metagRoot

F452879

General Info

Members	Datasets	Scaffolds	Average Seq Length
484	288	484	54

Family's Representative Sequence

Representative Sequence	3300005334\|Ga0068869_101071259\|Ga0068869_1010712592
Length	56
Sequence	MTLSPELLEILVCPKCKGDLEYRPEPEEKLLCHACRLVYRVEDGIPVMLIDEATPF

Samples

	Sample ID	Description	Type	Environment
1	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
7	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
8	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
11	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
12	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
13	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
14	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
15	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
16	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
17	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
18	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
22	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
23	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
24	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
25	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
37	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
38	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
39	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
40	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
41	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
42	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
43	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
44	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
45	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
46	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
47	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
48	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
49	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
50	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
53	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
54	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
57	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
60	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
61	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
62	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
63	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
64	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
66	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
67	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
68	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
69	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
70	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
71	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
72	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
75	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
79	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
80	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
81	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
84	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
85	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
86	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
87	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
88	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
89	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
90	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
91	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
92	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
93	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
94	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
145	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
146	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
147	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
148	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
149	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
150	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
151	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
152	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
153	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
154	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
155	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
156	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
157	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
158	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
159	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
160	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
161	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
162	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
163	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
164	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
165	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
166	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
167	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
168	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
169	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
170	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
171	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
172	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
173	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
174	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
175	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
176	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
177	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
178	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
179	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
180	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
181	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
182	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
183	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
184	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
185	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
186	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
187	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
188	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
189	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
190	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
191	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
192	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
193	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
194	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
195	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
196	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
197	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
198	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
199	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
200	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
201	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
202	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
203	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
204	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
205	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
206	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
207	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
208	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
209	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
210	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
211	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
212	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
213	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
214	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
215	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
216	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
217	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
218	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
219	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
220	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
221	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
222	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
223	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
224	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
225	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
226	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
227	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
228	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
229	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
230	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
231	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
232	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
233	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
234	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
235	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
236	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
237	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
238	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
239	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
240	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
241	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
242	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
243	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
244	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
245	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
246	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
248	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
249	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
250	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
255	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
258	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
260	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
262	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
263	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
264	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
265	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
266	3300049670	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought	Metagenome	Rhizosphere
267	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
268	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
269	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
270	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
271	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
272	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
273	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
274	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
275	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
276	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
277	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
278	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
279	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
280	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
281	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
282	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
283	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
284	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
285	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
286	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
287	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
288	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	4.75
Rhizosphere	95.25
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065707_10676225	3300005295	Unclassified	651
2	Ga0070658_10283478	3300005327	Bacteria	1410
3	Ga0070676_10096087	3300005328	Unclassified	1823
4	Ga0070683_100150371	3300005329	Bacteria	2207
5	Ga0070690_100063906	3300005330	Bacteria	2376
6	Ga0070670_101908648	3300005331	Unclassified	547
7	Ga0068869_100049812	3300005334	Bacteria	3034
8	Ga0068869_101071259	3300005334	Bacteria	704
9	Ga0070666_10035113	3300005335	Bacteria	3324
10	Ga0070680_100761326	3300005336	Bacteria	834
11	Ga0068868_100447220	3300005338	Bacteria	1123
12	Ga0070660_100977470	3300005339	Bacteria	715
13	Ga0070691_10057917	3300005341	Bacteria	1859
14	Ga0070692_10176348	3300005345	Bacteria	1236
15	Ga0070668_100077377	3300005347	Bacteria	2600
16	Ga0070668_100581909	3300005347	Bacteria	977
17	Ga0070669_100018221	3300005353	Bacteria	5016
18	Ga0070675_100180121	3300005354	Bacteria	1827
19	Ga0070675_100751113	3300005354	Unclassified	890
20	Ga0070671_100158100	3300005355	Bacteria	1915
21	Ga0070671_100266521	3300005355	Bacteria	1456
22	Ga0070673_100567816	3300005364	Unclassified	1032
23	Ga0070673_101112310	3300005364	Unclassified	738
24	Ga0070659_101927089	3300005366	Bacteria	530
25	Ga0070667_100043136	3300005367	Bacteria	3785
26	Ga0070703_10028728	3300005406	Bacteria	1664
27	Ga0070709_10483245	3300005434	Unclassified	938
28	Ga0070709_10966308	3300005434	Bacteria	676
29	Ga0070714_100375584	3300005435	Bacteria	1339
30	Ga0070713_100300496	3300005436	Bacteria	1477
31	Ga0070710_10574841	3300005437	Unclassified	781
32	Ga0070711_101781673	3300005439	Unclassified	540
33	Ga0070705_100038273	3300005440	Bacteria	2712
34	Ga0070700_100136936	3300005441	Unclassified	1659
35	Ga0070700_101225666	3300005441	Unclassified	627
36	Ga0070694_100101550	3300005444	Bacteria	2035
37	Ga0070694_101931102	3300005444	Bacteria	504
38	Ga0070708_100194300	3300005445	Bacteria	1899
39	Ga0070708_101783249	3300005445	Bacteria	571
40	Ga0070663_100130892	3300005455	Unclassified	1905
41	Ga0070663_100949690	3300005455	Bacteria	745
42	Ga0070678_100050766	3300005456	Bacteria	3003
43	Ga0070662_100000543	3300005457	Bacteria	22925
44	Ga0070662_100415496	3300005457	Unclassified	1112
45	Ga0070681_10495287	3300005458	Bacteria	1135
46	Ga0068867_100000355	3300005459	Bacteria	30494
47	Ga0070706_101115522	3300005467	Bacteria	726
48	Ga0070698_100238997	3300005471	Bacteria	1750
49	Ga0070698_100652464	3300005471	Bacteria	993
50	Ga0070698_101547771	3300005471	Bacteria	615
51	Ga0070699_100001319	3300005518	Bacteria	22875
52	Ga0070699_100175760	3300005518	Bacteria	1898
53	Ga0070684_100393881	3300005535	Bacteria	1277
54	Ga0070697_100599650	3300005536	Bacteria	968
55	Ga0068853_100276597	3300005539	Unclassified	1547
56	Ga0070672_100532262	3300005543	Unclassified	1019
57	Ga0070686_100668911	3300005544	Bacteria	825
58	Ga0070695_100016999	3300005545	Bacteria	4411
59	Ga0070696_100008005	3300005546	Bacteria	7059
60	Ga0070696_100438934	3300005546	Unclassified	1028
61	Ga0070693_100090362	3300005547	Bacteria	1845
62	Ga0070704_100925459	3300005549	Bacteria	785
63	Ga0070704_101128919	3300005549	Bacteria	713
64	Ga0068855_100106490	3300005563	Bacteria	3223
65	Ga0068855_100839716	3300005563	Unclassified	974
66	Ga0070664_100201701	3300005564	Bacteria	1775
67	Ga0068857_100031912	3300005577	Bacteria	4655
68	Ga0068854_100024588	3300005578	Bacteria	4126
69	Ga0068856_102123363	3300005614	Unclassified	571
70	Ga0070702_100056865	3300005615	Bacteria	2261
71	Ga0068852_100226172	3300005616	Bacteria	1781
72	Ga0068859_100895331	3300005617	Unclassified	972
73	Ga0068859_101401860	3300005617	Bacteria	771
74	Ga0068864_100024787	3300005618	Bacteria	5046
75	Ga0068866_10000078	3300005718	Bacteria	39112
76	Ga0068861_100035282	3300005719	Bacteria	3703
77	Ga0068861_100174179	3300005719	Bacteria	1786
78	Ga0068870_10177462	3300005840	Unclassified	1276
79	Ga0068858_100412156	3300005842	Bacteria	1299
80	Ga0068858_102466331	3300005842	Bacteria	514
81	Ga0068860_100028485	3300005843	Bacteria	5376
82	Ga0068860_101696961	3300005843	Bacteria	654
83	Ga0068862_100363378	3300005844	Bacteria	1346
84	Ga0068862_100464396	3300005844	Bacteria	1195
85	Ga0081455_10187673	3300005937	Bacteria	1560
86	Ga0097621_100257727	3300006237	Bacteria	1529
87	Ga0075428_100289776	3300006844	Bacteria	1761
88	Ga0075428_102602399	3300006844	Bacteria	517
89	Ga0075428_102660173	3300006844	Bacteria	510
90	Ga0075430_100498291	3300006846	Bacteria	1005
91	Ga0075430_101490932	3300006846	Bacteria	556
92	Ga0075431_100948457	3300006847	Bacteria	829
93	Ga0075433_10740389	3300006852	Bacteria	860
94	Ga0075433_10876788	3300006852	Bacteria	783
95	Ga0075434_100053168	3300006871	Bacteria	4025
96	Ga0075434_101160495	3300006871	Bacteria	785
97	Ga0068865_100017527	3300006881	Bacteria	4607
98	Ga0068865_101612070	3300006881	Bacteria	583
99	Ga0075436_101104068	3300006914	Unclassified	597
100	Ga0097620_100895453	3300006931	Unclassified	972
101	Ga0097620_101401808	3300006931	Bacteria	771
102	Ga0111539_10458617	3300009094	Unclassified	1484
103	Ga0111539_10634578	3300009094	Bacteria	1244
104	Ga0105245_10225127	3300009098	Bacteria	1812
105	Ga0114129_13307976	3300009147	Unclassified	521
106	Ga0105243_10009895	3300009148	Bacteria	7250
107	Ga0105241_10029669	3300009174	Bacteria	4083
108	Ga0105242_10166664	3300009176	Bacteria	1933
109	Ga0105242_10413971	3300009176	Bacteria	1261
110	Ga0105248_10070061	3300009177	Bacteria	3938
111	Ga0105248_10764024	3300009177	Bacteria	1091
112	Ga0105238_10478638	3300009551	Bacteria	1244
113	Ga0105249_10023761	3300009553	Bacteria	5505
114	Ga0105249_10214489	3300009553	Unclassified	1891
115	Ga0105249_10600895	3300009553	Bacteria	1155
116	Ga0105249_10877542	3300009553	Bacteria	963
117	Ga0105249_12735456	3300009553	Unclassified	565
118	Ga0105239_10452221	3300010375	Unclassified	1457
119	Ga0105239_11058937	3300010375	Bacteria	933
120	Ga0105246_11248068	3300011119	Bacteria	686
121	Ga0157371_10046843	3300013102	Bacteria	3074
122	Ga0157371_10374515	3300013102	Bacteria	1039
123	Ga0157369_10019160	3300013105	Bacteria	7657
124	Ga0157369_11219530	3300013105	Unclassified	768
125	Ga0157378_10001907	3300013297	Bacteria	18712
126	Ga0163162_10113968	3300013306	Unclassified	2802
127	Ga0163162_12158293	3300013306	Unclassified	639
128	Ga0157372_10091774	3300013307	Bacteria	3454
129	Ga0157372_10132463	3300013307	Bacteria	2869
130	Ga0157372_12021361	3300013307	Unclassified	662
131	Ga0157372_13138047	3300013307	Bacteria	527
132	Ga0157375_10127568	3300013308	Unclassified	2661
133	Ga0157375_10315426	3300013308	Bacteria	1728
134	Ga0157380_10121628	3300014326	Unclassified	2212
135	Ga0157380_11603590	3300014326	Bacteria	706
136	Ga0157380_12664310	3300014326	Unclassified	566
137	Ga0157379_10430973	3300014968	Bacteria	1215
138	Ga0157379_10915459	3300014968	Bacteria	832
139	Ga0157376_11056474	3300014969	Bacteria	837
140	Ga0163161_10048053	3300017792	Unclassified	3081
141	Ga0207653_10045352	3300025885	Bacteria	1452
142	Ga0207642_10003635	3300025899	Bacteria	4894
143	Ga0207642_11139579	3300025899	Bacteria	505
144	Ga0207688_10541683	3300025901	Bacteria	731
145	Ga0207680_10063960	3300025903	Unclassified	2253
146	Ga0207647_10540504	3300025904	Bacteria	647
147	Ga0207699_10818106	3300025906	Bacteria	685
148	Ga0207645_10006666	3300025907	Bacteria	8245
149	Ga0207643_10014532	3300025908	Bacteria	4279
150	Ga0207684_11334247	3300025910	Bacteria	589
151	Ga0207654_10237963	3300025911	Unclassified	1215
152	Ga0207660_10427267	3300025917	Unclassified	1069
153	Ga0207649_10033026	3300025920	Bacteria	3089
154	Ga0207681_10011893	3300025923	Bacteria	5358
155	Ga0207694_11262114	3300025924	Bacteria	625
156	Ga0207650_11518124	3300025925	Unclassified	569
157	Ga0207659_10807975	3300025926	Unclassified	806
158	Ga0207659_11456893	3300025926	Bacteria	586
159	Ga0207700_11356820	3300025928	Bacteria	633
160	Ga0207644_10131866	3300025931	Bacteria	1914
161	Ga0207690_10311005	3300025932	Unclassified	1236
162	Ga0207706_10000146	3300025933	Bacteria	76821
163	Ga0207706_10264869	3300025933	Unclassified	1500
164	Ga0207686_10000143	3300025934	Bacteria	56102
165	Ga0207709_10004364	3300025935	Bacteria	8183
166	Ga0207669_10004336	3300025937	Bacteria	6235
167	Ga0207704_10000443	3300025938	Bacteria	18522
168	Ga0207691_10091184	3300025940	Bacteria	2731
169	Ga0207711_10002596	3300025941	Bacteria	16055
170	Ga0207689_10069940	3300025942	Bacteria	2884
171	Ga0207689_11167894	3300025942	Bacteria	648
172	Ga0207661_10344894	3300025944	Bacteria	1343
173	Ga0207679_10099942	3300025945	Bacteria	2266
174	Ga0207651_11228278	3300025960	Unclassified	673
175	Ga0207712_10010666	3300025961	Bacteria	5836
176	Ga0207712_10682305	3300025961	Bacteria	895
177	Ga0207712_11512492	3300025961	Unclassified	601
178	Ga0207668_10015006	3300025972	Bacteria	4807
179	Ga0207668_11035146	3300025972	Bacteria	735
180	Ga0207640_10019998	3300025981	Bacteria	3967
181	Ga0207658_10416057	3300025986	Bacteria	1184
182	Ga0207677_10382839	3300026023	Unclassified	1188
183	Ga0207703_10210042	3300026035	Bacteria	1735
184	Ga0207703_11444469	3300026035	Bacteria	662
185	Ga0207639_10555460	3300026041	Bacteria	1054
186	Ga0207678_10410760	3300026067	Unclassified	1173
187	Ga0207678_10803639	3300026067	Bacteria	830
188	Ga0207708_10101531	3300026075	Bacteria	2227
189	Ga0207708_10332424	3300026075	Unclassified	1242
190	Ga0207648_10000905	3300026089	Bacteria	33390
191	Ga0207676_10157879	3300026095	Bacteria	1961
192	Ga0207676_10782545	3300026095	Bacteria	930
193	Ga0207674_10027362	3300026116	Bacteria	6034
194	Ga0207674_10526251	3300026116	Bacteria	1142
195	Ga0207675_100227949	3300026118	Unclassified	1797
196	Ga0207675_100700035	3300026118	Bacteria	1022
197	Ga0207683_10078104	3300026121	Bacteria	2933
198	Ga0207698_12150030	3300026142	Bacteria	571
199	Ga0209995_1082202	3300027471	Unclassified	553
200	Ga0209995_1094883	3300027471	Unclassified	514
201	Ga0209999_1092625	3300027543	Bacteria	586
202	Ga0209966_1014983	3300027695	Bacteria	1453
203	Ga0268265_10132132	3300028380	Bacteria	2076
204	Ga0268265_10777653	3300028380	Unclassified	931
205	Ga0268264_10055233	3300028381	Bacteria	3318
206	Ga0268264_10139394	3300028381	Bacteria	2161
207	Ga0307408_100032986	3300031548	Bacteria	3614
208	Ga0307408_100061036	3300031548	Bacteria	2751
209	Ga0307408_100179902	3300031548	Bacteria	1695
210	Ga0307408_101687916	3300031548	Unclassified	603
211	Ga0265314_10031554	3300031711	Bacteria	3909
212	Ga0316576_10019523	3300031727	Unclassified	4646
213	Ga0316576_10207413	3300031727	Bacteria	1475
214	Ga0316578_10003140	3300031728	Bacteria	7472
215	Ga0316578_10048562	3300031728	Bacteria	2478
216	Ga0316578_10287908	3300031728	Unclassified	983
217	Ga0307405_10039240	3300031731	Bacteria	2860
218	Ga0307405_10136889	3300031731	Bacteria	1701
219	Ga0307405_10217368	3300031731	Bacteria	1400
220	Ga0307405_10692088	3300031731	Bacteria	843
221	Ga0307405_10884804	3300031731	Bacteria	754
222	Ga0307405_11132615	3300031731	Bacteria	674
223	Ga0316577_10001692	3300031733	Bacteria	10577
224	Ga0316577_10025766	3300031733	Bacteria	3270
225	Ga0316577_10424739	3300031733	Unclassified	755
226	Ga0307413_10022519	3300031824	Bacteria	3397
227	Ga0307413_10048004	3300031824	Bacteria	2549
228	Ga0307413_10119338	3300031824	Bacteria	1783
229	Ga0307413_10190334	3300031824	Bacteria	1472
230	Ga0307413_10867992	3300031824	Bacteria	764
231	Ga0307413_10984092	3300031824	Bacteria	722
232	Ga0307410_10024359	3300031852	Bacteria	3780
233	Ga0307410_10094903	3300031852	Unclassified	2126
234	Ga0307410_10110845	3300031852	Bacteria	1985
235	Ga0307410_10189711	3300031852	Bacteria	1562
236	Ga0307410_10287609	3300031852	Bacteria	1292
237	Ga0307410_10814658	3300031852	Bacteria	795
238	Ga0307410_10834138	3300031852	Bacteria	786
239	Ga0307410_10988013	3300031852	Bacteria	725
240	Ga0307410_11347862	3300031852	Bacteria	625
241	Ga0307406_10089443	3300031901	Bacteria	2069
242	Ga0307406_10546973	3300031901	Unclassified	946
243	Ga0307406_10703688	3300031901	Unclassified	844
244	Ga0307406_11159756	3300031901	Bacteria	669
245	Ga0307407_10003905	3300031903	Bacteria	6222
246	Ga0307407_10669599	3300031903	Bacteria	779
247	Ga0307407_11476638	3300031903	Bacteria	537
248	Ga0307412_10398168	3300031911	Bacteria	1120
249	Ga0307412_10439251	3300031911	Bacteria	1072
250	Ga0307412_10545770	3300031911	Bacteria	973
251	Ga0307412_10929687	3300031911	Unclassified	764
252	Ga0307412_11056062	3300031911	Bacteria	720
253	Ga0307409_100182718	3300031995	Bacteria	1858
254	Ga0307409_100466890	3300031995	Unclassified	1221
255	Ga0307409_100522331	3300031995	Bacteria	1160
256	Ga0307409_100618989	3300031995	Unclassified	1072
257	Ga0307409_100622096	3300031995	Viruses	1070
258	Ga0307409_101049898	3300031995	Bacteria	834
259	Ga0307416_100026503	3300032002	Bacteria	4273
260	Ga0307416_100194493	3300032002	Bacteria	1917
261	Ga0307416_100441167	3300032002	Bacteria	1352
262	Ga0307416_100708362	3300032002	Bacteria	1096
263	Ga0307416_100723183	3300032002	Unclassified	1086
264	Ga0307416_100749558	3300032002	Bacteria	1069
265	Ga0307416_101494122	3300032002	Bacteria	781
266	Ga0307416_101668160	3300032002	Bacteria	742
267	Ga0307416_102900516	3300032002	Bacteria	574
268	Ga0307414_10018562	3300032004	Bacteria	4287
269	Ga0307414_10318853	3300032004	Bacteria	1322
270	Ga0307414_11214387	3300032004	Bacteria	698
271	Ga0307414_12051653	3300032004	Bacteria	534
272	Ga0307411_10062228	3300032005	Bacteria	2488
273	Ga0307411_10123469	3300032005	Bacteria	1878
274	Ga0307411_10190052	3300032005	Bacteria	1567
275	Ga0307411_10387134	3300032005	Bacteria	1152
276	Ga0307411_11105591	3300032005	Unclassified	715
277	Ga0307411_11284962	3300032005	Bacteria	666
278	Ga0307415_100013351	3300032126	Bacteria	4792
279	Ga0307415_100059197	3300032126	Bacteria	2641
280	Ga0307415_100066827	3300032126	Bacteria	2510
281	Ga0307415_100113135	3300032126	Bacteria	2018
282	Ga0307415_100223193	3300032126	Bacteria	1512
283	Ga0307415_102045713	3300032126	Unclassified	558
284	Ga0316583_10025085	3300032133	Bacteria	2129
285	Ga0316580_10009156	3300032139	Unclassified	2976
286	Ga0316580_10076546	3300032139	Unclassified	1024
287	Ga0373939_0448242	3300035114	Bacteria	543
288	Ga0373955_0270677	3300035172	Bacteria	1021
289	Ga0316574_0198413	3300035398	Bacteria	1289
290	Ga0316574_0371027	3300035398	Unclassified	904
291	Ga0373935_0203974	3300035692	Bacteria	1368
292	Ga0373933_0323454	3300035724	Bacteria	1000
293	Ga0373937_0217948	3300036401	Bacteria	1796
294	Ga0316582_0376658	3300036647	Unclassified	977
295	Ga0316584_0022003	3300036712	Bacteria	4644
296	Ga0316584_0593887	3300036712	Bacteria	769
297	Ga0316584_0635786	3300036712	Unclassified	737
298	Ga0395905_0077856	3300037471	Bacteria	3107
299	Ga0395905_1251065	3300037471	Unclassified	646
300	Ga0439453_0153737	3300041408	Unclassified	547
301	Ga0439461_0085738	3300041410	Bacteria	749
302	Ga0439445_0218880	3300042004	Bacteria	565
303	Ga0439455_0187090	3300042012	Unclassified	597
304	Ga0439457_019597	3300042014	Bacteria	1503
305	Ga0439462_0070765	3300042015	Bacteria	947
306	Ga0450890_032721	3300042127	Unclassified	745
307	Ga0450896_009044	3300042133	Bacteria	1386
308	Ga0450898_013860	3300042134	Bacteria	1349
309	Ga0439446_0028193	3300042156	Unclassified	1616
310	Ga0439446_0090600	3300042156	Bacteria	957
311	Ga0439435_0043586	3300042436	Bacteria	1263
312	Ga0439444_0043386	3300042437	Unclassified	891
313	Ga0439464_0140094	3300042439	Unclassified	753
314	Ga0451577_0090520	3300042876	Bacteria	2731
315	Ga0451577_0839580	3300042876	Bacteria	829
316	Ga0451577_1264323	3300042876	Bacteria	657
317	Ga0453683_0374827	3300044673	Bacteria	916
318	Ga0466965_0035342	3300044683	Bacteria	2448
319	Ga0453684_1260977	3300044712	Unclassified	773
320	Ga0466957_0548307	3300044842	Bacteria	806
321	Ga0466960_0313267	3300044901	Unclassified	887
322	Ga0451576_0097617	3300045051	Bacteria	3055
323	Ga0451576_0104942	3300045051	Bacteria	2940
324	Ga0451576_0534814	3300045051	Bacteria	1231
325	Ga0495592_0073164	3300046454	Bacteria	2493
326	Ga0495592_0483465	3300046454	Bacteria	771
327	Ga0495603_0034962	3300046455	Bacteria	3020
328	Ga0495603_0324956	3300046455	Bacteria	883
329	Ga0495603_0718930	3300046455	Bacteria	571
330	Ga0495651_0117663	3300046462	Bacteria	1956
331	Ga0495651_0415626	3300046462	Bacteria	875
332	Ga0495653_0283388	3300046463	Bacteria	1087
333	Ga0495653_0555290	3300046463	Bacteria	710
334	Ga0495582_0216799	3300046473	Bacteria	1095
335	Ga0495662_0071443	3300046476	Bacteria	1682
336	Ga0495662_0215105	3300046476	Bacteria	947
337	Ga0495664_0138699	3300046477	Bacteria	1474
338	Ga0495594_0205515	3300046499	Bacteria	1122
339	Ga0495594_0255734	3300046499	Unclassified	998
340	Ga0495594_0348529	3300046499	Unclassified	843
341	Ga0495608_0099130	3300046511	Bacteria	1880
342	Ga0495608_0124531	3300046511	Bacteria	1652
343	Ga0495618_0797998	3300046514	Bacteria	550
344	Ga0495628_0149491	3300046516	Bacteria	1780
345	Ga0495628_0228335	3300046516	Bacteria	1396
346	Ga0495630_0069656	3300046517	Bacteria	2646
347	Ga0495630_0126045	3300046517	Bacteria	1943
348	Ga0495637_0227483	3300046520	Unclassified	677
349	Ga0495652_0049580	3300046529	Bacteria	3594
350	Ga0495665_0177138	3300046531	Bacteria	1109
351	Ga0495665_0609824	3300046531	Bacteria	545
352	Ga0495640_0317502	3300046533	Bacteria	965
353	Ga0495586_0498135	3300046535	Bacteria	703
354	Ga0495587_0049108	3300046536	Bacteria	2498
355	Ga0495645_0134965	3300046543	Bacteria	1727
356	Ga0495667_0144864	3300046559	Bacteria	1530
357	Ga0495634_0041358	3300046642	Bacteria	3130
358	Ga0495611_0272320	3300046648	Unclassified	783
359	Ga0495635_1007591	3300046663	Bacteria	530
360	Ga0495659_0490690	3300046664	Unclassified	538
361	Ga0495657_0186400	3300046675	Bacteria	1270
362	Ga0495599_0112712	3300046678	Bacteria	1693
363	Ga0495646_0396181	3300046680	Bacteria	718
364	Ga0495647_0108566	3300046681	Bacteria	1156
365	Ga0495658_0074389	3300046683	Bacteria	1980
366	Ga0495613_0073800	3300046689	Bacteria	2485
367	Ga0495613_0203000	3300046689	Bacteria	1397
368	Ga0495600_0101945	3300046809	Bacteria	1871
369	Ga0495581_0476490	3300047315	Unclassified	726
370	Ga0495604_0100845	3300047317	Bacteria	2122
371	Ga0495604_0242800	3300047317	Bacteria	1231
372	Ga0495636_0053854	3300047318	Bacteria	1690
373	Ga0495636_0305227	3300047318	Unclassified	745
374	Ga0495674_0067323	3300047319	Bacteria	3103
375	Ga0495674_0287895	3300047319	Bacteria	1344
376	Ga0495674_1123054	3300047319	Bacteria	597
377	Ga0495683_0268432	3300047323	Unclassified	743
378	Ga0495675_0188883	3300047444	Bacteria	1258
379	Ga0495684_0040600	3300047471	Bacteria	3566
380	Ga0495593_0126032	3300047673	Bacteria	1302
381	Ga0495602_0270938	3300048088	Bacteria	1255
382	Ga0496100_0612717	3300048903	Bacteria	846
383	Ga0496101_0064688	3300048904	Bacteria	2665
384	Ga0496102_0114630	3300048905	Unclassified	2515
385	Ga0496102_0142779	3300048905	Unclassified	2246
386	Ga0496102_0472589	3300048905	Unclassified	1175
387	Ga0496105_0805496	3300048908	Bacteria	714
388	Ga0496106_0235299	3300048909	Bacteria	1463
389	Ga0496106_0573582	3300048909	Bacteria	905
390	Ga0496106_0635563	3300048909	Archaea	853
391	Ga0496107_0516584	3300048910	Unclassified	886
392	Ga0496107_1021083	3300048910	Unclassified	600
393	Ga0496108_0028070	3300048911	Bacteria	4655
394	Ga0496109_0019996	3300048912	Bacteria	5911
395	Ga0496110_0022215	3300048913	Bacteria	5384
396	Ga0496110_0477438	3300048913	Bacteria	1136
397	Ga0496111_0053412	3300048914	Bacteria	2919
398	Ga0496111_0788983	3300048914	Bacteria	688
399	Ga0496112_0023807	3300048915	Bacteria	5857
400	Ga0496113_0005346	3300048916	Bacteria	8002
401	Ga0496114_0080384	3300048917	Bacteria	2753
402	Ga0496114_0405666	3300048917	Bacteria	1207
403	Ga0496114_1217866	3300048917	Bacteria	639
404	Ga0496115_0003459	3300048918	Bacteria	11345
405	Ga0501031_0030972	3300049568	Unclassified	3490
406	Ga0501033_0152487	3300049570	Bacteria	1667
407	Ga0501033_0203390	3300049570	Bacteria	1414
408	Ga0501036_0047420	3300049572	Bacteria	3639
409	Ga0501036_0241127	3300049572	Unclassified	1516
410	Ga0501036_0344662	3300049572	Bacteria	1244
411	Ga0501038_0353042	3300049574	Bacteria	1145
412	Ga0501039_1181368	3300049575	Bacteria	592
413	Ga0501040_0030505	3300049576	Bacteria	3642
414	Ga0501040_0052424	3300049576	Bacteria	2792
415	Ga0501041_0239744	3300049577	Unclassified	1139
416	Ga0501041_0780350	3300049577	Bacteria	612
417	Ga0501041_1068895	3300049577	Bacteria	520
418	Ga0501042_0038168	3300049578	Bacteria	3411
419	Ga0501042_0349529	3300049578	Unclassified	1069
420	Ga0501043_0986705	3300049579	Bacteria	600
421	Ga0501046_0156624	3300049580	Unclassified	1715
422	Ga0501048_0078341	3300049582	Bacteria	2332
423	Ga0501048_0261847	3300049582	Unclassified	1229
424	Ga0501068_0498220	3300049584	Unclassified	790
425	Ga0501069_0466912	3300049585	Unclassified	751
426	Ga0501071_0016921	3300049587	Bacteria	5018
427	Ga0501071_0064744	3300049587	Unclassified	2653
428	Ga0501072_0037161	3300049588	Bacteria	3819
429	Ga0501072_0299812	3300049588	Unclassified	1278
430	Ga0501072_1229827	3300049588	Bacteria	581
431	Ga0501073_0578166	3300049589	Bacteria	776
432	Ga0501073_0683650	3300049589	Bacteria	708
433	Ga0501074_0390387	3300049590	Bacteria	987
434	Ga0501074_0483782	3300049590	Unclassified	877
435	Ga0501075_0025491	3300049591	Bacteria	4344
436	Ga0501075_1454634	3300049591	Bacteria	519
437	Ga0501076_0041933	3300049592	Bacteria	3603
438	Ga0501076_0302583	3300049592	Unclassified	1311
439	Ga0501076_1295666	3300049592	Unclassified	599
440	Ga0501077_0026127	3300049593	Bacteria	3705
441	Ga0501077_0251624	3300049593	Bacteria	1124
442	Ga0501235_229628	3300049669	Bacteria	512
443	Ga0501236_130849	3300049670	Bacteria	517
444	Ga0501245_019670	3300049708	Bacteria	1048
445	Ga0501079_0051977	3300049741	Bacteria	3164
446	Ga0501079_0112296	3300049741	Unclassified	2118
447	Ga0501079_0317507	3300049741	Bacteria	1220
448	Ga0501079_0339530	3300049741	Unclassified	1177
449	Ga0501079_0395467	3300049741	Bacteria	1084
450	Ga0501079_0785333	3300049741	Unclassified	750
451	Ga0501080_0594291	3300049742	Bacteria	983
452	Ga0501080_0650878	3300049742	Unclassified	932
453	Ga0501081_0114766	3300049743	Bacteria	1914
454	Ga0501081_1029471	3300049743	Bacteria	622
455	Ga0501083_0294557	3300049744	Bacteria	1055
456	Ga0501268_007011	3300049765	Bacteria	1672
457	Ga0501035_0196271	3300049822	Unclassified	1734
458	Ga0501035_0423282	3300049822	Bacteria	1105
459	Ga0501045_0127488	3300049824	Bacteria	1891
460	Ga0501045_0212693	3300049824	Unclassified	1440
461	Ga0501045_0509021	3300049824	Bacteria	894
462	Ga0501045_0568116	3300049824	Bacteria	841
463	nmdc:mga05p37_581684_c1	3300050507	Bacteria	1268
464	nmdc:mga09592_867413_c1	3300050508	Unclassified	760
465	nmdc:mga0qj67_924796_c1	3300050509	Bacteria	686
466	nmdc:mga06r32_174094_c1	3300050510	Bacteria	2136
467	nmdc:mga08y16_472683_c1	3300050511	Unclassified	1276
468	nmdc:mga08y16_473853_c1	3300050511	Unclassified	1274
469	nmdc:mga0n895_78095_c1	3300050512	Bacteria	3294
470	nmdc:mga0rr50_357221_c1	3300050513	Bacteria	1229
471	nmdc:mga0a205_719000_c1	3300050515	Bacteria	848
472	nmdc:mga0a205_720334_c1	3300050515	Bacteria	847
473	Ga0495612_0599935	3300053078	Bacteria	509
474	Ga0501084_0134519	3300054114	Bacteria	2081
475	Ga0501084_0382043	3300054114	Bacteria	1190
476	Ga0501084_0584279	3300054114	Bacteria	944
477	Ga0501084_1586758	3300054114	Archaea	547
478	Ga0590074_021414	3300059423	Bacteria	1114
479	Ga0590075_036891	3300059424	Unclassified	1246
480	Ga0590075_045071	3300059424	Unclassified	1129
481	Ga0590077_176076	3300059426	Bacteria	515
482	Ga0501082_0238578	3300060353	Bacteria	1582
483	Ga0501082_0705247	3300060353	Bacteria	883
484	Ga0501082_1124728	3300060353	Bacteria	687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005434	Ga0070709_10483245	Ga0070709_104832452	45
2	3300005435	Ga0070714_100375584	Ga0070714_1003755842	45
3	3300005437	Ga0070710_10574841	Ga0070710_105748412	45
4	3300005439	Ga0070711_101781673	Ga0070711_1017816732	45
5	3300005563	Ga0068855_100839716	Ga0068855_1008397162	45
6	3300013105	Ga0157369_11219530	Ga0157369_112195301	45
7	3300013307	Ga0157372_12021361	Ga0157372_120213612	45
8	3300013307	Ga0157372_13138047	Ga0157372_131380472	45
9	3300005355	Ga0070671_100266521	Ga0070671_1002665212	47
10	3300031911	Ga0307412_10929687	Ga0307412_109296872	47
11	3300044683	Ga0466965_0035342	Ga0466965_0035342_1373_1546	47
12	3300048908	Ga0496105_0805496	Ga0496105_0805496_55_222	47
13	3300048909	Ga0496106_0573582	Ga0496106_0573582_160_327	47
14	3300048917	Ga0496114_0405666	Ga0496114_0405666_531_698	47
15	3300048918	Ga0496115_0003459	Ga0496115_0003459_10011_10178	47
16	3300005327	Ga0070658_10283478	Ga0070658_102834783	48
17	3300013102	Ga0157371_10374515	Ga0157371_103745152	48
18	3300013105	Ga0157369_10019160	Ga0157369_100191607	48
19	3300013307	Ga0157372_10132463	Ga0157372_101324633	48
20	3300032002	Ga0307416_100026503	Ga0307416_1000265034	48
21	3300032002	Ga0307416_101668160	Ga0307416_1016681601	48
22	3300032002	Ga0307416_102900516	Ga0307416_1029005162	48
23	3300005535	Ga0070684_100393881	Ga0070684_1003938812	49
24	3300005937	Ga0081455_10187673	Ga0081455_101876733	49
25	3300035172	Ga0373955_0270677	Ga0373955_0270677_809_976	49
26	3300035724	Ga0373933_0323454	Ga0373933_0323454_168_344	49
27	3300036401	Ga0373937_0217948	Ga0373937_0217948_160_336	49
28	3300042876	Ga0451577_0839580	Ga0451577_0839580_427_594	49
29	3300046454	Ga0495592_0073164	Ga0495592_0073164_942_1118	49
30	3300046454	Ga0495592_0483465	Ga0495592_0483465_131_298	49
31	3300046455	Ga0495603_0034962	Ga0495603_0034962_118_285	49
32	3300046462	Ga0495651_0117663	Ga0495651_0117663_992_1159	49
33	3300046462	Ga0495651_0415626	Ga0495651_0415626_578_754	49
34	3300046463	Ga0495653_0283388	Ga0495653_0283388_184_360	49
35	3300046463	Ga0495653_0555290	Ga0495653_0555290_523_690	49
36	3300046473	Ga0495582_0216799	Ga0495582_0216799_619_795	49
37	3300046476	Ga0495662_0071443	Ga0495662_0071443_938_1114	49
38	3300046476	Ga0495662_0215105	Ga0495662_0215105_223_390	49
39	3300046477	Ga0495664_0138699	Ga0495664_0138699_444_611	49
40	3300046499	Ga0495594_0348529	Ga0495594_0348529_543_710	49
41	3300046511	Ga0495608_0099130	Ga0495608_0099130_112_288	49
42	3300046511	Ga0495608_0124531	Ga0495608_0124531_582_749	49
43	3300046514	Ga0495618_0797998	Ga0495618_0797998_79_255	49
44	3300046516	Ga0495628_0149491	Ga0495628_0149491_375_542	49
45	3300046516	Ga0495628_0228335	Ga0495628_0228335_938_1114	49
46	3300046517	Ga0495630_0069656	Ga0495630_0069656_1939_2115	49
47	3300046517	Ga0495630_0126045	Ga0495630_0126045_657_824	49
48	3300046529	Ga0495652_0049580	Ga0495652_0049580_2309_2485	49
49	3300046531	Ga0495665_0177138	Ga0495665_0177138_230_406	49
50	3300046531	Ga0495665_0609824	Ga0495665_0609824_309_476	49
51	3300046533	Ga0495640_0317502	Ga0495640_0317502_471_638	49
52	3300046535	Ga0495586_0498135	Ga0495586_0498135_109_276	49
53	3300046536	Ga0495587_0049108	Ga0495587_0049108_1831_2007	49
54	3300046543	Ga0495645_0134965	Ga0495645_0134965_238_414	49
55	3300046559	Ga0495667_0144864	Ga0495667_0144864_949_1116	49
56	3300046642	Ga0495634_0041358	Ga0495634_0041358_953_1120	49
57	3300046675	Ga0495657_0186400	Ga0495657_0186400_479_646	49
58	3300046678	Ga0495599_0112712	Ga0495599_0112712_359_535	49
59	3300046680	Ga0495646_0396181	Ga0495646_0396181_430_606	49
60	3300046681	Ga0495647_0108566	Ga0495647_0108566_163_330	49
61	3300046683	Ga0495658_0074389	Ga0495658_0074389_1429_1596	49
62	3300046689	Ga0495613_0073800	Ga0495613_0073800_971_1138	49
63	3300046689	Ga0495613_0203000	Ga0495613_0203000_979_1155	49
64	3300046809	Ga0495600_0101945	Ga0495600_0101945_1548_1724	49
65	3300047315	Ga0495581_0476490	Ga0495581_0476490_191_367	49
66	3300047317	Ga0495604_0100845	Ga0495604_0100845_436_612	49
67	3300047317	Ga0495604_0242800	Ga0495604_0242800_180_347	49
68	3300047319	Ga0495674_0067323	Ga0495674_0067323_536_712	49
69	3300047319	Ga0495674_0287895	Ga0495674_0287895_328_495	49
70	3300047319	Ga0495674_1123054	Ga0495674_1123054_267_434	49
71	3300047444	Ga0495675_0188883	Ga0495675_0188883_389_565	49
72	3300047471	Ga0495684_0040600	Ga0495684_0040600_1851_2027	49
73	3300047673	Ga0495593_0126032	Ga0495593_0126032_125_292	49
74	3300048088	Ga0495602_0270938	Ga0495602_0270938_751_927	49
75	3300053078	Ga0495612_0599935	Ga0495612_0599935_292_459	49
76	3300031711	Ga0265314_10031554	Ga0265314_100315541	54
77	3300032133	Ga0316583_10025085	Ga0316583_100250854	54
78	3300049741	Ga0501079_0785333	Ga0501079_0785333_240_404	54
79	3300049743	Ga0501081_1029471	Ga0501081_1029471_422_586	54
80	3300049824	Ga0501045_0509021	Ga0501045_0509021_465_632	54
81	3300060353	Ga0501082_1124728	Ga0501082_1124728_67_231	54
82	3300005295	Ga0065707_10676225	Ga0065707_106762251	55
83	3300005328	Ga0070676_10096087	Ga0070676_100960872	55
84	3300005329	Ga0070683_100150371	Ga0070683_1001503712	55
85	3300005330	Ga0070690_100063906	Ga0070690_1000639063	55
86	3300005331	Ga0070670_101908648	Ga0070670_1019086481	55
87	3300005334	Ga0068869_100049812	Ga0068869_1000498123	55
88	3300005334	Ga0068869_101071259	Ga0068869_1010712592	55
89	3300005335	Ga0070666_10035113	Ga0070666_100351133	55
90	3300005336	Ga0070680_100761326	Ga0070680_1007613262	55
91	3300005338	Ga0068868_100447220	Ga0068868_1004472202	55
92	3300005339	Ga0070660_100977470	Ga0070660_1009774702	55
93	3300005341	Ga0070691_10057917	Ga0070691_100579173	55
94	3300005345	Ga0070692_10176348	Ga0070692_101763482	55
95	3300005347	Ga0070668_100077377	Ga0070668_1000773771	55
96	3300005347	Ga0070668_100581909	Ga0070668_1005819092	55
97	3300005353	Ga0070669_100018221	Ga0070669_1000182215	55
98	3300005354	Ga0070675_100180121	Ga0070675_1001801213	55
99	3300005354	Ga0070675_100751113	Ga0070675_1007511132	55
100	3300005355	Ga0070671_100158100	Ga0070671_1001581001	55
101	3300005364	Ga0070673_100567816	Ga0070673_1005678161	55
102	3300005364	Ga0070673_101112310	Ga0070673_1011123102	55
103	3300005366	Ga0070659_101927089	Ga0070659_1019270892	55
104	3300005367	Ga0070667_100043136	Ga0070667_1000431364	55
105	3300005406	Ga0070703_10028728	Ga0070703_100287282	55
106	3300005434	Ga0070709_10966308	Ga0070709_109663082	55
107	3300005436	Ga0070713_100300496	Ga0070713_1003004961	55
108	3300005440	Ga0070705_100038273	Ga0070705_1000382732	55
109	3300005441	Ga0070700_100136936	Ga0070700_1001369362	55
110	3300005441	Ga0070700_101225666	Ga0070700_1012256662	55
111	3300005444	Ga0070694_100101550	Ga0070694_1001015503	55
112	3300005444	Ga0070694_101931102	Ga0070694_1019311021	55
113	3300005445	Ga0070708_100194300	Ga0070708_1001943002	55
114	3300005445	Ga0070708_101783249	Ga0070708_1017832492	55
115	3300005455	Ga0070663_100130892	Ga0070663_1001308922	55
116	3300005455	Ga0070663_100949690	Ga0070663_1009496902	55
117	3300005456	Ga0070678_100050766	Ga0070678_1000507663	55
118	3300005457	Ga0070662_100000543	Ga0070662_1000005432	55
119	3300005457	Ga0070662_100415496	Ga0070662_1004154962	55
120	3300005458	Ga0070681_10495287	Ga0070681_104952872	55
121	3300005459	Ga0068867_100000355	Ga0068867_1000003554	55
122	3300005467	Ga0070706_101115522	Ga0070706_1011155222	55
123	3300005471	Ga0070698_100238997	Ga0070698_1002389973	55
124	3300005471	Ga0070698_100652464	Ga0070698_1006524642	55
125	3300005471	Ga0070698_101547771	Ga0070698_1015477712	55
126	3300005518	Ga0070699_100001319	Ga0070699_1000013194	55
127	3300005518	Ga0070699_100175760	Ga0070699_1001757601	55
128	3300005536	Ga0070697_100599650	Ga0070697_1005996502	55
129	3300005539	Ga0068853_100276597	Ga0068853_1002765972	55
130	3300005543	Ga0070672_100532262	Ga0070672_1005322622	55
131	3300005544	Ga0070686_100668911	Ga0070686_1006689112	55
132	3300005545	Ga0070695_100016999	Ga0070695_1000169994	55
133	3300005546	Ga0070696_100008005	Ga0070696_1000080054	55
134	3300005546	Ga0070696_100438934	Ga0070696_1004389342	55
135	3300005547	Ga0070693_100090362	Ga0070693_1000903624	55
136	3300005549	Ga0070704_100925459	Ga0070704_1009254592	55
137	3300005549	Ga0070704_101128919	Ga0070704_1011289191	55
138	3300005563	Ga0068855_100106490	Ga0068855_1001064902	55
139	3300005564	Ga0070664_100201701	Ga0070664_1002017012	55
140	3300005577	Ga0068857_100031912	Ga0068857_1000319122	55
141	3300005578	Ga0068854_100024588	Ga0068854_1000245882	55
142	3300005614	Ga0068856_102123363	Ga0068856_1021233632	55
143	3300005615	Ga0070702_100056865	Ga0070702_1000568654	55
144	3300005616	Ga0068852_100226172	Ga0068852_1002261722	55
145	3300005617	Ga0068859_100895331	Ga0068859_1008953312	55
146	3300005617	Ga0068859_101401860	Ga0068859_1014018602	55
147	3300005618	Ga0068864_100024787	Ga0068864_1000247875	55
148	3300005718	Ga0068866_10000078	Ga0068866_1000007838	55
149	3300005719	Ga0068861_100035282	Ga0068861_1000352824	55
150	3300005719	Ga0068861_100174179	Ga0068861_1001741792	55
151	3300005840	Ga0068870_10177462	Ga0068870_101774622	55
152	3300005842	Ga0068858_100412156	Ga0068858_1004121561	55
153	3300005842	Ga0068858_102466331	Ga0068858_1024663312	55
154	3300005843	Ga0068860_100028485	Ga0068860_1000284854	55
155	3300005843	Ga0068860_101696961	Ga0068860_1016969612	55
156	3300005844	Ga0068862_100363378	Ga0068862_1003633782	55
157	3300005844	Ga0068862_100464396	Ga0068862_1004643962	55
158	3300006237	Ga0097621_100257727	Ga0097621_1002577273	55
159	3300006844	Ga0075428_100289776	Ga0075428_1002897762	55
160	3300006844	Ga0075428_102602399	Ga0075428_1026023992	55
161	3300006844	Ga0075428_102660173	Ga0075428_1026601732	55
162	3300006846	Ga0075430_100498291	Ga0075430_1004982912	55
163	3300006846	Ga0075430_101490932	Ga0075430_1014909322	55
164	3300006847	Ga0075431_100948457	Ga0075431_1009484572	55
165	3300006852	Ga0075433_10740389	Ga0075433_107403892	55
166	3300006852	Ga0075433_10876788	Ga0075433_108767882	55
167	3300006871	Ga0075434_100053168	Ga0075434_1000531683	55
168	3300006871	Ga0075434_101160495	Ga0075434_1011604951	55
169	3300006881	Ga0068865_100017527	Ga0068865_1000175274	55
170	3300006881	Ga0068865_101612070	Ga0068865_1016120702	55
171	3300006914	Ga0075436_101104068	Ga0075436_1011040682	55
172	3300006931	Ga0097620_100895453	Ga0097620_1008954532	55
173	3300006931	Ga0097620_101401808	Ga0097620_1014018082	55
174	3300009094	Ga0111539_10458617	Ga0111539_104586172	55
175	3300009094	Ga0111539_10634578	Ga0111539_106345782	55
176	3300009098	Ga0105245_10225127	Ga0105245_102251272	55
177	3300009147	Ga0114129_13307976	Ga0114129_133079762	55
178	3300009148	Ga0105243_10009895	Ga0105243_100098957	55
179	3300009174	Ga0105241_10029669	Ga0105241_100296694	55
180	3300009176	Ga0105242_10166664	Ga0105242_101666644	55
181	3300009176	Ga0105242_10413971	Ga0105242_104139712	55
182	3300009177	Ga0105248_10070061	Ga0105248_100700614	55
183	3300009177	Ga0105248_10764024	Ga0105248_107640241	55
184	3300009551	Ga0105238_10478638	Ga0105238_104786383	55
185	3300009553	Ga0105249_10023761	Ga0105249_100237612	55
186	3300009553	Ga0105249_10214489	Ga0105249_102144892	55
187	3300009553	Ga0105249_10600895	Ga0105249_106008951	55
188	3300009553	Ga0105249_10877542	Ga0105249_108775422	55
189	3300009553	Ga0105249_12735456	Ga0105249_127354562	55
190	3300010375	Ga0105239_10452221	Ga0105239_104522212	55
191	3300010375	Ga0105239_11058937	Ga0105239_110589372	55
192	3300011119	Ga0105246_11248068	Ga0105246_112480682	55
193	3300013102	Ga0157371_10046843	Ga0157371_100468432	55
194	3300013297	Ga0157378_10001907	Ga0157378_1000190715	55
195	3300013306	Ga0163162_10113968	Ga0163162_101139682	55
196	3300013306	Ga0163162_12158293	Ga0163162_121582932	55
197	3300013307	Ga0157372_10091774	Ga0157372_100917742	55
198	3300013308	Ga0157375_10127568	Ga0157375_101275682	55
199	3300013308	Ga0157375_10315426	Ga0157375_103154262	55
200	3300014326	Ga0157380_10121628	Ga0157380_101216282	55
201	3300014326	Ga0157380_11603590	Ga0157380_116035901	55
202	3300014326	Ga0157380_12664310	Ga0157380_126643102	55
203	3300014968	Ga0157379_10430973	Ga0157379_104309732	55
204	3300014968	Ga0157379_10915459	Ga0157379_109154592	55
205	3300014969	Ga0157376_11056474	Ga0157376_110564742	55
206	3300017792	Ga0163161_10048053	Ga0163161_100480533	55
207	3300025885	Ga0207653_10045352	Ga0207653_100453522	55
208	3300025899	Ga0207642_10003635	Ga0207642_100036354	55
209	3300025899	Ga0207642_11139579	Ga0207642_111395792	55
210	3300025901	Ga0207688_10541683	Ga0207688_105416832	55
211	3300025903	Ga0207680_10063960	Ga0207680_100639603	55
212	3300025904	Ga0207647_10540504	Ga0207647_105405042	55
213	3300025906	Ga0207699_10818106	Ga0207699_108181062	55
214	3300025907	Ga0207645_10006666	Ga0207645_100066664	55
215	3300025908	Ga0207643_10014532	Ga0207643_100145324	55
216	3300025910	Ga0207684_11334247	Ga0207684_113342471	55
217	3300025911	Ga0207654_10237963	Ga0207654_102379632	55
218	3300025917	Ga0207660_10427267	Ga0207660_104272671	55
219	3300025920	Ga0207649_10033026	Ga0207649_100330263	55
220	3300025923	Ga0207681_10011893	Ga0207681_100118933	55
221	3300025924	Ga0207694_11262114	Ga0207694_112621141	55
222	3300025925	Ga0207650_11518124	Ga0207650_115181242	55
223	3300025926	Ga0207659_10807975	Ga0207659_108079752	55
224	3300025926	Ga0207659_11456893	Ga0207659_114568932	55
225	3300025928	Ga0207700_11356820	Ga0207700_113568202	55
226	3300025931	Ga0207644_10131866	Ga0207644_101318664	55
227	3300025932	Ga0207690_10311005	Ga0207690_103110052	55
228	3300025933	Ga0207706_10000146	Ga0207706_1000014675	55
229	3300025933	Ga0207706_10264869	Ga0207706_102648693	55
230	3300025934	Ga0207686_10000143	Ga0207686_1000014329	55
231	3300025935	Ga0207709_10004364	Ga0207709_100043644	55
232	3300025937	Ga0207669_10004336	Ga0207669_100043365	55
233	3300025938	Ga0207704_10000443	Ga0207704_100004438	55
234	3300025940	Ga0207691_10091184	Ga0207691_100911844	55
235	3300025941	Ga0207711_10002596	Ga0207711_1000259612	55
236	3300025942	Ga0207689_10069940	Ga0207689_100699404	55
237	3300025942	Ga0207689_11167894	Ga0207689_111678942	55
238	3300025944	Ga0207661_10344894	Ga0207661_103448942	55
239	3300025945	Ga0207679_10099942	Ga0207679_100999424	55
240	3300025960	Ga0207651_11228278	Ga0207651_112282782	55
241	3300025961	Ga0207712_10010666	Ga0207712_100106662	55
242	3300025961	Ga0207712_10682305	Ga0207712_106823052	55
243	3300025961	Ga0207712_11512492	Ga0207712_115124922	55
244	3300025972	Ga0207668_10015006	Ga0207668_100150062	55
245	3300025972	Ga0207668_11035146	Ga0207668_110351462	55
246	3300025981	Ga0207640_10019998	Ga0207640_100199984	55
247	3300025986	Ga0207658_10416057	Ga0207658_104160572	55
248	3300026023	Ga0207677_10382839	Ga0207677_103828392	55
249	3300026035	Ga0207703_10210042	Ga0207703_102100422	55
250	3300026035	Ga0207703_11444469	Ga0207703_114444692	55
251	3300026041	Ga0207639_10555460	Ga0207639_105554602	55
252	3300026067	Ga0207678_10410760	Ga0207678_104107602	55
253	3300026067	Ga0207678_10803639	Ga0207678_108036392	55
254	3300026075	Ga0207708_10101531	Ga0207708_101015312	55
255	3300026075	Ga0207708_10332424	Ga0207708_103324242	55
256	3300026089	Ga0207648_10000905	Ga0207648_1000090532	55
257	3300026095	Ga0207676_10157879	Ga0207676_101578792	55
258	3300026095	Ga0207676_10782545	Ga0207676_107825452	55
259	3300026116	Ga0207674_10027362	Ga0207674_100273626	55
260	3300026116	Ga0207674_10526251	Ga0207674_105262512	55
261	3300026118	Ga0207675_100227949	Ga0207675_1002279492	55
262	3300026118	Ga0207675_100700035	Ga0207675_1007000352	55
263	3300026121	Ga0207683_10078104	Ga0207683_100781044	55
264	3300026142	Ga0207698_12150030	Ga0207698_121500302	55
265	3300027471	Ga0209995_1082202	Ga0209995_10822022	55
266	3300027471	Ga0209995_1094883	Ga0209995_10948832	55
267	3300027543	Ga0209999_1092625	Ga0209999_10926252	55
268	3300027695	Ga0209966_1014983	Ga0209966_10149832	55
269	3300028380	Ga0268265_10132132	Ga0268265_101321323	55
270	3300028380	Ga0268265_10777653	Ga0268265_107776532	55
271	3300028381	Ga0268264_10055233	Ga0268264_100552332	55
272	3300028381	Ga0268264_10139394	Ga0268264_101393942	55
273	3300031548	Ga0307408_100032986	Ga0307408_1000329862	55
274	3300031548	Ga0307408_100061036	Ga0307408_1000610363	55
275	3300031548	Ga0307408_100179902	Ga0307408_1001799023	55
276	3300031548	Ga0307408_101687916	Ga0307408_1016879162	55
277	3300031727	Ga0316576_10019523	Ga0316576_100195234	55
278	3300031727	Ga0316576_10207413	Ga0316576_102074132	55
279	3300031728	Ga0316578_10003140	Ga0316578_100031406	55
280	3300031728	Ga0316578_10048562	Ga0316578_100485623	55
281	3300031728	Ga0316578_10287908	Ga0316578_102879082	55
282	3300031731	Ga0307405_10039240	Ga0307405_100392404	55
283	3300031731	Ga0307405_10136889	Ga0307405_101368892	55
284	3300031731	Ga0307405_10217368	Ga0307405_102173682	55
285	3300031731	Ga0307405_10692088	Ga0307405_106920882	55
286	3300031731	Ga0307405_10884804	Ga0307405_108848042	55
287	3300031731	Ga0307405_11132615	Ga0307405_111326152	55
288	3300031733	Ga0316577_10001692	Ga0316577_100016923	55
289	3300031733	Ga0316577_10025766	Ga0316577_100257664	55
290	3300031733	Ga0316577_10424739	Ga0316577_104247392	55
291	3300031824	Ga0307413_10022519	Ga0307413_100225193	55
292	3300031824	Ga0307413_10048004	Ga0307413_100480042	55
293	3300031824	Ga0307413_10119338	Ga0307413_101193382	55
294	3300031824	Ga0307413_10190334	Ga0307413_101903342	55
295	3300031824	Ga0307413_10867992	Ga0307413_108679922	55
296	3300031824	Ga0307413_10984092	Ga0307413_109840922	55
297	3300031852	Ga0307410_10024359	Ga0307410_100243591	55
298	3300031852	Ga0307410_10094903	Ga0307410_100949031	55
299	3300031852	Ga0307410_10110845	Ga0307410_101108452	55
300	3300031852	Ga0307410_10189711	Ga0307410_101897112	55
301	3300031852	Ga0307410_10287609	Ga0307410_102876092	55
302	3300031852	Ga0307410_10814658	Ga0307410_108146581	55
303	3300031852	Ga0307410_10834138	Ga0307410_108341382	55
304	3300031852	Ga0307410_10988013	Ga0307410_109880132	55
305	3300031852	Ga0307410_11347862	Ga0307410_113478622	55
306	3300031901	Ga0307406_10089443	Ga0307406_100894432	55
307	3300031901	Ga0307406_10546973	Ga0307406_105469732	55
308	3300031901	Ga0307406_10703688	Ga0307406_107036882	55
309	3300031901	Ga0307406_11159756	Ga0307406_111597561	55
310	3300031903	Ga0307407_10003905	Ga0307407_100039057	55
311	3300031903	Ga0307407_10669599	Ga0307407_106695992	55
312	3300031903	Ga0307407_11476638	Ga0307407_114766382	55
313	3300031911	Ga0307412_10398168	Ga0307412_103981682	55
314	3300031911	Ga0307412_10439251	Ga0307412_104392512	55
315	3300031911	Ga0307412_10545770	Ga0307412_105457702	55
316	3300031911	Ga0307412_11056062	Ga0307412_110560622	55
317	3300031995	Ga0307409_100182718	Ga0307409_1001827182	55
318	3300031995	Ga0307409_100466890	Ga0307409_1004668902	55
319	3300031995	Ga0307409_100522331	Ga0307409_1005223312	55
320	3300031995	Ga0307409_100618989	Ga0307409_1006189892	55
321	3300031995	Ga0307409_100622096	Ga0307409_1006220962	55
322	3300031995	Ga0307409_101049898	Ga0307409_1010498982	55
323	3300032002	Ga0307416_100194493	Ga0307416_1001944934	55
324	3300032002	Ga0307416_100441167	Ga0307416_1004411671	55
325	3300032002	Ga0307416_100708362	Ga0307416_1007083622	55
326	3300032002	Ga0307416_100723183	Ga0307416_1007231832	55
327	3300032002	Ga0307416_100749558	Ga0307416_1007495582	55
328	3300032002	Ga0307416_101494122	Ga0307416_1014941222	55
329	3300032004	Ga0307414_10018562	Ga0307414_100185625	55
330	3300032004	Ga0307414_10318853	Ga0307414_103188532	55
331	3300032004	Ga0307414_11214387	Ga0307414_112143872	55
332	3300032004	Ga0307414_12051653	Ga0307414_120516532	55
333	3300032005	Ga0307411_10062228	Ga0307411_100622284	55
334	3300032005	Ga0307411_10123469	Ga0307411_101234694	55
335	3300032005	Ga0307411_10190052	Ga0307411_101900522	55
336	3300032005	Ga0307411_10387134	Ga0307411_103871342	55
337	3300032005	Ga0307411_11105591	Ga0307411_111055912	55
338	3300032005	Ga0307411_11284962	Ga0307411_112849622	55
339	3300032126	Ga0307415_100013351	Ga0307415_1000133515	55
340	3300032126	Ga0307415_100059197	Ga0307415_1000591972	55
341	3300032126	Ga0307415_100066827	Ga0307415_1000668274	55
342	3300032126	Ga0307415_100113135	Ga0307415_1001131352	55
343	3300032126	Ga0307415_100223193	Ga0307415_1002231933	55
344	3300032126	Ga0307415_102045713	Ga0307415_1020457131	55
345	3300032139	Ga0316580_10009156	Ga0316580_100091563	55
346	3300032139	Ga0316580_10076546	Ga0316580_100765461	55
347	3300035114	Ga0373939_0448242	Ga0373939_0448242_115_282	55
348	3300035398	Ga0316574_0198413	Ga0316574_0198413_914_1081	55
349	3300035398	Ga0316574_0371027	Ga0316574_0371027_476_643	55
350	3300035692	Ga0373935_0203974	Ga0373935_0203974_416_583	55
351	3300036647	Ga0316582_0376658	Ga0316582_0376658_142_309	55
352	3300036712	Ga0316584_0022003	Ga0316584_0022003_3892_4059	55
353	3300036712	Ga0316584_0593887	Ga0316584_0593887_197_364	55
354	3300036712	Ga0316584_0635786	Ga0316584_0635786_137_304	55
355	3300037471	Ga0395905_0077856	Ga0395905_0077856_2398_2568	55
356	3300037471	Ga0395905_1251065	Ga0395905_1251065_308_475	55
357	3300041408	Ga0439453_0153737	Ga0439453_0153737_283_456	55
358	3300041410	Ga0439461_0085738	Ga0439461_0085738_158_325	55
359	3300042004	Ga0439445_0218880	Ga0439445_0218880_192_362	55
360	3300042012	Ga0439455_0187090	Ga0439455_0187090_233_400	55
361	3300042014	Ga0439457_019597	Ga0439457_019597_396_566	55
362	3300042015	Ga0439462_0070765	Ga0439462_0070765_443_613	55
363	3300042127	Ga0450890_032721	Ga0450890_032721_456_623	55
364	3300042133	Ga0450896_009044	Ga0450896_009044_230_400	55
365	3300042134	Ga0450898_013860	Ga0450898_013860_904_1074	55
366	3300042156	Ga0439446_0028193	Ga0439446_0028193_699_869	55
367	3300042156	Ga0439446_0090600	Ga0439446_0090600_119_286	55
368	3300042436	Ga0439435_0043586	Ga0439435_0043586_727_894	55
369	3300042437	Ga0439444_0043386	Ga0439444_0043386_492_662	55
370	3300042439	Ga0439464_0140094	Ga0439464_0140094_321_488	55
371	3300042876	Ga0451577_0090520	Ga0451577_0090520_995_1162	55
372	3300042876	Ga0451577_1264323	Ga0451577_1264323_195_362	55
373	3300044673	Ga0453683_0374827	Ga0453683_0374827_414_581	55
374	3300044712	Ga0453684_1260977	Ga0453684_1260977_301_468	55
375	3300044842	Ga0466957_0548307	Ga0466957_0548307_528_698	55
376	3300044901	Ga0466960_0313267	Ga0466960_0313267_376_543	55
377	3300045051	Ga0451576_0097617	Ga0451576_0097617_1641_1808	55
378	3300045051	Ga0451576_0104942	Ga0451576_0104942_2577_2744	55
379	3300045051	Ga0451576_0534814	Ga0451576_0534814_140_307	55
380	3300046455	Ga0495603_0324956	Ga0495603_0324956_76_243	55
381	3300046455	Ga0495603_0718930	Ga0495603_0718930_361_531	55
382	3300046499	Ga0495594_0205515	Ga0495594_0205515_363_530	55
383	3300046499	Ga0495594_0255734	Ga0495594_0255734_141_311	55
384	3300046520	Ga0495637_0227483	Ga0495637_0227483_153_320	55
385	3300046648	Ga0495611_0272320	Ga0495611_0272320_536_703	55
386	3300046663	Ga0495635_1007591	Ga0495635_1007591_184_354	55
387	3300046664	Ga0495659_0490690	Ga0495659_0490690_28_195	55
388	3300047318	Ga0495636_0053854	Ga0495636_0053854_381_548	55
389	3300047318	Ga0495636_0305227	Ga0495636_0305227_339_506	55
390	3300047323	Ga0495683_0268432	Ga0495683_0268432_559_726	55
391	3300048903	Ga0496100_0612717	Ga0496100_0612717_83_250	55
392	3300048904	Ga0496101_0064688	Ga0496101_0064688_1658_1825	55
393	3300048905	Ga0496102_0114630	Ga0496102_0114630_566_733	55
394	3300048905	Ga0496102_0142779	Ga0496102_0142779_472_639	55
395	3300048905	Ga0496102_0472589	Ga0496102_0472589_163_330	55
396	3300048909	Ga0496106_0235299	Ga0496106_0235299_1250_1417	55
397	3300048909	Ga0496106_0635563	Ga0496106_0635563_270_437	55
398	3300048910	Ga0496107_0516584	Ga0496107_0516584_551_718	55
399	3300048910	Ga0496107_1021083	Ga0496107_1021083_286_453	55
400	3300048911	Ga0496108_0028070	Ga0496108_0028070_2305_2472	55
401	3300048912	Ga0496109_0019996	Ga0496109_0019996_2585_2752	55
402	3300048913	Ga0496110_0022215	Ga0496110_0022215_3033_3200	55
403	3300048913	Ga0496110_0477438	Ga0496110_0477438_86_253	55
404	3300048914	Ga0496111_0053412	Ga0496111_0053412_1307_1474	55
405	3300048914	Ga0496111_0788983	Ga0496111_0788983_458_625	55
406	3300048915	Ga0496112_0023807	Ga0496112_0023807_2658_2825	55
407	3300048916	Ga0496113_0005346	Ga0496113_0005346_5652_5819	55
408	3300048917	Ga0496114_0080384	Ga0496114_0080384_1415_1582	55
409	3300048917	Ga0496114_1217866	Ga0496114_1217866_361_528	55
410	3300049568	Ga0501031_0030972	Ga0501031_0030972_550_717	55
411	3300049570	Ga0501033_0152487	Ga0501033_0152487_1193_1360	55
412	3300049570	Ga0501033_0203390	Ga0501033_0203390_396_563	55
413	3300049572	Ga0501036_0047420	Ga0501036_0047420_3033_3200	55
414	3300049572	Ga0501036_0241127	Ga0501036_0241127_314_481	55
415	3300049572	Ga0501036_0344662	Ga0501036_0344662_121_288	55
416	3300049574	Ga0501038_0353042	Ga0501038_0353042_135_302	55
417	3300049575	Ga0501039_1181368	Ga0501039_1181368_322_489	55
418	3300049576	Ga0501040_0030505	Ga0501040_0030505_1631_1798	55
419	3300049576	Ga0501040_0052424	Ga0501040_0052424_1745_1912	55
420	3300049577	Ga0501041_0239744	Ga0501041_0239744_263_430	55
421	3300049577	Ga0501041_0780350	Ga0501041_0780350_384_551	55
422	3300049577	Ga0501041_1068895	Ga0501041_1068895_126_293	55
423	3300049578	Ga0501042_0038168	Ga0501042_0038168_2962_3129	55
424	3300049578	Ga0501042_0349529	Ga0501042_0349529_160_327	55
425	3300049579	Ga0501043_0986705	Ga0501043_0986705_75_242	55
426	3300049580	Ga0501046_0156624	Ga0501046_0156624_551_718	55
427	3300049582	Ga0501048_0078341	Ga0501048_0078341_1779_1946	55
428	3300049582	Ga0501048_0261847	Ga0501048_0261847_827_994	55
429	3300049584	Ga0501068_0498220	Ga0501068_0498220_144_311	55
430	3300049585	Ga0501069_0466912	Ga0501069_0466912_449_616	55
431	3300049587	Ga0501071_0016921	Ga0501071_0016921_1148_1315	55
432	3300049587	Ga0501071_0064744	Ga0501071_0064744_961_1128	55
433	3300049588	Ga0501072_0037161	Ga0501072_0037161_2705_2872	55
434	3300049588	Ga0501072_0299812	Ga0501072_0299812_146_313	55
435	3300049588	Ga0501072_1229827	Ga0501072_1229827_123_296	55
436	3300049589	Ga0501073_0578166	Ga0501073_0578166_298_465	55
437	3300049589	Ga0501073_0683650	Ga0501073_0683650_404_577	55
438	3300049590	Ga0501074_0390387	Ga0501074_0390387_260_427	55
439	3300049590	Ga0501074_0483782	Ga0501074_0483782_269_436	55
440	3300049591	Ga0501075_0025491	Ga0501075_0025491_3240_3407	55
441	3300049591	Ga0501075_1454634	Ga0501075_1454634_40_207	55
442	3300049592	Ga0501076_0041933	Ga0501076_0041933_1619_1786	55
443	3300049592	Ga0501076_0302583	Ga0501076_0302583_180_347	55
444	3300049592	Ga0501076_1295666	Ga0501076_1295666_344_511	55
445	3300049593	Ga0501077_0026127	Ga0501077_0026127_1872_2039	55
446	3300049593	Ga0501077_0251624	Ga0501077_0251624_400_573	55
447	3300049669	Ga0501235_229628	Ga0501235_229628_299_466	55
448	3300049670	Ga0501236_130849	Ga0501236_130849_319_486	55
449	3300049708	Ga0501245_019670	Ga0501245_019670_62_229	55
450	3300049741	Ga0501079_0051977	Ga0501079_0051977_1825_1992	55
451	3300049741	Ga0501079_0112296	Ga0501079_0112296_701_868	55
452	3300049741	Ga0501079_0317507	Ga0501079_0317507_602_775	55
453	3300049741	Ga0501079_0339530	Ga0501079_0339530_589_756	55
454	3300049741	Ga0501079_0395467	Ga0501079_0395467_489_656	55
455	3300049742	Ga0501080_0594291	Ga0501080_0594291_339_506	55
456	3300049742	Ga0501080_0650878	Ga0501080_0650878_562_729	55
457	3300049743	Ga0501081_0114766	Ga0501081_0114766_344_511	55
458	3300049744	Ga0501083_0294557	Ga0501083_0294557_810_977	55
459	3300049765	Ga0501268_007011	Ga0501268_007011_449_616	55
460	3300049822	Ga0501035_0196271	Ga0501035_0196271_1486_1653	55
461	3300049822	Ga0501035_0423282	Ga0501035_0423282_522_689	55
462	3300049824	Ga0501045_0127488	Ga0501045_0127488_1692_1859	55
463	3300049824	Ga0501045_0212693	Ga0501045_0212693_84_251	55
464	3300049824	Ga0501045_0568116	Ga0501045_0568116_543_710	55
465	3300050507	nmdc:mga05p37_581684_c1	nmdc:mga05p37_581684_c1_364_531	55
466	3300050508	nmdc:mga09592_867413_c1	nmdc:mga09592_867413_c1_550_717	55
467	3300050509	nmdc:mga0qj67_924796_c1	nmdc:mga0qj67_924796_c1_138_305	55
468	3300050510	nmdc:mga06r32_174094_c1	nmdc:mga06r32_174094_c1_93_260	55
469	3300050511	nmdc:mga08y16_472683_c1	nmdc:mga08y16_472683_c1_671_841	55
470	3300050511	nmdc:mga08y16_473853_c1	nmdc:mga08y16_473853_c1_581_748	55
471	3300050512	nmdc:mga0n895_78095_c1	nmdc:mga0n895_78095_c1_881_1048	55
472	3300050513	nmdc:mga0rr50_357221_c1	nmdc:mga0rr50_357221_c1_1002_1169	55
473	3300050515	nmdc:mga0a205_719000_c1	nmdc:mga0a205_719000_c1_233_400	55
474	3300050515	nmdc:mga0a205_720334_c1	nmdc:mga0a205_720334_c1_643_810	55
475	3300054114	Ga0501084_0134519	Ga0501084_0134519_248_415	55
476	3300054114	Ga0501084_0382043	Ga0501084_0382043_342_509	55
477	3300054114	Ga0501084_0584279	Ga0501084_0584279_354_521	55
478	3300054114	Ga0501084_1586758	Ga0501084_1586758_197_382	55
479	3300059423	Ga0590074_021414	Ga0590074_021414_919_1086	55
480	3300059424	Ga0590075_036891	Ga0590075_036891_111_278	55
481	3300059424	Ga0590075_045071	Ga0590075_045071_82_249	55
482	3300059426	Ga0590077_176076	Ga0590077_176076_309_476	55
483	3300060353	Ga0501082_0238578	Ga0501082_0238578_259_426	55
484	3300060353	Ga0501082_0705247	Ga0501082_0705247_74_241	55

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03966

Trm112p

Trm112p-like protein

4

44

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2hf1-assembly1.cif.gz_A	crystal structure of the putative tetraacyldisaccharide-1-p 4-kinase from chromobacterium violaceum. nesg target cvr39.	0.9619	11	55
2pk7-assembly1.cif.gz_B	crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1	0.9267	7	55
2pk7-assembly1.cif.gz_A	crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1	0.9051	7	55
4h44-assembly1.cif.gz_D	2.70 a cytochrome b6f complex structure from nostoc pcc 7120	0.8913	12	39
2js4-assembly1.cif.gz_A	solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54	0.8676	8	55

ID	Description	Score	Start	End	Superfamily
af_Q8LG27_23_76_2.20.25.10	Mainly Beta;Single Sheet;N-terminal domain of TfIIb;	0.9859	11	55	2.20.25.10
af_Q5U1Z8_55_112_2.20.25.10	Mainly Beta;Single Sheet;N-terminal domain of TfIIb;	0.9634	11	53	2.20.25.10
2hf1B01	Mainly Beta;Single Sheet;N-terminal domain of TfIIb;	0.9618	11	55	2.20.25.10
af_O33186_9_68_2.20.25.10	Mainly Beta;Single Sheet;N-terminal domain of TfIIb;	0.9147	11	55	2.20.25.10
2js4A01	Mainly Beta;Single Sheet;N-terminal domain of TfIIb;	0.8796	11	55	2.20.25.10

ID	Description	Score	Start	End	GO Terms
AF-A0A177E8M5-F1-model_v4	UPF0434 protein TH606_04735	0.9908	3	55	GO:0005829 GO:0016301
AF-A0A2P5SX00-F1-model_v4	Uncharacterized protein	0.9869	11	55
AF-A0A3C1FBJ1-F1-model_v4	Uncharacterized protein	0.9816	3	54	GO:0005829
AF-A0A7V8BHS2-F1-model_v4	UPF0434 protein F9K50_02905	0.9779	1	54
AF-A0A1Q9TS72-F1-model_v4	UPF0434 protein BJF83_01800	0.9777	1	54

Feature Viewer

pLDDT	pTM	Quality
85.22	0.66	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F452879

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03966

Trm112p

Trm112p-like protein

4

44

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map