacteria 2405
52 Ga0070704_100062326 3300005549 Bacteria 2672
53 Ga0068855_100008088 3300005563 Bacteria 12708
54 Ga0068855_100013438 3300005563 Bacteria 9871
55 Ga0068857_100003412 3300005577 Bacteria 13243
56 Ga0068856_100052668 3300005614 Bacteria 4014
57 Ga0068856_100118286 3300005614 Bacteria 2651
58 Ga0070702_100009081 3300005615 Bacteria 4851
59 Ga0068852_100008649 3300005616 Bacteria 7522
60 Ga0068859_100031478 3300005617 Bacteria 5327
61 Ga0068859_100031649 3300005617 Bacteria 5312
62 Ga0068864_100049926 3300005618 Bacteria 3600
63 Ga0068864_100147420 3300005618 Bacteria 2129
64 Ga0068866_10013844 3300005718 Bacteria 3547
65 Ga0068870_10021984 3300005840 Bacteria 3130
66 Ga0068863_100021511 3300005841 Bacteria 6155
67 Ga0068860_100135925 3300005843 Bacteria 2361
68 Ga0068862_100021766 3300005844 Bacteria 5361
69 Ga0068862_100024885 3300005844 Bacteria 5023
70 Ga0081455_10015313 3300005937 Bacteria 7456
71 Ga0081455_10029876 3300005937 Bacteria 4963
72 Ga0081538_10007242 3300005981 Bacteria 9620
73 Ga0081540_1019281 3300005983 Bacteria 4152
74 Ga0081539_10000012 3300005985 Bacteria 440369
75 Ga0081539_10002229 3300005985 Bacteria 28273
76 Ga0075365_10008563 3300006038 Bacteria 5821
77 Ga0075365_10061537 3300006038 Bacteria 2507
78 Ga0075368_10022279 3300006042 Bacteria 2411
79 Ga0070715_10011087 3300006163 Bacteria 3234
80 Ga0070715_10051940 3300006163 Bacteria 1766
81 Ga0070716_100008399 3300006173 Bacteria 5121
82 Ga0068871_100063366 3300006358 Bacteria 3023
83 Ga0075428_100078334 3300006844 Bacteria 3608
84 Ga0075430_100015121 3300006846 Bacteria 6569
85 Ga0075431_100000995 3300006847 Bacteria 25251
86 Ga0075431_100178090 3300006847 Bacteria 2183
87 Ga0075433_10016463 3300006852 Bacteria 6096
88 Ga0075434_100001081 3300006871 Bacteria 22315
89 Ga0075434_100001146 3300006871 Bacteria 21889
90 Ga0075434_100046319 3300006871 Bacteria 4315
91 Ga0075434_100170356 3300006871 Bacteria 2197
92 Ga0075434_100178921 3300006871 Bacteria 2140
93 Ga0075436_100001269 3300006914 Bacteria 17145
94 Ga0075436_100004460 3300006914 Bacteria 9605
95 Ga0097620_100031478 3300006931 Bacteria 5327
96 Ga0097620_100031650 3300006931 Bacteria 5312
97 Ga0075435_100002439 3300007076 Bacteria 12345
98 Ga0099794_10001312 3300007265 Bacteria 8649
99 Ga0111539_10004506 3300009094 Bacteria 18215
100 Ga0111539_10021144 3300009094 Bacteria 8013
101 Ga0111539_10034808 3300009094 Bacteria 6102
102 Ga0111539_10149980 3300009094 Bacteria 2729
103 Ga0105247_10024302 3300009101 Bacteria 3650
104 Ga0114129_10013551 3300009147 Bacteria 11618
105 Ga0114129_10045213 3300009147 Bacteria 6190
106 Ga0114129_10071734 3300009147 Bacteria 4829
107 Ga0105243_10008030 3300009148 Bacteria 8102
108 Ga0105237_10047966 3300009545 Bacteria 4294
109 Ga0105238_10332295 3300009551 Bacteria 1507
110 Ga0105249_10063681 3300009553 Bacteria 3388
111 Ga0105249_10075583 3300009553 Bacteria 3120
112 Ga0157375_10046974 3300013308 Bacteria 4213
113 Ga0163163_10039234 3300014325 Bacteria 4621
114 Ga0157380_10030383 3300014326 Bacteria 4137
115 Ga0157380_10129727 3300014326 Bacteria 2149
116 Ga0157379_10038294 3300014968 Bacteria 4279
117 Ga0209455_1000494 3300025272 Bacteria 28781
118 Ga0209673_1000138 3300025273 Bacteria 158321
119 Ga0209130_1000035 3300025284 Bacteria 296161
120 Ga0209025_1006066 3300025294 Bacteria 9556
121 Ga0209564_1022721 3300025295 Bacteria 2204
122 Ga0209758_1000033 3300025297 Bacteria 469998
123 Ga0209256_1003268 3300025299 Bacteria 11623
124 Ga0207426_1000017 3300025302 Bacteria 577913
125 Ga0207653_10000916 3300025885 Bacteria 9775
126 Ga0207642_10003570 3300025899 Bacteria 4931
127 Ga0207710_10009678 3300025900 Bacteria 4051
128 Ga0207688_10000135 3300025901 Bacteria 31221
129 Ga0207647_10010263 3300025904 Bacteria 6617
130 Ga0207699_10079653 3300025906 Bacteria 2027
131 Ga0207645_10030498 3300025907 Bacteria 3474
132 Ga0207643_10004358 3300025908 Bacteria 7606
133 Ga0207684_10012097 3300025910 Bacteria 7514
134 Ga0207671_10146441 3300025914 Bacteria 1822
135 Ga0207663_10062138 3300025916 Bacteria 2373
136 Ga0207660_10036111 3300025917 Bacteria 3435
137 Ga0207662_10118737 3300025918 Bacteria 1656
138 Ga0207657_10073794 3300025919 Bacteria 2882
139 Ga0207649_10099177 3300025920 Bacteria 1924
140 Ga0207646_10119708 3300025922 Bacteria 2365
141 Ga0207694_10032128 3300025924 Bacteria 4016
142 Ga0207650_10008691 3300025925 Bacteria 6935
143 Ga0207650_10107676 3300025925 Bacteria 2153
144 Ga0207659_10026827 3300025926 Bacteria 3893
145 Ga0207700_10004698 3300025928 Bacteria 8093
146 Ga0207700_10064369 3300025928 Bacteria 2793
147 Ga0207690_10134090 3300025932 Bacteria 1816
148 Ga0207706_10044820 3300025933 Bacteria 3919
149 Ga0207709_10033321 3300025935 Bacteria 3024
150 Ga0207670_10007206 3300025936 Bacteria 6197
151 Ga0207704_10009950 3300025938 Bacteria 4614
152 Ga0207665_10006915 3300025939 Bacteria 7508
153 Ga0207691_10018822 3300025940 Bacteria 6540
154 Ga0207689_10011802 3300025942 Bacteria 7483
155 Ga0207661_10128409 3300025944 Bacteria 2168
156 Ga0207679_10038841 3300025945 Bacteria 3396
157 Ga0207667_10058895 3300025949 Bacteria 4026
158 Ga0207712_10009027 3300025961 Bacteria 6307
159 Ga0207658_10106840 3300025986 Bacteria 2205
160 Ga0207677_10014112 3300026023 Bacteria 4653
161 Ga0207703_10017422 3300026035 Bacteria 5607
162 Ga0207678_10001748 3300026067 Bacteria 19890
163 Ga0207678_10045581 3300026067 Bacteria 3792
164 Ga0207708_10000891 3300026075 Bacteria 22428
165 Ga0207708_10023443 3300026075 Bacteria 4665
166 Ga0207702_10085537 3300026078 Bacteria 2748
167 Ga0207641_10100254 3300026088 Bacteria 2550
168 Ga0207676_10020054 3300026095 Bacteria 4886
169 Ga0207676_10059460 3300026095 Bacteria 3018
170 Ga0207674_10002799 3300026116 Bacteria 21723
171 Ga0207675_100007361 3300026118 Bacteria 10400
172 Ga0207683_10007749 3300026121 Bacteria 9191
173 Ga0207683_10041191 3300026121 Bacteria 4032
174 Ga0207683_10044319 3300026121 Bacteria 3889
175 Ga0207698_10051289 3300026142 Bacteria 3153
176 Ga0207428_10008432 3300027907 Bacteria 9304
177 Ga0207428_10122313 3300027907 Bacteria 1995
178 Ga0268266_10070933 3300028379 Bacteria 3019
179 Ga0268265_10008198 3300028380 Bacteria 7058
180 Ga0268265_10039041 3300028380 Bacteria 3496
181 Ga0268264_10001838 3300028381 Bacteria 19352
182 Ga0268264_10104167 3300028381 Bacteria 2472
183 Ga0265337_1000691 3300028556 Bacteria 17795
184 Ga0265334_10002246 3300028573 Bacteria 9081
185 Ga0265338_10029750 3300028800 Bacteria 5405
186 Ga0307513_10058302 3300031456 Bacteria 4106
187 Ga0307513_10182493 3300031456 Bacteria 1960
188 Ga0265314_10001634 3300031711 Bacteria 24559
189 Ga0265342_10001205 3300031712 Bacteria 24521
190 Ga0373944_0003925 3300035089 Bacteria 3852
191 Ga0373923_0000267 3300035111 Bacteria 11360
192 Ga0373945_0029881 3300035116 Bacteria 1917
193 Ga0373954_0006992 3300035118 Bacteria 4925
194 Ga0373956_0023510 3300035119 Bacteria 2646
195 Ga0373943_0005794 3300035170 Bacteria 5549
196 Ga0373943_0044190 3300035170 Bacteria 2167
197 Ga0373946_0047892 3300035171 Bacteria 1777
198 Ga0373955_0000191 3300035172 Bacteria 25296
199 Ga0373955_0005711 3300035172 Bacteria 5604
200 Ga0373924_0000239 3300035410 Bacteria 16754
201 Ga0373931_0011661 3300035691 Bacteria 4247
202 Ga0373935_0004920 3300035692 Bacteria 7850
203 Ga0373935_0024476 3300035692 Bacteria 3716
204 Ga0373927_0012591 3300035695 Bacteria 5630
205 Ga0373927_0013334 3300035695 Bacteria 5464
206 Ga0373927_0030641 3300035695 Bacteria 3509
207 Ga0373927_0037033 3300035695 Bacteria 3171
208 Ga0373927_0062775 3300035695 Bacteria 2402
209 Ga0373933_0002903 3300035724 Bacteria 9576
210 Ga0373947_0019274 3300035725 Bacteria 3932
211 Ga0373947_0069935 3300035725 Bacteria 2149
212 Ga0373947_0154873 3300035725 Bacteria 1478
213 Ga0373937_0000030 3300036401 Bacteria 122176
214 Ga0373937_0015209 3300036401 Bacteria 6800
215 Ga0373937_0027771 3300036401 Bacteria 5120
216 Ga0373937_0255958 3300036401 Bacteria 1650
217 Ga0316584_0018811 3300036712 Bacteria 4987
218 Ga0373925_0000501 3300037068 Bacteria 39530
219 Ga0373925_0060415 3300037068 Bacteria 2846
220 Ga0373925_0093388 3300037068 Bacteria 2303
221 Ga0373925_0132563 3300037068 Bacteria 1944
222 Ga0395899_0000314 3300037312 Bacteria 62037
223 Ga0395900_0000408 3300037418 Bacteria 62036
224 Ga0395898_0000666 3300037466 Bacteria 62036
225 Ga0395905_0000392 3300037471 Bacteria 62036
226 Ga0395901_0000292 3300038443 Bacteria 62036
227 Ga0436360_0540813 3300039438 Bacteria 2557
228 Ga0436361_0468034 3300039447 Bacteria 3400
229 Ga0495592_0000046 3300046454 Bacteria 117345
230 Ga0495603_0100439 3300046455 Bacteria 1689
231 Ga0495629_0016126 3300046459 Bacteria 5364
232 Ga0495638_0000238 3300046460 Bacteria 75287
233 Ga0495651_0029859 3300046462 Bacteria 4250
234 Ga0495651_0105194 3300046462 Bacteria 2094
235 Ga0495653_0000036 3300046463 Bacteria 129776
236 Ga0495580_0035408 3300046472 Bacteria 3590
237 Ga0495582_0022666 3300046473 Bacteria 3436
238 Ga0495662_0011334 3300046476 Bacteria 4356
239 Ga0495662_0032042 3300046476 Bacteria 2539
240 Ga0495662_0069301 3300046476 Bacteria 1708
241 Ga0495664_0000002 3300046477 Bacteria 625183
242 Ga0495585_0013074 3300046492 Bacteria 4868
243 Ga0495594_0021861 3300046499 Bacteria 3417
244 Ga0495607_0090464 3300046501 Bacteria 1659
245 Ga0495606_0016858 3300046507 Bacteria 5548
246 Ga0495606_0033428 3300046507 Bacteria 3547
247 Ga0495608_0000006 3300046511 Bacteria 324334
248 Ga0495618_0000034 3300046514 Bacteria 104335
249 Ga0495628_0000077 3300046516 Bacteria 77338
250 Ga0495628_0252360 3300046516 Bacteria 1317
251 Ga0495630_0000516 3300046517 Bacteria 28537
252 Ga0495630_0003645 3300046517 Bacteria 10734
253 Ga0495644_0026632 3300046523 Bacteria 2193
254 Ga0495652_0000824 3300046529 Bacteria 35711
255 Ga0495665_0004116 3300046531 Bacteria 7842
256 Ga0495640_0000007 3300046533 Bacteria 265481
257 Ga0495640_0015825 3300046533 Bacteria 5661
258 Ga0495640_0036579 3300046533 Bacteria 3468
259 Ga0495587_0001165 3300046536 Bacteria 17314
260 Ga0495598_0000802 3300046537 Bacteria 6003
261 Ga0495645_0000116 3300046543 Bacteria 54286
262 Ga0495667_0000129 3300046559 Bacteria 54274
263 Ga0495667_0131065 3300046559 Bacteria 1617
264 Ga0495656_0044183 3300046615 Bacteria 1874
265 Ga0495634_0001134 3300046642 Bacteria 24604
266 Ga0495635_0000021 3300046663 Bacteria 164643
267 Ga0495659_0040961 3300046664 Bacteria 1653
268 Ga0495657_0000521 3300046675 Bacteria 35776
269 Ga0495599_0000001 3300046678 Bacteria 537563
270 Ga0495623_0000237 3300046679 Bacteria 35677
271 Ga0495646_0000007 3300046680 Bacteria 236764
272 Ga0495647_0035555 3300046681 Bacteria 1871
273 Ga0495658_0024071 3300046683 Bacteria 3239
274 Ga0495658_0033634 3300046683 Bacteria 2809
275 Ga0495613_0024619 3300046689 Bacteria 4486
276 Ga0495624_0036758 3300046690 Bacteria 3155
277 Ga0495600_0000190 3300046809 Bacteria 35746
278 Ga0495604_0000005 3300047317 Bacteria 424516
279 Ga0495604_0076640 3300047317 Bacteria 2515
280 Ga0495604_0080347 3300047317 Bacteria 2443
281 Ga0495604_0158817 3300047317 Bacteria 1599
282 Ga0495674_0000014 3300047319 Bacteria 241211
283 Ga0495674_0044058 3300047319 Bacteria 3968
284 Ga0495674_0076876 3300047319 Bacteria 2871
285 Ga0495674_0130098 3300047319 Bacteria 2121
286 Ga0495674_0186816 3300047319 Bacteria 1724
287 Ga0495672_0021489 3300047320 Bacteria 4209
288 Ga0495672_0048737 3300047320 Bacteria 2511
289 Ga0495680_0000580 3300047322 Bacteria 41033
290 Ga0495680_0026193 3300047322 Bacteria 4812
291 Ga0495675_0000573 3300047444 Bacteria 23696
292 Ga0495675_0112910 3300047444 Bacteria 1695
293 Ga0495684_0000390 3300047471 Bacteria 35768
294 Ga0495686_0000594 3300047472 Bacteria 50426
295 Ga0495593_0011849 3300047673 Bacteria 5000
296 Ga0495602_0000211 3300048088 Bacteria 54539
297 Ga0495602_0058791 3300048088 Bacteria 3363
298 Ga0495602_0060818 3300048088 Bacteria 3289
299 Ga0496100_0009346 3300048903 Bacteria 5508
300 Ga0496101_0002598 3300048904 Bacteria 11096
301 Ga0496101_0122380 3300048904 Bacteria 1968
302 Ga0496102_0005580 3300048905 Bacteria 10687
303 Ga0496102_0010961 3300048905 Bacteria 7810
304 Ga0496102_0045445 3300048905 Bacteria 3987
305 Ga0496103_0015561 3300048906 Bacteria 4530
306 Ga0496103_0032948 3300048906 Bacteria 3164
307 Ga0496104_0000351 3300048907 Bacteria 41200
308 Ga0496104_0088471 3300048907 Bacteria 2958
309 Ga0496105_0001783 3300048908 Bacteria 15381
310 Ga0496105_0003346 3300048908 Bacteria 11852
311 Ga0496105_0006479 3300048908 Bacteria 8999
312 Ga0496105_0130177 3300048908 Bacteria 2075
313 Ga0496106_0021558 3300048909 Bacteria 4784
314 Ga0496106_0064799 3300048909 Bacteria 2781
315 Ga0496106_0207405 3300048909 Bacteria 1560
316 Ga0496107_0027242 3300048910 Bacteria 4057
317 Ga0496108_0046305 3300048911 Bacteria 3633
318 Ga0496109_0000340 3300048912 Bacteria 43565
319 Ga0496109_0011906 3300048912 Bacteria 7488
320 Ga0496109_0092824 3300048912 Bacteria 2792
321 Ga0496110_0038863 3300048913 Bacteria 4142
322 Ga0496110_0179030 3300048913 Bacteria 1925
323 Ga0496111_0052113 3300048914 Bacteria 2954
324 Ga0496112_0001843 3300048915 Bacteria 16682
325 Ga0496112_0011291 3300048915 Bacteria 8148
326 Ga0496113_0004318 3300048916 Bacteria 8711
327 Ga0496113_0040569 3300048916 Bacteria 3430
328 Ga0496114_0016716 3300048917 Bacteria 5916
329 Ga0496115_0005904 3300048918 Bacteria 8925
330 Ga0496115_0013526 3300048918 Bacteria 6174
331 Ga0496121_0006722 3300048924 Bacteria 14118
332 Ga0501032_0002590 3300049569 Bacteria 14149
333 Ga0501032_0094891 3300049569 Bacteria 1978
334 Ga0501033_0002032 3300049570 Bacteria 17592
335 Ga0501033_0018516 3300049570 Bacteria 5262
336 Ga0501034_0005104 3300049571 Bacteria 14411
337 Ga0501034_0146901 3300049571 Bacteria 2335
338 Ga0501034_0158621 3300049571 Bacteria 2235
339 Ga0501036_0008366 3300049572 Bacteria 8478
340 Ga0501036_0015524 3300049572 Bacteria 6363
341 Ga0501036_0080770 3300049572 Bacteria 2748
342 Ga0501036_0185040 3300049572 Bacteria 1753
343 Ga0501037_0008103 3300049573 Bacteria 7698
344 Ga0501038_0005721 3300049574 Bacteria 11528
345 Ga0501038_0020771 3300049574 Bacteria 5902
346 Ga0501038_0057022 3300049574 Bacteria 3355
347 Ga0501038_0068575 3300049574 Bacteria 3014
348 Ga0501038_0269853 3300049574 Bacteria 1342
349 Ga0501039_0020110 3300049575 Bacteria 5118
350 Ga0501039_0068451 3300049575 Bacteria 2756
351 Ga0501040_0016063 3300049576 Bacteria 4951
352 Ga0501040_0030440 3300049576 Bacteria 3646
353 Ga0501040_0045848 3300049576 Bacteria 2983
354 Ga0501040_0090109 3300049576 Bacteria 2131
355 Ga0501040_0210263 3300049576 Bacteria 1383
356 Ga0501041_0005445 3300049577 Bacteria 7452
357 Ga0501042_0004874 3300049578 Bacteria 8581
358 Ga0501042_0007297 3300049578 Bacteria 7233
359 Ga0501042_0158260 3300049578 Bacteria 1634
360 Ga0501043_0009950 3300049579 Bacteria 7456
361 Ga0501043_0016232 3300049579 Bacteria 5841
362 Ga0501046_0029943 3300049580 Bacteria 4422
363 Ga0501046_0040889 3300049580 Bacteria 3702
364 Ga0501046_0075974 3300049580 Bacteria 2604
365 Ga0501046_0091361 3300049580 Bacteria 2342
366 Ga0501047_0012203 3300049581 Bacteria 8134
367 Ga0501047_0023529 3300049581 Bacteria 5912
368 Ga0501047_0052372 3300049581 Bacteria 3945
369 Ga0501047_0054538 3300049581 Bacteria 3866
370 Ga0501048_0016010 3300049582 Bacteria 5530
371 Ga0501048_0016091 3300049582 Bacteria 5515
372 Ga0501048_0027846 3300049582 Bacteria 4104
373 Ga0501048_0033466 3300049582 Bacteria 3713
374 Ga0501067_0022532 3300049583 Bacteria 3486
375 Ga0501067_0056196 3300049583 Bacteria 2181
376 Ga0501067_0103593 3300049583 Bacteria 1581
377 Ga0501068_0003107 3300049584 Bacteria 8871
378 Ga0501068_0009385 3300049584 Bacteria 5473
379 Ga0501069_0010067 3300049585 Bacteria 4999
380 Ga0501070_0021221 3300049586 Bacteria 5452
381 Ga0501070_0028747 3300049586 Bacteria 4661
382 Ga0501070_0035633 3300049586 Bacteria 4157
383 Ga0501071_0000281 3300049587 Bacteria 24250
384 Ga0501071_0245152 3300049587 Bacteria 1351
385 Ga0501072_0003765 3300049588 Bacteria 11453
386 Ga0501072_0003943 3300049588 Bacteria 11230
387 Ga0501072_0041485 3300049588 Bacteria 3615
388 Ga0501073_0022572 3300049589 Bacteria 4529
389 Ga0501073_0034945 3300049589 Bacteria 3574
390 Ga0501074_0020487 3300049590 Bacteria 4806
391 Ga0501074_0091371 3300049590 Bacteria 2180
392 Ga0501075_0003249 3300049591 Bacteria 10884
393 Ga0501076_0018424 3300049592 Bacteria 5323
394 Ga0501077_0003465 3300049593 Bacteria 9472
395 Ga0501077_0027254 3300049593 Bacteria 3628
396 Ga0501079_0011227 3300049741 Bacteria 6833
397 Ga0501079_0064322 3300049741 Bacteria 2829
398 Ga0501080_0001953 3300049742 Bacteria 17807
399 Ga0501080_0041567 3300049742 Bacteria 4283
400 Ga0501080_0054449 3300049742 Bacteria 3725
401 Ga0501080_0055392 3300049742 Bacteria 3693
402 Ga0501081_0012015 3300049743 Bacteria 5676
403 Ga0501081_0016250 3300049743 Bacteria 4919
404 Ga0501081_0092004 3300049743 Bacteria 2134
405 Ga0501083_0006236 3300049744 Bacteria 8459
406 Ga0501083_0012078 3300049744 Bacteria 6047
407 Ga0501083_0013372 3300049744 Bacteria 5737
408 Ga0501083_0140730 3300049744 Bacteria 1580
409 Ga0501035_0007827 3300049822 Bacteria 9987
410 Ga0501035_0058371 3300049822 Bacteria 3438
411 Ga0501044_0030859 3300049823 Bacteria 5644
412 Ga0501044_0038754 3300049823 Bacteria 4975
413 Ga0501044_0114871 3300049823 Bacteria 2697
414 Ga0501044_0162280 3300049823 Bacteria 2211
415 Ga0501045_0000893 3300049824 Bacteria 19395
416 nmdc:mga00v17_34852_c1 3300050491 Bacteria 2993
417 nmdc:mga00v17_6660_c1 3300050491 Bacteria 6135
418 nmdc:mga05p37_121859_c1 3300050507 Bacteria 3203
419 nmdc:mga05p37_145938_c1 3300050507 Bacteria 2898
420 nmdc:mga05p37_234781_c1 3300050507 Bacteria 2208
421 nmdc:mga05p37_44868_c1 3300050507 Bacteria 5438
422 nmdc:mga05p37_45816_c1 3300050507 Bacteria 5378
423 nmdc:mga09592_79857_c1 3300050508 Bacteria 2785
424 nmdc:mga08y16_120561_c1 3300050511 Bacteria 2729
425 nmdc:mga08y16_21013_c1 3300050511 Bacteria 6891
426 nmdc:mga08y16_26580_c1 3300050511 Bacteria 6101
427 nmdc:mga08y16_49765_c1 3300050511 Bacteria 4385
428 nmdc:mga08y16_6645_c1 3300050511 Bacteria 12132
429 nmdc:mga0n895_320536_c1 3300050512 Bacteria 1571
430 nmdc:mga0n895_36436_c1 3300050512 Bacteria 4750
431 nmdc:mga0n895_69893_c1 3300050512 Bacteria 3479
432 nmdc:mga0n895_702_c1 3300050512 Bacteria 23535
433 nmdc:mga0rr50_2586_c1 3300050513 Bacteria 10250
434 nmdc:mga08x19_12614_c1 3300050514 Bacteria 5096
435 nmdc:mga0a205_471_c1 3300050515 Bacteria 20085
436 Ga0495601_0000008 3300053077 Bacteria 362152
437 Ga0495601_0000549 3300053077 Bacteria 19855
438 Ga0495612_0000026 3300053078 Bacteria 111627
439 Ga0495595_0000096 3300053084 Bacteria 41512
440 Ga0495595_0045294 3300053084 Bacteria 2023
441 Ga0495619_0000033 3300053085 Bacteria 138925
442 Ga0495619_0002288 3300053085 Bacteria 12629
443 Ga0500578_0023005 3300053086 Bacteria 4003
444 Ga0500643_003082 3300053087 Bacteria 8191
445 Ga0500644_0000584 3300053088 Bacteria 13962
446 Ga0500651_0006148 3300053093 Bacteria 6895
447 Ga0500555_001552 3300053103 Bacteria 6952
448 Ga0500593_000206 3300053117 Bacteria 24090
449 Ga0500595_000010 3300053119 Bacteria 275806
450 Ga0500595_003087 3300053119 Bacteria 7900
451 Ga0500642_0000617 3300053130 Bacteria 10607
452 Ga0500642_0002225 3300053130 Bacteria 5654
453 Ga0500658_0041528 3300053134 Bacteria 1845
454 Ga0500568_0000001 3300053139 Bacteria 988705
455 Ga0500568_0000295 3300053139 Bacteria 40681
456 Ga0500577_0005391 3300053142 Bacteria 3443
457 Ga0500616_0000001 3300053153 Bacteria 1986011
458 Ga0500616_0001084 3300053153 Bacteria 28373
459 Ga0500645_000015 3300053730 Bacteria 150140
460 Ga0501084_0001270 3300054114 Bacteria 19890
461 Ga0501084_0009647 3300054114 Bacteria 7986
462 Ga0501084_0010604 3300054114 Bacteria 7625
463 Ga0501084_0012071 3300054114 Bacteria 7155
464 Ga0501084_0041587 3300054114 Bacteria 3845
465 Ga0501082_0000013 3300060353 Bacteria 119623
466 Ga0501082_0009289 3300060353 Bacteria 8476
467 Ga0501082_0016557 3300060353 Bacteria 6347
468 Ga0501082_0049899 3300060353 Bacteria 3608
469 Ga0530510_0004776 3300061734 Bacteria 9381
470 Ga0530510_0054627 3300061734 Bacteria 2886
471 2511169152 2510917026 Bacteria 7046020
472 2599717848 2599185236 Bacteria 6875203
473 2765466666 2765235802 Bacteria 5618596
474 2839997694 2839993093 Bacteria 5512535
475 2840765973 2840764183 Bacteria 6358399
476 2841914623 2841911363 Bacteria 6173697
477 2841920212 2841917233 Bacteria 6173500
478 2852394846 2852387548 Bacteria 8025568
479 2894657117 2894652903 Bacteria 4587256
480 2904581822 2904578770 Bacteria 5302906
481 2919123490 2919119836 Bacteria 5208557
482 3005413870 3005409236 Bacteria 7188837
483 8001849558 8001845381 Bacteria 5804942
484 8057576177 8057575449 Bacteria 7367519
485 Ga0070705_100002136
486 JGI25153J46596_10000010
487 JGI25160J50197_1000018
488 JGI25161J50226_1000020
489 Ga0055524_1003148
490 Ga0055528_1000721
491 Ga0055543_1000004
492 Ga0065165_1000065
493 Ga0070690_100019427
494 Ga0070690_100025142
495 Ga0070670_100125149
496 Ga0070670_100171971
497 Ga0068869_100028381
498 Ga0068868_100036161
499 Ga0070689_100022884
500 Ga0070691_10001323
501 Ga0070687_100056927
502 Ga0070692_10048226
503 Ga0070668_100084123
504 Ga0070669_100070123
505 Ga0070675_100046883
506 Ga0070688_100018515
507 Ga0070659_100077319
508 Ga0070714_100010606
509 Ga0070713_100058585
510 Ga0070701_10061068
511 Ga0070711_100013485
512 Ga0070700_100013806
513 Ga0070694_100006148
514 Ga0070708_100000142
515 Ga0070663_100051932
516 Ga0070678_100032389
517 Ga0070678_100045899
518 Ga0070678_100200102
519 Ga0070685_10118106
520 Ga0070706_100108083
521 Ga0070707_100068960
522 Ga0070699_100003531
523 Ga0070699_100005255
524 Ga0070699_100169789
525 Ga0070679_100081126
526 Ga0070679_100122432
527 Ga0070697_100007169
528 Ga0070697_100126423
529 Ga0070697_100220492
530 Ga0068853_100058533
531 Ga0070672_100087235
532 Ga0070695_100005494
533 Ga0070695_100024759
534 Ga0070696_100004630
535 Ga0070665_100141860
536 Ga0070704_100062326
537 Ga0068855_100008088
538 Ga0068855_100013438
539 Ga0068857_100003412
540 Ga0068856_100052668
541 Ga0068856_100118286
542 Ga0070702_100009081
543 Ga0068852_100008649
544 Ga0068859_100031478
545 Ga0068859_100031649
546 Ga0068864_100049926
547 Ga0068864_100147420
548 Ga0068866_10013844
549 Ga0068870_10021984
550 Ga0068863_100021511
551 Ga0068860_100135925
552 Ga0068862_100021766
553 Ga0068862_100024885
554 Ga0081455_10015313
555 Ga0081455_10029876
556 Ga0081538_10007242
557 Ga0081540_1019281
558 Ga0081539_10000012
559 Ga0081539_10002229
560 Ga0075365_10008563
561 Ga0075365_10061537
562 Ga0075368_10022279
563 Ga0070715_10011087
564 Ga0070715_10051940
565 Ga0070716_100008399
566 Ga0068871_100063366
567 Ga0075428_100078334
568 Ga0075430_100015121
569 Ga0075431_100000995
570 Ga0075431_100178090
571 Ga0075433_10016463
572 Ga0075434_100001081
573 Ga0075434_100001146
574 Ga0075434_100046319
575 Ga0075434_100170356
576 Ga0075434_100178921
577 Ga0075436_100001269
578 Ga0075436_100004460
579 Ga0097620_100031478
580 Ga0097620_100031650
581 Ga0075435_100002439
582 Ga0099794_10001312
583 Ga0111539_10004506
584 Ga0111539_10021144
585 Ga0111539_10034808
586 Ga0111539_10149980
587 Ga0105247_10024302
588 Ga0114129_10013551
589 Ga0114129_10045213
590 Ga0114129_10071734
591 Ga0105243_10008030
592 Ga0105237_10047966
593 Ga0105238_10332295
594 Ga0105249_10063681
595 Ga0105249_10075583
596 Ga0157375_10046974
597 Ga0163163_10039234
598 Ga0157380_10030383
599 Ga0157380_10129727
600 Ga0157379_10038294
601 Ga0209455_1000494
602 Ga0209673_1000138
603 Ga0209130_1000035
604 Ga0209025_1006066
605 Ga0209564_1022721
606 Ga0209758_1000033
607 Ga0209256_1003268
608 Ga0207426_1000017
609 Ga0207653_10000916
610 Ga0207642_10003570
611 Ga0207710_10009678
612 Ga0207688_10000135
613 Ga0207647_10010263
614 Ga0207699_10079653
615 Ga0207645_10030498
616 Ga0207643_10004358
617 Ga0207684_10012097
618 Ga0207671_10146441
619 Ga0207663_10062138
620 Ga0207660_10036111
621 Ga0207662_10118737
622 Ga0207657_10073794
623 Ga0207649_10099177
624 Ga0207646_10119708
625 Ga0207694_10032128
626 Ga0207650_10008691
627 Ga0207650_10107676
628 Ga0207659_10026827
629 Ga0207700_10004698
630 Ga0207700_10064369
631 Ga0207690_10134090
632 Ga0207706_10044820
633 Ga0207709_10033321
634 Ga0207670_10007206
635 Ga0207704_10009950
636 Ga0207665_10006915
637 Ga0207691_10018822
638 Ga0207689_10011802
639 Ga0207661_10128409
640 Ga0207679_10038841
641 Ga0207667_10058895
642 Ga0207712_10009027
643 Ga0207658_10106840
644 Ga0207677_10014112
645 Ga0207703_10017422
646 Ga0207678_10001748
647 Ga0207678_10045581
648 Ga0207708_10000891
649 Ga0207708_10023443
650 Ga0207702_10085537
651 Ga0207641_10100254
652 Ga0207676_10020054
653 Ga0207676_10059460
654 Ga0207674_10002799
655 Ga0207675_100007361
656 Ga0207683_10007749
657 Ga0207683_10041191
658 Ga0207683_10044319
659 Ga0207698_10051289
660 Ga0207428_10008432
661 Ga0207428_10122313
662 Ga0268266_10070933
663 Ga0268265_10008198
664 Ga0268265_10039041
665 Ga0268264_10001838
666 Ga0268264_10104167
667 Ga0265337_1000691
668 Ga0265334_10002246
669 Ga0265338_10029750
670 Ga0307513_10058302
671 Ga0307513_10182493
672 Ga0265314_10001634
673 Ga0265342_10001205
674 Ga0373944_0003925
675 Ga0373923_0000267
676 Ga0373945_0029881
677 Ga0373954_0006992
678 Ga0373956_0023510
679 Ga0373943_0005794
680 Ga0373943_0044190
681 Ga0373946_0047892
682 Ga0373955_0000191
683 Ga0373955_0005711
684 Ga0373924_0000239
685 Ga0373931_0011661
686 Ga0373935_0004920
687 Ga0373935_0024476
688 Ga0373927_0012591
689 Ga0373927_0013334
690 Ga0373927_0030641
691 Ga0373927_0037033
692 Ga0373927_0062775
693 Ga0373933_0002903
694 Ga0373947_0019274
695 Ga0373947_0069935
696 Ga0373947_0154873
697 Ga0373937_0000030
698 Ga0373937_0015209
699 Ga0373937_0027771
700 Ga0373937_0255958
701 Ga0316584_0018811
702 Ga0373925_0000501
703 Ga0373925_0060415
704 Ga0373925_0093388
705 Ga0373925_0132563
706 Ga0395899_0000314
707 Ga0395900_0000408
708 Ga0395898_0000666
709 Ga0395905_0000392
710 Ga0395901_0000292
711 Ga0436360_0540813
712 Ga0436361_0468034
713 Ga0495592_0000046
714 Ga0495603_0100439
715 Ga0495629_0016126
716 Ga0495638_0000238
717 Ga0495651_0029859
718 Ga0495651_0105194
719 Ga0495653_0000036
720 Ga0495580_0035408
721 Ga0495582_0022666
722 Ga0495662_0011334
723 Ga0495662_0032042
724 Ga0495662_0069301
725 Ga0495664_0000002
726 Ga0495585_0013074
727 Ga0495594_0021861
728 Ga0495607_0090464
729 Ga0495606_0016858
730 Ga0495606_0033428
731 Ga0495608_0000006
732 Ga0495618_0000034
733 Ga0495628_0000077
734 Ga0495628_0252360
735 Ga0495630_0000516
736 Ga0495630_0003645
737 Ga0495644_0026632
738 Ga0495652_0000824
739 Ga0495665_0004116
740 Ga0495640_0000007
741 Ga0495640_0015825
742 Ga0495640_0036579
743 Ga0495587_0001165
744 Ga0495598_0000802
745 Ga0495645_0000116
746 Ga0495667_0000129
747 Ga0495667_0131065
748 Ga0495656_0044183
749 Ga0495634_0001134
750 Ga0495635_0000021
751 Ga0495659_0040961
752 Ga0495657_0000521
753 Ga0495599_0000001
754 Ga0495623_0000237
755 Ga0495646_0000007
756 Ga0495647_0035555
757 Ga0495658_0024071
758 Ga0495658_0033634
759 Ga0495613_0024619
760 Ga0495624_0036758
761 Ga0495600_0000190
762 Ga0495604_0000005
763 Ga0495604_0076640
764 Ga0495604_0080347
765 Ga0495604_0158817
766 Ga0495674_0000014
767 Ga0495674_0044058
768 Ga0495674_0076876
769 Ga0495674_0130098
770 Ga0495674_0186816
771 Ga0495672_0021489
772 Ga0495672_0048737
773 Ga0495680_0000580
774 Ga0495680_0026193
775 Ga0495675_0000573
776 Ga0495675_0112910
777 Ga0495684_0000390
778 Ga0495686_0000594
779 Ga0495593_0011849
780 Ga0495602_0000211
781 Ga0495602_0058791
782 Ga0495602_0060818
783 Ga0496100_0009346
784 Ga0496101_0002598
785 Ga0496101_0122380
786 Ga0496102_0005580
787 Ga0496102_0010961
788 Ga0496102_0045445
789 Ga0496103_0015561
790 Ga0496103_0032948
791 Ga0496104_0000351
792 Ga0496104_0088471
793 Ga0496105_0001783
794 Ga0496105_0003346
795 Ga0496105_0006479
796 Ga0496105_0130177
797 Ga0496106_0021558
798 Ga0496106_0064799
799 Ga0496106_0207405
800 Ga0496107_0027242
801 Ga0496108_0046305
802 Ga0496109_0000340
803 Ga0496109_0011906
804 Ga0496109_0092824
805 Ga0496110_0038863
806 Ga0496110_0179030
807 Ga0496111_0052113
808 Ga0496112_0001843
809 Ga0496112_0011291
810 Ga0496113_0004318
811 Ga0496113_0040569
812 Ga0496114_0016716
813 Ga0496115_0005904
814 Ga0496115_0013526
815 Ga0496121_0006722
816 Ga0501032_0002590
817 Ga0501032_0094891
818 Ga0501033_0002032
819 Ga0501033_0018516
820 Ga0501034_0005104
821 Ga0501034_0146901
822 Ga0501034_0158621
823 Ga0501036_0008366
824 Ga0501036_0015524
825 Ga0501036_0080770
826 Ga0501036_0185040
827 Ga0501037_0008103
828 Ga0501038_0005721
829 Ga0501038_0020771
830 Ga0501038_0057022
831 Ga0501038_0068575
832 Ga0501038_0269853
833 Ga0501039_0020110
834 Ga0501039_0068451
835 Ga0501040_0016063
836 Ga0501040_0030440
837 Ga0501040_0045848
838 Ga0501040_0090109
839 Ga0501040_0210263
840 Ga0501041_0005445
841 Ga0501042_0004874
842 Ga0501042_0007297
843 Ga0501042_0158260
844 Ga0501043_0009950
845 Ga0501043_0016232
846 Ga0501046_0029943
847 Ga0501046_0040889
848 Ga0501046_0075974
849 Ga0501046_0091361
850 Ga0501047_0012203
851 Ga0501047_0023529
852 Ga0501047_0052372
853 Ga0501047_0054538
854 Ga0501048_0016010
855 Ga0501048_0016091
856 Ga0501048_0027846
857 Ga0501048_0033466
858 Ga0501067_0022532
859 Ga0501067_0056196
860 Ga0501067_0103593
861 Ga0501068_0003107
862 Ga0501068_0009385
863 Ga0501069_0010067
864 Ga0501070_0021221
865 Ga0501070_0028747
866 Ga0501070_0035633
867 Ga0501071_0000281
868 Ga0501071_0245152
869 Ga0501072_0003765
870 Ga0501072_0003943
871 Ga0501072_0041485
872 Ga0501073_0022572
873 Ga0501073_0034945
874 Ga0501074_0020487
875 Ga0501074_0091371
876 Ga0501075_0003249
877 Ga0501076_0018424
878 Ga0501077_0003465
879 Ga0501077_0027254
880 Ga0501079_0011227
881 Ga0501079_0064322
882 Ga0501080_0001953
883 Ga0501080_0041567
884 Ga0501080_0054449
885 Ga0501080_0055392
886 Ga0501081_0012015
887 Ga0501081_0016250
888 Ga0501081_0092004
889 Ga0501083_0006236
890 Ga0501083_0012078
891 Ga0501083_0013372
892 Ga0501083_0140730
893 Ga0501035_0007827
894 Ga0501035_0058371
895 Ga0501044_0030859
896 Ga0501044_0038754
897 Ga0501044_0114871
898 Ga0501044_0162280
899 Ga0501045_0000893
900 nmdc:mga00v17_34852_c1
901 nmdc:mga00v17_6660_c1
902 nmdc:mga05p37_121859_c1
903 nmdc:mga05p37_145938_c1
904 nmdc:mga05p37_234781_c1
905 nmdc:mga05p37_44868_c1
906 nmdc:mga05p37_45816_c1
907 nmdc:mga09592_79857_c1
908 nmdc:mga08y16_120561_c1
909 nmdc:mga08y16_21013_c1
910 nmdc:mga08y16_26580_c1
911 nmdc:mga08y16_49765_c1
912 nmdc:mga08y16_6645_c1
913 nmdc:mga0n895_320536_c1
914 nmdc:mga0n895_36436_c1
915 nmdc:mga0n895_69893_c1
916 nmdc:mga0n895_702_c1
917 nmdc:mga0rr50_2586_c1
918 nmdc:mga08x19_12614_c1
919 nmdc:mga0a205_471_c1
920 Ga0495601_0000008
921 Ga0495601_0000549
922 Ga0495612_0000026
923 Ga0495595_0000096
924 Ga0495595_0045294
925 Ga0495619_0000033
926 Ga0495619_0002288
927 Ga0500578_0023005
928 Ga0500643_003082
929 Ga0500644_0000584
930 Ga0500651_0006148
931 Ga0500555_001552
932 Ga0500593_000206
933 Ga0500595_000010
934 Ga0500595_003087
935 Ga0500642_0000617
936 Ga0500642_0002225
937 Ga0500658_0041528
938 Ga0500568_0000001
939 Ga0500568_0000295
940 Ga0500577_0005391
941 Ga0500616_0000001
942 Ga0500616_0001084
943 Ga0500645_000015
944 Ga0501084_0001270
945 Ga0501084_0009647
946 Ga0501084_0010604
947 Ga0501084_0012071
948 Ga0501084_0041587
949 Ga0501082_0000013
950 Ga0501082_0009289
951 Ga0501082_0016557
952 Ga0501082_0049899
953 Ga0530510_0004776
954 Ga0530510_0054627
955 2511169152
956 2599717848
957 2765466666
958 2839997694
959 2840765973
960 2841914623
961 2841920212
962 2852394846
963 2894657117
964 2904581822
965 2919123490
966 3005413870
967 8001849558
968 8057576177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03972

MmgE_PrpD_N

MmgE/PrpD N-terminal domain

59

284

0.94

PF19305

MmgE_PrpD_C

MmgE/PrpD C-terminal domain

304

474

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7br9-assembly1.cif.gz_A crystal structure of mus musculus irg1 0.8739 9 429
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.8713 11 430
6r6t-assembly1.cif.gz_B crystal structure of mouse cis-aconitate decarboxylase 0.8554 9 430
7br9-assembly1.cif.gz_A crystal structure of mus musculus irg1 0.8547 9 429
6r6t-assembly1.cif.gz_A crystal structure of mouse cis-aconitate decarboxylase 0.8525 13 430
ID Description Score Start End Superfamily
af_O06582_313_451_3.30.1330.120 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.8547 249 373 3.30.1330.120
af_O06582_36_312_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.81 2 247 1.10.4100.10
af_A0A2R8RL39_271_404_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.8059 246 377 1.10.4100.10
2hp0B02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.7925 247 377 3.30.1330.120
af_A0A2R8RL39_271_404_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.7892 246 377 1.10.4100.10
ID Description Score Start End GO Terms
AF-A0A524HYU7-F1-model_v4 MmgE/PrpD family protein 0.9851 9 158 GO:0016829
AF-A0A524HYU7-F1-model_v4 MmgE/PrpD family protein 0.9722 9 158 GO:0016829
AF-A0A6N7FD90-F1-model_v4 MmgE/PrpD family protein 0.9616 4 430 GO:0016829
AF-A0A538RBR5-F1-model_v4 MmgE/PrpD family protein 0.9552 5 429 GO:0016829
AF-A0A2E4HLG4-F1-model_v4 2-methylcitrate dehydratase 0.9535 7 430 GO:0016829

Map