F452767

General Info

Members Datasets Scaffolds Average Seq Length
483 284 435 445

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000041|Ga0157371_10000041181
Length 480
Sequence MVYRLWGMYPKPSAFYLSAFNLKKMLDSLKKMFSGNEADIPVNTGSKPDISRVKSAELYEKSKTYFPGGVNSPVRAFKSVYGTPLFIEKGDGCYIWDADGNQFIDFCGSWGPLILGHNNPKIREKVTEVMQNGMSFGAPTALENELAELIIKNNRFVEKIRFTSSGTEAVMSAIRLARGFTGRDKILKFEGCYHGHSDSLLVKAGSGLVTFGETSSAGVPKSFAEETIVVPLNDKTAIEQAFAQFKDQIAAVIIEGIPANNGLIMQDEEYIHFLRKICTDNGSLLIFDEVITGFRIGFEGAAAHYGIIPDIVTYGKIIGGGLPVGMYGARAEIMEHISPDGGVYQAGTLSGNPVAMAAGIATLTELNKSGFYKDLNNKAQEFVASIQRFATARNYKFKVFTIGSIFWFAFTDKDKIQSADDIDASSMEKFKVMHRELLNRGIYLGPSGYEVGFVSSAHTKIELEKAKRAIFEALDLVFKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2818991441 Niallia circulans 3243 Isolate Rhizosphere
15 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
16 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
17 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
18 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
19 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
20 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
21 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
22 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
23 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
24 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
25 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
26 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
27 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
28 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
29 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
30 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
31 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
32 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
33 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
34 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
35 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
36 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
37 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
38 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
39 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
40 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
41 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
42 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
43 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
44 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
45 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
46 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
47 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
48 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
49 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
50 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
57 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
187 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
188 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
281 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.65
Metatranscriptomes 0.41
Isolates 9.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.45
Nodule 0
Rhizoplane 1.45
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 9.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1166171 2162886007 Bacteria 3229
2 JGI24737J22298_10004613 3300001990 Bacteria 4794
3 JGI24737J22298_10007890 3300001990 Bacteria 3584
4 JGI24737J22298_10013231 3300001990 Bacteria 2687
5 JGI24735J21928_10000009 3300002067 Bacteria 247425
6 JGI24735J21928_10000036 3300002067 Bacteria 65596
7 JGI24735J21928_10007144 3300002067 Bacteria 3647
8 JGI25162J39368_1000123 3300002737 Bacteria 85062
9 JGI25162J39368_1000306 3300002737 Bacteria 44891
10 JGI25152J39213_1000047 3300002773 Bacteria 84434
11 JGI25150J39212_1000001 3300002774 Bacteria 1318726
12 JGI25151J46595_10000001 3300003187 Bacteria 887211
13 JGI25151J46595_10000060 3300003187 Bacteria 146867
14 JGI25151J46595_10021862 3300003187 Bacteria 2667
15 JGI25165J46597_1000983 3300003214 Bacteria 19102
16 JGI25153J46596_10000001 3300003215 Bacteria 748985
17 rootH1_10113611 3300003316 Bacteria 2739
18 rootH2_10000336 3300003320 Bacteria 69852
19 rootH2_10194668 3300003320 Bacteria 2213
20 rootH2_10198877 3300003320 Bacteria 3557
21 rootH1_10011684 3300003323 Bacteria 42276
22 Ga0055536_1000004 3300003781 Bacteria 411108
23 Ga0055530_10005284 3300003791 Bacteria 6205
24 Ga0058863_10041784 3300004799 Bacteria 7673
25 Ga0058862_11288598 3300004803 Unclassified 1676
26 Ga0065714_10002286 3300005288 Bacteria 28187
27 Ga0065714_10007892 3300005288 Bacteria 3930
28 Ga0065714_10011309 3300005288 Bacteria 2119
29 Ga0065714_10013017 3300005288 Bacteria 3063
30 Ga0065714_10013455 3300005288 Bacteria 2288
31 Ga0065714_10076017 3300005288 Bacteria 2823
32 Ga0065704_10000263 3300005289 Bacteria 48992
33 Ga0065704_10080358 3300005289 Bacteria 3961
34 Ga0065707_10118584 3300005295 Bacteria 2181
35 Ga0070658_10000099 3300005327 Bacteria 76585
36 Ga0070683_100018563 3300005329 Bacteria 6164
37 Ga0068868_100009296 3300005338 Bacteria 7066
38 Ga0068868_100017383 3300005338 Bacteria 5358
39 Ga0068868_100041830 3300005338 Bacteria 3572
40 Ga0068868_100204940 3300005338 Bacteria 1646
41 Ga0070660_100175322 3300005339 Bacteria 1734
42 Ga0070661_100125111 3300005344 Bacteria 1928
43 Ga0070673_100038055 3300005364 Bacteria 3671
44 Ga0070688_100178064 3300005365 Bacteria 1473
45 Ga0070659_100000824 3300005366 Bacteria 22594
46 Ga0070667_100000809 3300005367 Bacteria 29230
47 Ga0070703_10000002 3300005406 Bacteria 167332
48 Ga0070708_100000212 3300005445 Bacteria 43245
49 Ga0070708_100007479 3300005445 Bacteria 8747
50 Ga0070663_100015786 3300005455 Bacteria 4886
51 Ga0070678_100019638 3300005456 Bacteria 4414
52 Ga0070662_100000013 3300005457 Bacteria 125019
53 Ga0070681_10005212 3300005458 Bacteria 12550
54 Ga0068867_100000852 3300005459 Bacteria 20584
55 Ga0070706_100011276 3300005467 Bacteria 8302
56 Ga0070707_100014787 3300005468 Bacteria 7315
57 Ga0070679_100018413 3300005530 Bacteria 6777
58 Ga0070679_100022509 3300005530 Bacteria 6160
59 Ga0070679_100273660 3300005530 Bacteria 1642
60 Ga0068853_100007576 3300005539 Bacteria 8692
61 Ga0070696_100011483 3300005546 Bacteria 5933
62 Ga0070665_100000010 3300005548 Bacteria 529545
63 Ga0070665_100084628 3300005548 Bacteria 3176
64 Ga0070704_100008443 3300005549 Bacteria 6177
65 Ga0068855_100000631 3300005563 Bacteria 43172
66 Ga0068855_100001701 3300005563 Bacteria 27524
67 Ga0068855_100013731 3300005563 Bacteria 9764
68 Ga0068855_100024159 3300005563 Bacteria 7275
69 Ga0068857_100014194 3300005577 Bacteria 6937
70 Ga0068856_100000030 3300005614 Bacteria 128494
71 Ga0068856_100002703 3300005614 Bacteria 18181
72 Ga0068856_100037042 3300005614 Bacteria 4785
73 Ga0068864_100032786 3300005618 Bacteria 4415
74 Ga0068866_10012303 3300005718 Bacteria 3727
75 Ga0068866_10050649 3300005718 Bacteria 2110
76 Ga0068863_100026789 3300005841 Bacteria 5497
77 Ga0068858_100074153 3300005842 Bacteria 3159
78 Ga0068860_100008525 3300005843 Bacteria 10214
79 Ga0075366_10002946 3300006195 Bacteria 8859
80 Ga0097621_100001053 3300006237 Bacteria 19313
81 Ga0097621_100001956 3300006237 Bacteria 14050
82 Ga0068871_100000109 3300006358 Bacteria 49767
83 Ga0068865_100000079 3300006881 Bacteria 51370
84 Ga0068865_100057333 3300006881 Bacteria 2717
85 Ga0099795_10000034 3300007788 Bacteria 36525
86 Ga0105240_10000128 3300009093 Bacteria 156107
87 Ga0105240_10001477 3300009093 Bacteria 40056
88 Ga0105240_10027264 3300009093 Bacteria 7481
89 Ga0105240_10033682 3300009093 Bacteria 6615
90 Ga0105240_10143513 3300009093 Bacteria 2852
91 Ga0105245_10007223 3300009098 Bacteria 9735
92 Ga0105247_10029255 3300009101 Bacteria 3338
93 Ga0105243_10000009 3300009148 Bacteria 354419
94 Ga0105243_10019690 3300009148 Bacteria 5117
95 Ga0105243_10035109 3300009148 Bacteria 3886
96 Ga0105243_10165720 3300009148 Bacteria 1909
97 Ga0105241_10001015 3300009174 Bacteria 21354
98 Ga0105241_10014824 3300009174 Bacteria 5707
99 Ga0105241_10133858 3300009174 Bacteria 2010
100 Ga0105242_10018964 3300009176 Bacteria 5388
101 Ga0105242_10020601 3300009176 Bacteria 5172
102 Ga0105242_10065006 3300009176 Bacteria 3008
103 Ga0105242_10077525 3300009176 Bacteria 2773
104 Ga0105242_10104699 3300009176 Unclassified 2402
105 Ga0105248_10036920 3300009177 Bacteria 5465
106 Ga0105237_10000713 3300009545 Bacteria 45969
107 Ga0105237_10001681 3300009545 Bacteria 28643
108 Ga0105237_10003226 3300009545 Bacteria 19533
109 Ga0105237_10010902 3300009545 Bacteria 9645
110 Ga0105237_10027313 3300009545 Bacteria 5828
111 Ga0105237_10032126 3300009545 Bacteria 5315
112 Ga0105237_10041568 3300009545 Bacteria 4636
113 Ga0105238_10007790 3300009551 Bacteria 10714
114 Ga0105238_10203895 3300009551 Bacteria 1954
115 Ga0099796_10000049 3300010159 Bacteria 22581
116 Ga0105239_10000011 3300010375 Bacteria 337500
117 Ga0105239_10000392 3300010375 Bacteria 64144
118 Ga0105239_10001249 3300010375 Bacteria 34548
119 Ga0105239_10003944 3300010375 Bacteria 17976
120 Ga0105239_10004273 3300010375 Bacteria 17138
121 Ga0105239_10005554 3300010375 Bacteria 14758
122 Ga0105239_10214347 3300010375 Bacteria 2158
123 Ga0157373_10000115 3300013100 Bacteria 63326
124 Ga0157373_10003087 3300013100 Bacteria 12582
125 Ga0157373_10003093 3300013100 Bacteria 12572
126 Ga0157373_10018401 3300013100 Bacteria 5086
127 Ga0157373_10138790 3300013100 Bacteria 1709
128 Ga0157371_10000041 3300013102 Bacteria 203957
129 Ga0157371_10001176 3300013102 Bacteria 28083
130 Ga0157371_10005754 3300013102 Bacteria 10387
131 Ga0157371_10008441 3300013102 Bacteria 8202
132 Ga0157371_10013384 3300013102 Bacteria 6232
133 Ga0157371_10013891 3300013102 Bacteria 6099
134 Ga0157370_10002405 3300013104 Bacteria 22561
135 Ga0157370_10003392 3300013104 Bacteria 18728
136 Ga0157370_10019162 3300013104 Bacteria 6876
137 Ga0157370_10022798 3300013104 Bacteria 6227
138 Ga0157370_10024814 3300013104 Bacteria 5936
139 Ga0157370_10035113 3300013104 Bacteria 4877
140 Ga0157370_10037895 3300013104 Bacteria 4667
141 Ga0157370_10104762 3300013104 Bacteria 2648
142 Ga0157370_10112109 3300013104 Bacteria 2549
143 Ga0157369_10000016 3300013105 Bacteria 257827
144 Ga0157369_10005273 3300013105 Bacteria 15070
145 Ga0157369_10144705 3300013105 Bacteria 2514
146 Ga0157374_10000258 3300013296 Bacteria 48926
147 Ga0157374_10003809 3300013296 Bacteria 12674
148 Ga0157374_10008551 3300013296 Bacteria 8754
149 Ga0157378_10002371 3300013297 Bacteria 16734
150 Ga0157378_10003207 3300013297 Bacteria 14537
151 Ga0157378_10039852 3300013297 Bacteria 4166
152 Ga0157378_10049370 3300013297 Bacteria 3743
153 Ga0157378_10329949 3300013297 Bacteria 1485
154 Ga0163162_10000005 3300013306 Bacteria 447195
155 Ga0163162_10013733 3300013306 Bacteria 7910
156 Ga0163162_10057754 3300013306 Bacteria 3908
157 Ga0157372_10000026 3300013307 Bacteria 195407
158 Ga0157372_10001115 3300013307 Bacteria 29190
159 Ga0157372_10001737 3300013307 Bacteria 23642
160 Ga0157372_10004698 3300013307 Bacteria 14503
161 Ga0157372_10087795 3300013307 Bacteria 3530
162 Ga0157372_10143188 3300013307 Bacteria 2756
163 Ga0157375_10019342 3300013308 Bacteria 6193
164 Ga0163163_10012355 3300014325 Bacteria 7780
165 Ga0182008_10000014 3300014497 Bacteria 263844
166 Ga0182008_10000932 3300014497 Bacteria 20364
167 Ga0182008_10001241 3300014497 Bacteria 17515
168 Ga0182008_10006343 3300014497 Bacteria 6621
169 Ga0182008_10024565 3300014497 Bacteria 3067
170 Ga0157376_10004563 3300014969 Bacteria 9641
171 Ga0182006_1000258 3300015261 Bacteria 48657
172 Ga0182006_1001127 3300015261 Bacteria 16984
173 Ga0182006_1007803 3300015261 Bacteria 4878
174 Ga0182007_10000002 3300015262 Bacteria 564661
175 Ga0182007_10003077 3300015262 Bacteria 8031
176 Ga0182007_10012583 3300015262 Bacteria 3250
177 Ga0182007_10013350 3300015262 Bacteria 3134
178 Ga0183373_1004 3300015682 Bacteria 537398
179 Ga0163161_10000347 3300017792 Bacteria 39178
180 Ga0163161_10001290 3300017792 Bacteria 18682
181 Ga0163161_10002101 3300017792 Bacteria 14424
182 Ga0163161_10003196 3300017792 Bacteria 11522
183 Ga0163161_10038624 3300017792 Bacteria 3424
184 Ga0163161_10054942 3300017792 Bacteria 2890
185 Ga0207427_100210 3300025231 Bacteria 53314
186 Ga0209437_100021 3300025233 Bacteria 646400
187 Ga0209437_100251 3300025233 Bacteria 85135
188 Ga0207425_1000002 3300025245 Bacteria 1362590
189 Ga0209026_1000943 3300025250 Bacteria 14626
190 Ga0209026_1001240 3300025250 Bacteria 11679
191 Ga0209129_1000002 3300025258 Bacteria 1359086
192 Ga0209233_1000035 3300025261 Bacteria 568478
193 Ga0209233_1000482 3300025261 Bacteria 24375
194 Ga0209455_1000741 3300025272 Bacteria 18689
195 Ga0209675_1020495 3300025291 Bacteria 1790
196 Ga0209676_1000009 3300025292 Bacteria 981719
197 Ga0209025_1000004 3300025294 Bacteria 1361782
198 Ga0209758_1000006 3300025297 Bacteria 1359562
199 Ga0209050_1000048 3300025298 Bacteria 371553
200 Ga0207653_10000285 3300025885 Bacteria 29669
201 Ga0207642_10032183 3300025899 Bacteria 2205
202 Ga0207710_10046824 3300025900 Bacteria 1931
203 Ga0207680_10004601 3300025903 Bacteria 6548
204 Ga0207647_10000044 3300025904 Bacteria 90491
205 Ga0207647_10000431 3300025904 Bacteria 34359
206 Ga0207645_10000135 3300025907 Bacteria 56584
207 Ga0207705_10000142 3300025909 Bacteria 76788
208 Ga0207684_10000078 3300025910 Bacteria 181899
209 Ga0207654_10000191 3300025911 Bacteria 37892
210 Ga0207654_10004366 3300025911 Bacteria 7126
211 Ga0207654_10007426 3300025911 Bacteria 5521
212 Ga0207707_10010880 3300025912 Bacteria 7908
213 Ga0207695_10000179 3300025913 Bacteria 185564
214 Ga0207695_10002745 3300025913 Bacteria 25680
215 Ga0207695_10043825 3300025913 Bacteria 4763
216 Ga0207695_10048667 3300025913 Bacteria 4476
217 Ga0207671_10000948 3300025914 Bacteria 36011
218 Ga0207671_10002949 3300025914 Bacteria 17525
219 Ga0207671_10004197 3300025914 Bacteria 13900
220 Ga0207671_10014945 3300025914 Bacteria 6102
221 Ga0207671_10022468 3300025914 Bacteria 4769
222 Ga0207693_10039863 3300025915 Bacteria 3699
223 Ga0207657_10165407 3300025919 Bacteria 1795
224 Ga0207649_10035242 3300025920 Bacteria 3006
225 Ga0207652_10015818 3300025921 Bacteria 6148
226 Ga0207652_10039708 3300025921 Bacteria 3994
227 Ga0207646_10001252 3300025922 Bacteria 31826
228 Ga0207646_10200777 3300025922 Bacteria 1801
229 Ga0207694_10025702 3300025924 Bacteria 4476
230 Ga0207694_10147051 3300025924 Bacteria 1897
231 Ga0207644_10009772 3300025931 Bacteria 6307
232 Ga0207690_10000351 3300025932 Bacteria 30727
233 Ga0207706_10000173 3300025933 Bacteria 71958
234 Ga0207686_10059636 3300025934 Unclassified 2412
235 Ga0207709_10000026 3300025935 Bacteria 354467
236 Ga0207709_10009698 3300025935 Bacteria 5306
237 Ga0207704_10000019 3300025938 Bacteria 152734
238 Ga0207711_10003881 3300025941 Bacteria 12864
239 Ga0207689_10188890 3300025942 Bacteria 1699
240 Ga0207661_10202345 3300025944 Bacteria 1746
241 Ga0207667_10000030 3300025949 Bacteria 327226
242 Ga0207667_10000218 3300025949 Bacteria 80364
243 Ga0207667_10011112 3300025949 Bacteria 10483
244 Ga0207667_10013873 3300025949 Bacteria 9205
245 Ga0207667_10015128 3300025949 Bacteria 8774
246 Ga0207667_10028328 3300025949 Bacteria 6084
247 Ga0207667_10033359 3300025949 Bacteria 5535
248 Ga0207667_10069079 3300025949 Bacteria 3678
249 Ga0207651_10003044 3300025960 Bacteria 8132
250 Ga0207640_10003804 3300025981 Bacteria 8132
251 Ga0207677_10015964 3300026023 Bacteria 4434
252 Ga0207677_10027281 3300026023 Bacteria 3594
253 Ga0207703_10002324 3300026035 Bacteria 16603
254 Ga0207639_10042961 3300026041 Bacteria 3390
255 Ga0207639_10113084 3300026041 Bacteria 2217
256 Ga0207639_10135609 3300026041 Bacteria 2043
257 Ga0207678_10021189 3300026067 Bacteria 5698
258 Ga0207702_10001383 3300026078 Bacteria 24198
259 Ga0207702_10028200 3300026078 Bacteria 4665
260 Ga0207641_10209351 3300026088 Bacteria 1803
261 Ga0207648_10000061 3300026089 Bacteria 101034
262 Ga0207676_10053061 3300026095 Bacteria 3172
263 Ga0207683_10002822 3300026121 Bacteria 15178
264 Ga0209179_1000027 3300027512 Bacteria 35217
265 Ga0268266_10000032 3300028379 Bacteria 395079
266 Ga0307517_10000640 3300028786 Bacteria 59989
267 Ga0307515_10002716 3300028794 Bacteria 37857
268 Ga0307515_10017577 3300028794 Bacteria 13009
269 Ga0307515_10018541 3300028794 Bacteria 12580
270 Ga0307515_10191099 3300028794 Bacteria 1957
271 Ga0265338_10006311 3300028800 Bacteria 15153
272 Ga0265338_10024117 3300028800 Bacteria 6226
273 Ga0265338_10063557 3300028800 Bacteria 3218
274 Ga0265338_10069960 3300028800 Bacteria 3012
275 Ga0268256_1004720 3300030500 Bacteria 5553
276 Ga0316183_1046861 3300030742 Bacteria 13742
277 Ga0316181_1079882 3300030744 Bacteria 8228
278 Ga0265340_10029943 3300031247 Bacteria 2732
279 Ga0265327_10003330 3300031251 Bacteria 15537
280 Ga0265327_10008974 3300031251 Bacteria 7325
281 Ga0265327_10042075 3300031251 Bacteria 2455
282 Ga0307509_10031891 3300031507 Bacteria 5811
283 Ga0307408_100000324 3300031548 Bacteria 45798
284 Ga0307408_100020325 3300031548 Unclassified 4479
285 Ga0307408_100049562 3300031548 Bacteria 3017
286 Ga0307405_10000006 3300031731 Bacteria 361477
287 Ga0307407_10000075 3300031903 Bacteria 35183
288 Ga0307412_10000827 3300031911 Bacteria 17835
289 Ga0307412_10033931 3300031911 Bacteria 3248
290 Ga0307412_10041772 3300031911 Bacteria 2974
291 Ga0307409_100011023 3300031995 Bacteria 5668
292 Ga0307416_100000002 3300032002 Bacteria 509907
293 Ga0307414_10004624 3300032004 Bacteria 7489
294 Ga0307414_10010138 3300032004 Bacteria 5450
295 Ga0307414_10014891 3300032004 Bacteria 4680
296 Ga0307414_10039826 3300032004 Bacteria 3169
297 Ga0307414_10205637 3300032004 Bacteria 1605
298 Ga0307507_10000034 3300033179 Bacteria 188697
299 Ga0307510_10005665 3300033180 Bacteria 14888
300 Ga0373937_0068517 3300036401 Bacteria 3272
301 Ga0373937_0250212 3300036401 Bacteria 1671
302 Ga0395899_0000011 3300037312 Bacteria 521331
303 Ga0395899_0000025 3300037312 Bacteria 350927
304 Ga0395899_0000055 3300037312 Bacteria 220579
305 Ga0395899_0000563 3300037312 Bacteria 39619
306 Ga0395900_0000173 3300037418 Bacteria 103767
307 Ga0395900_0001545 3300037418 Bacteria 27359
308 Ga0395900_0035437 3300037418 Bacteria 5140
309 Ga0395900_0103932 3300037418 Unclassified 2918
310 Ga0395900_0413957 3300037418 Unclassified 1310
311 Ga0395898_0005193 3300037466 Bacteria 14084
312 Ga0395905_0000001 3300037471 Bacteria 2037079
313 Ga0395905_0000779 3300037471 Bacteria 41889
314 Ga0395905_0001821 3300037471 Bacteria 24671
315 Ga0395905_0003424 3300037471 Bacteria 16975
316 Ga0395905_0004928 3300037471 Bacteria 13744
317 Ga0395905_0039675 3300037471 Bacteria 4418
318 Ga0395905_0048862 3300037471 Bacteria 3963
319 Ga0395901_0006218 3300038443 Bacteria 12101
320 Ga0395901_0020679 3300038443 Bacteria 6737
321 Ga0395901_0043624 3300038443 Bacteria 4651
322 Ga0395901_0111729 3300038443 Bacteria 2870
323 Ga0395901_0128587 3300038443 Bacteria 2663
324 Ga0439448_0003865 3300042005 Bacteria 4193
325 Ga0451577_0000213 3300042876 Bacteria 121176
326 Ga0451577_0028735 3300042876 Bacteria 5027
327 Ga0451577_0081370 3300042876 Bacteria 2888
328 Ga0451577_0109743 3300042876 Bacteria 2467
329 Ga0453683_0011991 3300044673 Bacteria 5692
330 Ga0453683_0120503 3300044673 Bacteria 1651
331 Ga0466966_0058270 3300044684 Bacteria 2441
332 Ga0453684_0002500 3300044712 Bacteria 44341
333 Ga0453684_0091888 3300044712 Bacteria 3744
334 Ga0453684_0248173 3300044712 Bacteria 2045
335 Ga0453684_0280650 3300044712 Unclassified 1900
336 Ga0451576_0000002 3300045051 Bacteria 1670975
337 Ga0451576_0033134 3300045051 Bacteria 5492
338 Ga0451576_0294584 3300045051 Bacteria 1696
339 Ga0466958_0014767 3300045836 Bacteria 4462
340 Ga0495603_0003242 3300046455 Bacteria 9696
341 Ga0495603_0055292 3300046455 Bacteria 2352
342 Ga0495591_022492 3300046458 Bacteria 2036
343 Ga0495629_0117416 3300046459 Bacteria 1854
344 Ga0495650_0000447 3300046471 Bacteria 65735
345 Ga0495580_0075136 3300046472 Bacteria 2358
346 Ga0495585_0000116 3300046492 Bacteria 86272
347 Ga0495585_0000596 3300046492 Bacteria 33838
348 Ga0495594_0107800 3300046499 Bacteria 1569
349 Ga0495596_0007857 3300046500 Bacteria 4780
350 Ga0495583_0016097 3300046506 Bacteria 4037
351 Ga0495606_0000844 3300046507 Bacteria 46120
352 Ga0495606_0030120 3300046507 Bacteria 3796
353 Ga0495610_0000099 3300046512 Bacteria 101553
354 Ga0495610_0002563 3300046512 Bacteria 15114
355 Ga0495610_0002995 3300046512 Bacteria 13606
356 Ga0495616_0006153 3300046513 Bacteria 7308
357 Ga0495644_0044246 3300046523 Bacteria 1675
358 Ga0495609_0007074 3300046538 Bacteria 5648
359 Ga0495609_0026385 3300046538 Bacteria 2661
360 Ga0495621_0000057 3300046539 Bacteria 21332
361 Ga0495633_0000021 3300046558 Bacteria 227171
362 Ga0495633_0003971 3300046558 Bacteria 9602
363 Ga0495668_0000165 3300046616 Bacteria 98016
364 Ga0495625_0000907 3300046660 Bacteria 39912
365 Ga0495625_0000972 3300046660 Bacteria 38083
366 Ga0495625_0027806 3300046660 Bacteria 4250
367 Ga0495661_0000341 3300046665 Bacteria 51001
368 Ga0495588_0035791 3300046674 Bacteria 2517
369 Ga0495647_0001761 3300046681 Bacteria 6709
370 Ga0495658_0005011 3300046683 Bacteria 6504
371 Ga0495649_0000014 3300046694 Bacteria 287408
372 Ga0495649_0014284 3300046694 Bacteria 4560
373 Ga0495683_0025426 3300047323 Bacteria 3035
374 Ga0495687_001057 3300047443 Bacteria 27242
375 Ga0495687_005260 3300047443 Bacteria 8315
376 Ga0495673_0053516 3300047469 Bacteria 1759
377 Ga0495681_0045705 3300047470 Bacteria 2093
378 Ga0495686_0000913 3300047472 Bacteria 37043
379 Ga0495686_0001318 3300047472 Bacteria 27838
380 Ga0495686_0015517 3300047472 Bacteria 5196
381 Ga0495686_0037993 3300047472 Bacteria 3082
382 Ga0495686_0042805 3300047472 Bacteria 2876
383 Ga0495614_0060498 3300048089 Bacteria 1627
384 Ga0496101_0007581 3300048904 Bacteria 7043
385 Ga0496104_0034585 3300048907 Bacteria 4713
386 Ga0496105_0002145 3300048908 Bacteria 14294
387 Ga0496106_0002978 3300048909 Bacteria 12613
388 Ga0496108_0021926 3300048911 Bacteria 5250
389 Ga0496109_0055722 3300048912 Bacteria 3606
390 Ga0496116_0022816 3300048919 Bacteria 4677
391 Ga0496116_0022843 3300048919 Bacteria 4673
392 Ga0496117_0011076 3300048920 Bacteria 8114
393 Ga0496122_0002491 3300048925 Bacteria 26020
394 Ga0496122_0092725 3300048925 Bacteria 2051
395 Ga0496123_0005145 3300048926 Bacteria 13323
396 Ga0496123_0102798 3300048926 Bacteria 1657
397 Ga0496124_0102864 3300048927 Bacteria 2311
398 Ga0496125_0237768 3300048928 Bacteria 1159
399 Ga0496126_0055631 3300048929 Unclassified 3579
400 Ga0495678_006175 3300049459 Bacteria 6420
401 Ga0495682_0072652 3300049460 Bacteria 1238
402 Ga0501032_0026240 3300049569 Bacteria 4010
403 Ga0501037_0000732 3300049573 Bacteria 24915
404 Ga0501037_0055451 3300049573 Bacteria 2897
405 Ga0501038_0001222 3300049574 Bacteria 23298
406 Ga0501038_0239254 3300049574 Bacteria 1442
407 Ga0501042_0080292 3300049578 Bacteria 2337
408 Ga0501046_0073727 3300049580 Bacteria 2649
409 Ga0501046_0079017 3300049580 Bacteria 2544
410 Ga0501047_0190045 3300049581 Bacteria 1917
411 Ga0501070_0002248 3300049586 Bacteria 16967
412 Ga0501070_0026653 3300049586 Bacteria 4848
413 Ga0501070_0082398 3300049586 Bacteria 2663
414 Ga0501071_0021897 3300049587 Bacteria 4455
415 Ga0501074_0000076 3300049590 Bacteria 47882
416 Ga0501075_0049670 3300049591 Bacteria 3153
417 Ga0501076_0035959 3300049592 Bacteria 3878
418 Ga0501223_002508 3300049663 Bacteria 4065
419 Ga0501080_0012965 3300049742 Bacteria 7652
420 Ga0501081_0018433 3300049743 Bacteria 4636
421 Ga0501241_005478 3300049758 Bacteria 2365
422 nmdc:mga0k408_237_c1 3300050493 Bacteria 29636
423 nmdc:mga0k408_49719_c1 3300050493 Bacteria 2427
424 nmdc:mga0a205_92552_c1 3300050515 Bacteria 2921
425 Ga0500635_0001928 3300053080 Bacteria 5062
426 Ga0500643_000810 3300053087 Bacteria 20155
427 Ga0500651_0000182 3300053093 Bacteria 40910
428 Ga0500608_000555 3300053122 Bacteria 13973
429 Ga0500608_008573 3300053122 Bacteria 4307
430 Ga0500618_000027 3300053125 Bacteria 142903
431 Ga0500642_0002544 3300053130 Bacteria 5375
432 Ga0500579_096933 3300053143 Bacteria 1558
433 Ga0500622_0000440 3300053156 Bacteria 39478
434 Ga0530510_0028705 3300061734 Bacteria 3989
435 Ga0530510_0038128 3300061734 Bacteria 3469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0055631 Ga0496126_0055631_2284_3396 353
2 3300037418 Ga0395900_0413957 Ga0395900_0413957_41_1144 363
3 3300048928 Ga0496125_0237768 Ga0496125_0237768_42_1145 367
4 3300005549 Ga0070704_100008443 Ga0070704_1000084436 375
5 3300049663 Ga0501223_002508 Ga0501223_002508_187_1347 385
6 iso_pu_bacteria 2895498888 2895501544 387
7 3300044673 Ga0453683_0011991 Ga0453683_0011991_4489_5664 389
8 3300006881 Ga0068865_100057333 Ga0068865_1000573334 397
9 3300049460 Ga0495682_0072652 Ga0495682_0072652_32_1225 397
10 3300025922 Ga0207646_10200777 Ga0207646_102007772 404
11 3300046455 Ga0495603_0055292 Ga0495603_0055292_862_2133 405
12 3300046459 Ga0495629_0117416 Ga0495629_0117416_531_1802 405
13 3300046681 Ga0495647_0001761 Ga0495647_0001761_2664_3935 405
14 3300046683 Ga0495658_0005011 Ga0495658_0005011_4908_6179 405
15 3300050515 nmdc:mga0a205_92552_c1 nmdc:mga0a205_92552_c1_454_1680 406
16 3300047443 Ga0495687_005260 Ga0495687_005260_7076_8302 408
17 3300048904 Ga0496101_0007581 Ga0496101_0007581_34_1269 410
18 3300031251 Ga0265327_10003330 Ga0265327_1000333011 411
19 3300005406 Ga0070703_10000002 Ga0070703_1000000228 415
20 3300005445 Ga0070708_100000212 Ga0070708_10000021239 415
21 3300005467 Ga0070706_100011276 Ga0070706_1000112767 415
22 3300005468 Ga0070707_100014787 Ga0070707_1000147876 415
23 3300025885 Ga0207653_10000285 Ga0207653_100002857 415
24 3300025910 Ga0207684_10000078 Ga0207684_10000078126 415
25 3300025915 Ga0207693_10039863 Ga0207693_100398635 415
26 3300025922 Ga0207646_10001252 Ga0207646_100012521 415
27 3300031251 Ga0265327_10008974 Ga0265327_100089747 416
28 3300042876 Ga0451577_0028735 Ga0451577_0028735_274_1530 416
29 3300042876 Ga0451577_0081370 Ga0451577_0081370_1137_2393 416
30 3300042876 Ga0451577_0109743 Ga0451577_0109743_483_1739 416
31 3300044673 Ga0453683_0120503 Ga0453683_0120503_275_1531 416
32 3300044712 Ga0453684_0091888 Ga0453684_0091888_1966_3222 416
33 3300044712 Ga0453684_0248173 Ga0453684_0248173_223_1479 416
34 3300045051 Ga0451576_0033134 Ga0451576_0033134_25_1281 416
35 3300045051 Ga0451576_0294584 Ga0451576_0294584_193_1449 416
36 3300036401 Ga0373937_0250212 Ga0373937_0250212_388_1647 417
37 3300046458 Ga0495591_022492 Ga0495591_022492_631_1890 417
38 3300048919 Ga0496116_0022843 Ga0496116_0022843_2499_3803 417
39 3300028800 Ga0265338_10063557 Ga0265338_100635573 419
40 3300028800 Ga0265338_10069960 Ga0265338_100699602 419
41 3300007788 Ga0099795_10000034 Ga0099795_1000003415 420
42 3300010159 Ga0099796_10000049 Ga0099796_1000004915 420
43 3300027512 Ga0209179_1000027 Ga0209179_100002724 420
44 3300046539 Ga0495621_0000057 Ga0495621_0000057_19520_20791 421
45 3300047470 Ga0495681_0045705 Ga0495681_0045705_352_1623 421
46 3300005338 Ga0068868_100009296 Ga0068868_1000092962 422
47 3300005367 Ga0070667_100000809 Ga0070667_10000080913 422
48 3300005548 Ga0070665_100084628 Ga0070665_1000846283 422
49 3300005618 Ga0068864_100032786 Ga0068864_1000327863 422
50 3300005841 Ga0068863_100026789 Ga0068863_1000267896 422
51 3300005842 Ga0068858_100074153 Ga0068858_1000741532 422
52 3300005843 Ga0068860_100008525 Ga0068860_1000085256 422
53 3300006237 Ga0097621_100001956 Ga0097621_1000019567 422
54 3300009098 Ga0105245_10007223 Ga0105245_100072236 422
55 3300009101 Ga0105247_10029255 Ga0105247_100292553 422
56 3300009176 Ga0105242_10077525 Ga0105242_100775252 422
57 3300009177 Ga0105248_10036920 Ga0105248_100369205 422
58 3300013296 Ga0157374_10008551 Ga0157374_100085513 422
59 3300013297 Ga0157378_10049370 Ga0157378_100493702 422
60 3300013306 Ga0163162_10057754 Ga0163162_100577543 422
61 3300014325 Ga0163163_10012355 Ga0163163_100123555 422
62 3300014969 Ga0157376_10004563 Ga0157376_100045632 422
63 3300025900 Ga0207710_10046824 Ga0207710_100468242 422
64 3300025903 Ga0207680_10004601 Ga0207680_100046016 422
65 3300025941 Ga0207711_10003881 Ga0207711_100038816 422
66 3300026035 Ga0207703_10002324 Ga0207703_100023247 422
67 3300026095 Ga0207676_10053061 Ga0207676_100530612 422
68 3300036401 Ga0373937_0068517 Ga0373937_0068517_748_2034 422
69 3300048907 Ga0496104_0034585 Ga0496104_0034585_2267_3553 422
70 3300048911 Ga0496108_0021926 Ga0496108_0021926_1302_2588 422
71 3300048912 Ga0496109_0055722 Ga0496109_0055722_182_1468 422
72 3300005338 Ga0068868_100204940 Ga0068868_1002049402 423
73 3300005344 Ga0070661_100125111 Ga0070661_1001251112 423
74 3300005365 Ga0070688_100178064 Ga0070688_1001780641 423
75 3300005445 Ga0070708_100007479 Ga0070708_1000074793 423
76 3300005546 Ga0070696_100011483 Ga0070696_1000114834 423
77 3300005718 Ga0068866_10050649 Ga0068866_100506492 423
78 3300009148 Ga0105243_10035109 Ga0105243_100351094 423
79 3300009176 Ga0105242_10018964 Ga0105242_100189643 423
80 3300013297 Ga0157378_10002371 Ga0157378_100023719 423
81 3300025899 Ga0207642_10032183 Ga0207642_100321831 423
82 3300025920 Ga0207649_10035242 Ga0207649_100352422 423
83 3300025935 Ga0207709_10009698 Ga0207709_100096983 423
84 3300025942 Ga0207689_10188890 Ga0207689_101888901 423
85 3300037471 Ga0395905_0004928 Ga0395905_0004928_5904_7187 423
86 3300037471 Ga0395905_0048862 Ga0395905_0048862_1632_2915 423
87 3300046455 Ga0495603_0003242 Ga0495603_0003242_8232_9506 423
88 3300046499 Ga0495594_0107800 Ga0495594_0107800_138_1412 423
89 3300046674 Ga0495588_0035791 Ga0495588_0035791_145_1419 423
90 3300048908 Ga0496105_0002145 Ga0496105_0002145_5083_6396 423
91 3300048909 Ga0496106_0002978 Ga0496106_0002978_1811_3085 423
92 3300053087 Ga0500643_000810 Ga0500643_000810_5530_6816 423
93 3300009148 Ga0105243_10165720 Ga0105243_101657202 424
94 3300037471 Ga0395905_0039675 Ga0395905_0039675_485_1771 424
95 3300038443 Ga0395901_0111729 Ga0395901_0111729_369_1655 424
96 3300038443 Ga0395901_0128587 Ga0395901_0128587_80_1366 424
97 3300044712 Ga0453684_0002500 Ga0453684_0002500_1118_2392 424
98 iso_pu_bacteria 2936361878 2936362019 424
99 iso_pu_bacteria 2964375228 2964379234 424
100 iso_pu_bacteria 2977254563 2977256396 424
101 3300028800 Ga0265338_10006311 Ga0265338_100063113 425
102 3300031247 Ga0265340_10029943 Ga0265340_100299433 425
103 3300046472 Ga0495580_0075136 Ga0495580_0075136_217_1500 425
104 iso_pu_bacteria 2818991441 2819568656 425
105 iso_pu_bacteria 2831905167 2831906619 425
106 iso_pu_bacteria 2919414237 2919418229 425
107 3300049569 Ga0501032_0026240 Ga0501032_0026240_1665_2945 426
108 3300049573 Ga0501037_0000732 Ga0501037_0000732_68_1348 426
109 3300049573 Ga0501037_0055451 Ga0501037_0055451_1594_2874 426
110 3300049580 Ga0501046_0073727 Ga0501046_0073727_1299_2579 426
111 3300049586 Ga0501070_0002248 Ga0501070_0002248_4104_5384 426
112 3300049586 Ga0501070_0026653 Ga0501070_0026653_208_1488 426
113 3300049586 Ga0501070_0082398 Ga0501070_0082398_1086_2366 426
114 3300049590 Ga0501074_0000076 Ga0501074_0000076_42760_44040 426
115 3300049591 Ga0501075_0049670 Ga0501075_0049670_1454_2734 426
116 3300049742 Ga0501080_0012965 Ga0501080_0012965_4432_5712 426
117 iso_pu_bacteria 2881644220 2881645078 426
118 3300030500 Ga0268256_1004720 Ga0268256_10047203 427
119 3300003187 JGI25151J46595_10021862 JGI25151J46595_100218622 428
120 3300005563 Ga0068855_100013731 Ga0068855_1000137315 428
121 3300005614 Ga0068856_100037042 Ga0068856_1000370423 428
122 3300025949 Ga0207667_10013873 Ga0207667_100138733 428
123 3300049574 Ga0501038_0001222 Ga0501038_0001222_13076_14386 428
124 3300049574 Ga0501038_0239254 Ga0501038_0239254_81_1373 428
125 3300049578 Ga0501042_0080292 Ga0501042_0080292_973_2259 428
126 3300049580 Ga0501046_0079017 Ga0501046_0079017_957_2249 428
127 3300049581 Ga0501047_0190045 Ga0501047_0190045_328_1638 428
128 3300049592 Ga0501076_0035959 Ga0501076_0035959_800_2092 428
129 3300049743 Ga0501081_0018433 Ga0501081_0018433_2934_4226 428
130 3300061734 Ga0530510_0038128 Ga0530510_0038128_960_2249 428
131 iso_pu_bacteria 2902048731 2902052387 428
132 3300003187 JGI25151J46595_10000060 JGI25151J46595_10000060104 429
133 3300025949 Ga0207667_10069079 Ga0207667_100690793 430
134 3300037471 Ga0395905_0000001 Ga0395905_0000001_1964718_1966010 430
135 3300037471 Ga0395905_0003424 Ga0395905_0003424_10678_11982 430
136 3300049587 Ga0501071_0021897 Ga0501071_0021897_2720_4033 430
137 3300061734 Ga0530510_0028705 Ga0530510_0028705_1316_2629 430
138 iso_pu_bacteria 2890804823 2890806768 430
139 3300013307 Ga0157372_10004698 Ga0157372_1000469811 431
140 3300045051 Ga0451576_0000002 Ga0451576_0000002_883533_884828 431
141 iso_pu_bacteria 2890737413 2890739311 431
142 iso_pu_bacteria 2896344016 2896346846 431
143 iso_pu_bacteria 2898713307 2898713478 431
144 3300009176 Ga0105242_10104699 Ga0105242_101046992 432
145 3300025934 Ga0207686_10059636 Ga0207686_100596362 432
146 3300042876 Ga0451577_0000213 Ga0451577_0000213_78964_80262 432
147 iso_pu_bacteria 2721755487 2722726247 432
148 iso_pu_bacteria 2852623160 2852625364 432
149 iso_pu_bacteria 2884933994 2884934376 432
150 iso_pu_bacteria 2896317667 2896320770 432
151 iso_pu_bacteria 2904780799 2904782851 432
152 iso_pu_bacteria 2919177583 2919180462 432
153 iso_pu_bacteria 2977232053 2977233888 433
154 iso_pu_bacteria 3003233435 3003234849 433
155 3300046665 Ga0495661_0000341 Ga0495661_0000341_16213_17520 435
156 3300009148 Ga0105243_10000009 Ga0105243_10000009279 436
157 3300009176 Ga0105242_10065006 Ga0105242_100650064 436
158 3300025935 Ga0207709_10000026 Ga0207709_10000026280 436
159 3300028794 Ga0307515_10191099 Ga0307515_101910992 436
160 3300037312 Ga0395899_0000025 Ga0395899_0000025_9461_10771 436
161 3300037418 Ga0395900_0103932 Ga0395900_0103932_371_1681 436
162 3300048919 Ga0496116_0022816 Ga0496116_0022816_1281_2591 436
163 3300048920 Ga0496117_0011076 Ga0496117_0011076_1640_2950 436
164 3300048925 Ga0496122_0092725 Ga0496122_0092725_148_1458 436
165 3300048926 Ga0496123_0102798 Ga0496123_0102798_164_1474 436
166 3300048927 Ga0496124_0102864 Ga0496124_0102864_824_2134 436
167 3300006195 Ga0075366_10002946 Ga0075366_100029467 437
168 3300044712 Ga0453684_0280650 Ga0453684_0280650_125_1441 437
169 3300050493 nmdc:mga0k408_237_c1 nmdc:mga0k408_237_c1_6241_7554 437
170 3300053156 Ga0500622_0000440 Ga0500622_0000440_8149_9462 437
171 3300005289 Ga0065704_10080358 Ga0065704_100803584 438
172 3300005288 Ga0065714_10013017 Ga0065714_100130172 439
173 3300025924 Ga0207694_10147051 Ga0207694_101470512 439
174 3300017792 Ga0163161_10000347 Ga0163161_1000034721 440
175 3300025291 Ga0209675_1020495 Ga0209675_10204952 441
176 3300013100 Ga0157373_10018401 Ga0157373_100184014 444
177 3300046538 Ga0495609_0026385 Ga0495609_0026385_1108_2478 444
178 iso_pu_bacteria 2738541283 2738756866 446
179 3300005295 Ga0065707_10118584 Ga0065707_101185842 447
180 3300001990 JGI24737J22298_10004613 JGI24737J22298_100046132 448
181 3300001990 JGI24737J22298_10007890 JGI24737J22298_100078904 448
182 3300002067 JGI24735J21928_10000009 JGI24735J21928_1000000940 448
183 3300002067 JGI24735J21928_10000036 JGI24735J21928_1000003644 448
184 3300002067 JGI24735J21928_10007144 JGI24735J21928_100071441 448
185 3300003316 rootH1_10113611 rootH1_101136112 448
186 3300005577 Ga0068857_100014194 Ga0068857_1000141945 448
187 3300013100 Ga0157373_10003087 Ga0157373_1000308712 448
188 3300013102 Ga0157371_10001176 Ga0157371_1000117630 448
189 3300013307 Ga0157372_10001115 Ga0157372_100011156 448
190 3300025250 Ga0209026_1000943 Ga0209026_100094313 448
191 3300025261 Ga0209233_1000482 Ga0209233_100048218 448
192 3300025904 Ga0207647_10000431 Ga0207647_1000043111 448
193 3300025911 Ga0207654_10007426 Ga0207654_100074265 448
194 3300025913 Ga0207695_10000179 Ga0207695_1000017983 448
195 3300025949 Ga0207667_10028328 Ga0207667_100283285 448
196 3300038443 Ga0395901_0020679 Ga0395901_0020679_4645_5991 448
197 3300003781 Ga0055536_1000004 Ga0055536_1000004283 449
198 3300005288 Ga0065714_10013455 Ga0065714_100134552 449
199 3300005288 Ga0065714_10076017 Ga0065714_100760172 449
200 3300005530 Ga0070679_100022509 Ga0070679_1000225095 449
201 3300015682 Ga0183373_1004 Ga0183373_1004226 449
202 3300025292 Ga0209676_1000009 Ga0209676_1000009272 449
203 3300025298 Ga0209050_1000048 Ga0209050_100004867 449
204 3300025914 Ga0207671_10002949 Ga0207671_1000294914 449
205 3300025921 Ga0207652_10015818 Ga0207652_100158185 449
206 3300025949 Ga0207667_10033359 Ga0207667_100333596 449
207 3300028794 Ga0307515_10002716 Ga0307515_1000271611 449
208 3300028794 Ga0307515_10018541 Ga0307515_100185419 449
209 3300033179 Ga0307507_10000034 Ga0307507_1000003453 449
210 3300033180 Ga0307510_10005665 Ga0307510_100056652 449
211 3300032004 Ga0307414_10039826 Ga0307414_100398261 450
212 3300032004 Ga0307414_10205637 Ga0307414_102056371 450
213 iso_pu_bacteria 2842903701 2842908822 450
214 iso_pu_bacteria 2599185184 2599479322 451
215 iso_pu_bacteria 2928078545 2928082368 451
216 iso_pu_bacteria 2928147474 2928149051 451
217 iso_pu_bacteria 2932082852 2932088406 451
218 iso_pu_bacteria 2585427687 2586208089 452
219 iso_pu_bacteria 2738541302 2738856575 452
220 iso_pu_bacteria 2739367651 2739588119 452
221 iso_pu_bacteria 2739367656 2739616213 452
222 iso_pu_bacteria 2842722452 2842724085 452
223 iso_pu_bacteria 2842909656 2842912183 452
224 iso_pu_bacteria 2849281842 2849282400 452
225 iso_pu_bacteria 2857627736 2857631315 452
226 iso_pu_bacteria 2904445276 2904446276 452
227 iso_pu_bacteria 2919437846 2919438039 452
228 iso_pu_bacteria 2945997725 2945999102 452
229 iso_pu_bacteria 2954016120 2954021551 452
230 iso_pu_bacteria 8055588893 8055591252 452
231 iso_pu_bacteria 2738541284 2738760124 453
232 iso_pu_bacteria 2738543023 2739304992 453
233 iso_pu_bacteria 2739367663 2739646874 453
234 iso_pu_bacteria 2775506987 2776612108 453
235 iso_pu_bacteria 2852627209 2852631728 453
236 iso_pu_bacteria 2919186247 2919191430 453
237 iso_pu_bacteria 2939664404 2939669651 453
238 3300003320 rootH2_10194668 rootH2_101946682 454
239 3300030742 Ga0316183_1046861 Ga0316183_10468618 454
240 3300030744 Ga0316181_1079882 Ga0316181_10798827 454
241 3300047472 Ga0495686_0015517 Ga0495686_0015517_1520_2884 454
242 3300003320 rootH2_10198877 rootH2_101988772 455
243 3300005327 Ga0070658_10000099 Ga0070658_1000009969 455
244 3300005530 Ga0070679_100273660 Ga0070679_1002736601 455
245 3300005539 Ga0068853_100007576 Ga0068853_1000075767 455
246 3300005614 Ga0068856_100002703 Ga0068856_1000027037 455
247 3300009093 Ga0105240_10000128 Ga0105240_1000012897 455
248 3300009545 Ga0105237_10001681 Ga0105237_1000168118 455
249 3300009545 Ga0105237_10010902 Ga0105237_100109025 455
250 3300009551 Ga0105238_10203895 Ga0105238_102038951 455
251 3300010375 Ga0105239_10000011 Ga0105239_10000011164 455
252 3300010375 Ga0105239_10000392 Ga0105239_100003927 455
253 3300010375 Ga0105239_10001249 Ga0105239_1000124926 455
254 3300013104 Ga0157370_10019162 Ga0157370_100191623 455
255 3300013297 Ga0157378_10003207 Ga0157378_1000320713 455
256 3300013307 Ga0157372_10001737 Ga0157372_1000173723 455
257 3300025909 Ga0207705_10000142 Ga0207705_1000014269 455
258 3300025914 Ga0207671_10000948 Ga0207671_100009486 455
259 3300025914 Ga0207671_10014945 Ga0207671_100149452 455
260 3300025949 Ga0207667_10015128 Ga0207667_100151282 455
261 3300026041 Ga0207639_10135609 Ga0207639_101356091 455
262 3300026078 Ga0207702_10028200 Ga0207702_100282002 455
263 3300031911 Ga0307412_10033931 Ga0307412_100339311 455
264 3300037312 Ga0395899_0000011 Ga0395899_0000011_453272_454639 455
265 3300037418 Ga0395900_0001545 Ga0395900_0001545_10838_12205 455
266 3300037418 Ga0395900_0035437 Ga0395900_0035437_27_1394 455
267 3300037471 Ga0395905_0000779 Ga0395905_0000779_36357_37724 455
268 3300038443 Ga0395901_0043624 Ga0395901_0043624_2187_3554 455
269 3300046471 Ga0495650_0000447 Ga0495650_0000447_33119_34486 455
270 3300046492 Ga0495585_0000116 Ga0495585_0000116_62801_64168 455
271 3300046506 Ga0495583_0016097 Ga0495583_0016097_860_2227 455
272 3300046507 Ga0495606_0000844 Ga0495606_0000844_20424_21791 455
273 3300046512 Ga0495610_0002995 Ga0495610_0002995_5736_7103 455
274 3300046513 Ga0495616_0006153 Ga0495616_0006153_3382_4749 455
275 3300046558 Ga0495633_0003971 Ga0495633_0003971_1130_2497 455
276 3300046660 Ga0495625_0000972 Ga0495625_0000972_3716_5083 455
277 3300046694 Ga0495649_0000014 Ga0495649_0000014_282326_283693 455
278 3300047443 Ga0495687_001057 Ga0495687_001057_11847_13214 455
279 3300047469 Ga0495673_0053516 Ga0495673_0053516_20_1387 455
280 3300047472 Ga0495686_0001318 Ga0495686_0001318_17259_18626 455
281 3300050493 nmdc:mga0k408_49719_c1 nmdc:mga0k408_49719_c1_176_1543 455
282 3300053080 Ga0500635_0001928 Ga0500635_0001928_2642_4009 455
283 3300002737 JGI25162J39368_1000123 JGI25162J39368_100012312 456
284 3300002737 JGI25162J39368_1000306 JGI25162J39368_100030612 456
285 3300002773 JGI25152J39213_1000047 JGI25152J39213_100004732 456
286 3300002774 JGI25150J39212_1000001 JGI25150J39212_100000172 456
287 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001721 456
288 3300003214 JGI25165J46597_1000983 JGI25165J46597_10009838 456
289 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001610 456
290 3300003320 rootH2_10000336 rootH2_1000033633 456
291 3300003323 rootH1_10011684 rootH1_1001168419 456
292 3300003791 Ga0055530_10005284 Ga0055530_100052845 456
293 3300004799 Ga0058863_10041784 Ga0058863_100417844 456
294 3300004803 Ga0058862_11288598 Ga0058862_112885981 456
295 3300005288 Ga0065714_10002286 Ga0065714_100022864 456
296 3300005329 Ga0070683_100018563 Ga0070683_1000185633 456
297 3300005366 Ga0070659_100000824 Ga0070659_10000082417 456
298 3300005455 Ga0070663_100015786 Ga0070663_1000157863 456
299 3300005458 Ga0070681_10005212 Ga0070681_100052123 456
300 3300005530 Ga0070679_100018413 Ga0070679_1000184139 456
301 3300005548 Ga0070665_100000010 Ga0070665_100000010438 456
302 3300005563 Ga0068855_100000631 Ga0068855_10000063117 456
303 3300005563 Ga0068855_100001701 Ga0068855_10000170114 456
304 3300005563 Ga0068855_100024159 Ga0068855_1000241595 456
305 3300005614 Ga0068856_100000030 Ga0068856_10000003015 456
306 3300009093 Ga0105240_10027264 Ga0105240_100272645 456
307 3300009093 Ga0105240_10033682 Ga0105240_100336822 456
308 3300009093 Ga0105240_10143513 Ga0105240_101435131 456
309 3300009148 Ga0105243_10019690 Ga0105243_100196903 456
310 3300009174 Ga0105241_10133858 Ga0105241_101338582 456
311 3300009545 Ga0105237_10027313 Ga0105237_100273135 456
312 3300009545 Ga0105237_10032126 Ga0105237_100321263 456
313 3300009545 Ga0105237_10041568 Ga0105237_100415683 456
314 3300010375 Ga0105239_10003944 Ga0105239_1000394414 456
315 3300010375 Ga0105239_10004273 Ga0105239_1000427313 456
316 3300010375 Ga0105239_10005554 Ga0105239_100055549 456
317 3300013100 Ga0157373_10000115 Ga0157373_1000011544 456
318 3300013100 Ga0157373_10138790 Ga0157373_101387901 456
319 3300013102 Ga0157371_10000041 Ga0157371_10000041181 456
320 3300013102 Ga0157371_10005754 Ga0157371_100057545 456
321 3300013104 Ga0157370_10003392 Ga0157370_100033923 456
322 3300013104 Ga0157370_10035113 Ga0157370_100351133 456
323 3300013104 Ga0157370_10104762 Ga0157370_101047622 456
324 3300013104 Ga0157370_10112109 Ga0157370_101121092 456
325 3300013105 Ga0157369_10000016 Ga0157369_1000001637 456
326 3300013105 Ga0157369_10005273 Ga0157369_100052733 456
327 3300013297 Ga0157378_10329949 Ga0157378_103299491 456
328 3300013306 Ga0163162_10000005 Ga0163162_10000005342 456
329 3300013306 Ga0163162_10013733 Ga0163162_100137331 456
330 3300013307 Ga0157372_10000026 Ga0157372_10000026151 456
331 3300013307 Ga0157372_10087795 Ga0157372_100877953 456
332 3300013308 Ga0157375_10019342 Ga0157375_100193424 456
333 3300014497 Ga0182008_10001241 Ga0182008_1000124118 456
334 3300015261 Ga0182006_1000258 Ga0182006_10002584 456
335 3300015261 Ga0182006_1001127 Ga0182006_100112713 456
336 3300015262 Ga0182007_10000002 Ga0182007_10000002240 456
337 3300017792 Ga0163161_10001290 Ga0163161_1000129015 456
338 3300017792 Ga0163161_10003196 Ga0163161_100031968 456
339 3300017792 Ga0163161_10038624 Ga0163161_100386242 456
340 3300017792 Ga0163161_10054942 Ga0163161_100549422 456
341 3300025231 Ga0207427_100210 Ga0207427_10021010 456
342 3300025233 Ga0209437_100021 Ga0209437_100021595 456
343 3300025233 Ga0209437_100251 Ga0209437_1002519 456
344 3300025245 Ga0207425_1000002 Ga0207425_10000021085 456
345 3300025250 Ga0209026_1001240 Ga0209026_100124010 456
346 3300025258 Ga0209129_1000002 Ga0209129_10000021085 456
347 3300025261 Ga0209233_1000035 Ga0209233_100003542 456
348 3300025272 Ga0209455_1000741 Ga0209455_10007417 456
349 3300025294 Ga0209025_1000004 Ga0209025_1000004107 456
350 3300025297 Ga0209758_1000006 Ga0209758_1000006107 456
351 3300025912 Ga0207707_10010880 Ga0207707_100108809 456
352 3300025913 Ga0207695_10043825 Ga0207695_100438253 456
353 3300025913 Ga0207695_10048667 Ga0207695_100486672 456
354 3300025914 Ga0207671_10022468 Ga0207671_100224682 456
355 3300025921 Ga0207652_10039708 Ga0207652_100397083 456
356 3300025932 Ga0207690_10000351 Ga0207690_100003519 456
357 3300025944 Ga0207661_10202345 Ga0207661_102023452 456
358 3300025949 Ga0207667_10000030 Ga0207667_1000003014 456
359 3300025949 Ga0207667_10000218 Ga0207667_1000021843 456
360 3300025949 Ga0207667_10011112 Ga0207667_100111126 456
361 3300025981 Ga0207640_10003804 Ga0207640_100038047 456
362 3300026041 Ga0207639_10113084 Ga0207639_101130841 456
363 3300026067 Ga0207678_10021189 Ga0207678_100211892 456
364 3300026078 Ga0207702_10001383 Ga0207702_1000138315 456
365 3300028379 Ga0268266_10000032 Ga0268266_10000032139 456
366 3300028786 Ga0307517_10000640 Ga0307517_1000064053 456
367 3300028794 Ga0307515_10017577 Ga0307515_1001757714 456
368 3300028800 Ga0265338_10024117 Ga0265338_100241173 456
369 3300031251 Ga0265327_10042075 Ga0265327_100420752 456
370 3300031507 Ga0307509_10031891 Ga0307509_100318914 456
371 3300031548 Ga0307408_100000324 Ga0307408_10000032416 456
372 3300031548 Ga0307408_100020325 Ga0307408_1000203252 456
373 3300031548 Ga0307408_100049562 Ga0307408_1000495622 456
374 3300031731 Ga0307405_10000006 Ga0307405_10000006258 456
375 3300031903 Ga0307407_10000075 Ga0307407_1000007525 456
376 3300031911 Ga0307412_10041772 Ga0307412_100417722 456
377 3300031995 Ga0307409_100011023 Ga0307409_1000110232 456
378 3300032002 Ga0307416_100000002 Ga0307416_100000002223 456
379 3300037312 Ga0395899_0000055 Ga0395899_0000055_66257_67627 456
380 3300044684 Ga0466966_0058270 Ga0466966_0058270_791_2161 456
381 3300045836 Ga0466958_0014767 Ga0466958_0014767_1052_2422 456
382 3300046492 Ga0495585_0000596 Ga0495585_0000596_2479_3909 456
383 3300046500 Ga0495596_0007857 Ga0495596_0007857_2368_3738 456
384 3300046512 Ga0495610_0000099 Ga0495610_0000099_49861_51231 456
385 3300046512 Ga0495610_0002563 Ga0495610_0002563_9083_10525 456
386 3300046523 Ga0495644_0044246 Ga0495644_0044246_251_1621 456
387 3300046538 Ga0495609_0007074 Ga0495609_0007074_2536_3966 456
388 3300046558 Ga0495633_0000021 Ga0495633_0000021_21207_22577 456
389 3300046616 Ga0495668_0000165 Ga0495668_0000165_76857_78287 456
390 3300046660 Ga0495625_0000907 Ga0495625_0000907_4869_6299 456
391 3300046660 Ga0495625_0027806 Ga0495625_0027806_1140_2510 456
392 3300046694 Ga0495649_0014284 Ga0495649_0014284_2391_3761 456
393 3300047323 Ga0495683_0025426 Ga0495683_0025426_1578_2948 456
394 3300047472 Ga0495686_0000913 Ga0495686_0000913_34552_35922 456
395 3300047472 Ga0495686_0037993 Ga0495686_0037993_805_2175 456
396 3300047472 Ga0495686_0042805 Ga0495686_0042805_396_1766 456
397 3300048089 Ga0495614_0060498 Ga0495614_0060498_176_1606 456
398 3300049459 Ga0495678_006175 Ga0495678_006175_4159_5529 456
399 3300053122 Ga0500608_000555 Ga0500608_000555_11730_13100 456
400 3300053122 Ga0500608_008573 Ga0500608_008573_1600_2970 456
401 3300053125 Ga0500618_000027 Ga0500618_000027_88254_89624 456
402 3300053130 Ga0500642_0002544 Ga0500642_0002544_2689_4059 456
403 3300053143 Ga0500579_096933 Ga0500579_096933_73_1443 456
404 iso_pu_bacteria 2818991437 2819546018 456
405 2162886007 SwRhRL2b_contig_1166171 SwRhRL2b_0607.00004350 457
406 3300001990 JGI24737J22298_10013231 JGI24737J22298_100132312 457
407 3300005288 Ga0065714_10007892 Ga0065714_100078923 457
408 3300005288 Ga0065714_10011309 Ga0065714_100113092 457
409 3300005289 Ga0065704_10000263 Ga0065704_1000026319 457
410 3300005338 Ga0068868_100017383 Ga0068868_1000173835 457
411 3300005338 Ga0068868_100041830 Ga0068868_1000418302 457
412 3300005339 Ga0070660_100175322 Ga0070660_1001753221 457
413 3300005364 Ga0070673_100038055 Ga0070673_1000380552 457
414 3300005456 Ga0070678_100019638 Ga0070678_1000196383 457
415 3300005457 Ga0070662_100000013 Ga0070662_10000001344 457
416 3300005459 Ga0068867_100000852 Ga0068867_10000085216 457
417 3300005718 Ga0068866_10012303 Ga0068866_100123033 457
418 3300006237 Ga0097621_100001053 Ga0097621_10000105318 457
419 3300006358 Ga0068871_100000109 Ga0068871_10000010910 457
420 3300006881 Ga0068865_100000079 Ga0068865_10000007913 457
421 3300009093 Ga0105240_10001477 Ga0105240_1000147731 457
422 3300009174 Ga0105241_10001015 Ga0105241_100010156 457
423 3300009174 Ga0105241_10014824 Ga0105241_100148243 457
424 3300009176 Ga0105242_10020601 Ga0105242_100206014 457
425 3300009545 Ga0105237_10000713 Ga0105237_100007136 457
426 3300009545 Ga0105237_10003226 Ga0105237_100032263 457
427 3300009551 Ga0105238_10007790 Ga0105238_100077905 457
428 3300010375 Ga0105239_10214347 Ga0105239_102143471 457
429 3300013100 Ga0157373_10003093 Ga0157373_100030934 457
430 3300013102 Ga0157371_10008441 Ga0157371_100084415 457
431 3300013102 Ga0157371_10013384 Ga0157371_100133845 457
432 3300013102 Ga0157371_10013891 Ga0157371_100138914 457
433 3300013104 Ga0157370_10002405 Ga0157370_100024057 457
434 3300013104 Ga0157370_10022798 Ga0157370_100227986 457
435 3300013104 Ga0157370_10024814 Ga0157370_100248142 457
436 3300013104 Ga0157370_10037895 Ga0157370_100378953 457
437 3300013105 Ga0157369_10144705 Ga0157369_101447052 457
438 3300013296 Ga0157374_10000258 Ga0157374_1000025820 457
439 3300013296 Ga0157374_10003809 Ga0157374_100038099 457
440 3300013297 Ga0157378_10039852 Ga0157378_100398524 457
441 3300013307 Ga0157372_10143188 Ga0157372_101431882 457
442 3300014497 Ga0182008_10000014 Ga0182008_1000001446 457
443 3300014497 Ga0182008_10000932 Ga0182008_100009327 457
444 3300014497 Ga0182008_10006343 Ga0182008_100063435 457
445 3300014497 Ga0182008_10024565 Ga0182008_100245652 457
446 3300015261 Ga0182006_1007803 Ga0182006_10078032 457
447 3300015262 Ga0182007_10003077 Ga0182007_100030772 457
448 3300015262 Ga0182007_10012583 Ga0182007_100125832 457
449 3300015262 Ga0182007_10013350 Ga0182007_100133502 457
450 3300017792 Ga0163161_10002101 Ga0163161_100021014 457
451 3300025904 Ga0207647_10000044 Ga0207647_1000004445 457
452 3300025907 Ga0207645_10000135 Ga0207645_1000013549 457
453 3300025911 Ga0207654_10000191 Ga0207654_1000019123 457
454 3300025911 Ga0207654_10004366 Ga0207654_100043663 457
455 3300025913 Ga0207695_10002745 Ga0207695_100027458 457
456 3300025914 Ga0207671_10004197 Ga0207671_100041974 457
457 3300025919 Ga0207657_10165407 Ga0207657_101654072 457
458 3300025924 Ga0207694_10025702 Ga0207694_100257023 457
459 3300025931 Ga0207644_10009772 Ga0207644_100097722 457
460 3300025933 Ga0207706_10000173 Ga0207706_1000017345 457
461 3300025938 Ga0207704_10000019 Ga0207704_10000019116 457
462 3300025960 Ga0207651_10003044 Ga0207651_100030447 457
463 3300026023 Ga0207677_10015964 Ga0207677_100159645 457
464 3300026023 Ga0207677_10027281 Ga0207677_100272812 457
465 3300026041 Ga0207639_10042961 Ga0207639_100429613 457
466 3300026088 Ga0207641_10209351 Ga0207641_102093512 457
467 3300026089 Ga0207648_10000061 Ga0207648_1000006189 457
468 3300026121 Ga0207683_10002822 Ga0207683_1000282211 457
469 3300031911 Ga0307412_10000827 Ga0307412_1000082712 457
470 3300032004 Ga0307414_10004624 Ga0307414_100046248 457
471 3300032004 Ga0307414_10010138 Ga0307414_100101383 457
472 3300032004 Ga0307414_10014891 Ga0307414_100148914 457
473 3300037312 Ga0395899_0000563 Ga0395899_0000563_26080_27453 457
474 3300037418 Ga0395900_0000173 Ga0395900_0000173_27003_28376 457
475 3300037466 Ga0395898_0005193 Ga0395898_0005193_8285_9658 457
476 3300037471 Ga0395905_0001821 Ga0395905_0001821_13454_14827 457
477 3300038443 Ga0395901_0006218 Ga0395901_0006218_7362_8735 457
478 3300042005 Ga0439448_0003865 Ga0439448_0003865_1299_2672 457
479 3300046507 Ga0495606_0030120 Ga0495606_0030120_2072_3445 457
480 3300048925 Ga0496122_0002491 Ga0496122_0002491_11200_12573 457
481 3300048926 Ga0496123_0005145 Ga0496123_0005145_3280_4653 457
482 3300049758 Ga0501241_005478 Ga0501241_005478_536_1909 457
483 3300053093 Ga0500651_0000182 Ga0500651_0000182_24748_26121 457

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

76

472

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hp1-assembly1.cif.gz_B inter-subunit signaling in gsam 0.9725 26 452
2hoy-assembly1.cif.gz_B inter-subunit signaling in gsam 0.972 26 450
2hoz-assembly1.cif.gz_B inter-subunit signaling in gsam 0.9718 26 452
2hoy-assembly1.cif.gz_A inter-subunit signaling in gsam 0.9717 26 450
5i92-assembly2.cif.gz_D crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa 0.9686 30 452
ID Description Score Start End Superfamily
af_Q58020_48_419_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9647 74 446 3.40.640.10
2epjA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9606 97 342 3.40.640.10
af_P9WMN9_84_347_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9596 98 341 3.40.640.10
af_Q58020_48_419_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9596 74 446 3.40.640.10
5i92D01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9505 30 452 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A4Q3BAK0-F1-model_v4 deleted 0.9904 86 455
AF-A0A3C0ZBN6-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (EC 5.4.3.8) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) 0.9884 24 455 GO:0005737
GO:0006782
GO:0008483
GO:0030170
GO:0042286
AF-A0A2U2PCM3-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (EC 5.4.3.8) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) 0.9866 23 453 GO:0005737
GO:0006782
GO:0008483
GO:0030170
GO:0042286
AF-A0A7V4YUB3-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9854 151 454 GO:0008483
GO:0030170
AF-A0A4Q3BAK0-F1-model_v4 deleted 0.9824 86 455

Feature Viewer

pLDDT pTM Quality
87.33 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map