F452762

General Info

Members Datasets Scaffolds Average Seq Length
483 320 966 258

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10025858|Ga0105247_100258584
Length 294
Sequence MVTFRFSPAGTALASGLNPTPSIQDVINFAGGEDVMFRMLASLAIVMLWTVFAHAQQPATSRLDDILKRGTLRVGMTGDYRPFTYLDKATSKFHGFDVDMAEALGKALGVKVEFVQTSWPQLMKDFEADNFDIAMGGVSITLDRQKKGLFSTPIMREGKTPITRCADKGKYETIADIDKSGTRVIVNPGGTNERFAKANIRNAEIKMWNDNVTIFDEIAKGNADLMMTDASETRYQQKQHPGVLCSVHPEKPFDFAEKAYWLQRDVALKAFVDQWLHIATEDGSYRKIYAAWFD

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
140 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
270 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
271 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
272 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
273 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
274 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
275 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
276 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
277 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
278 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
279 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
282 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
283 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
284 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
285 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
286 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
287 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
288 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
289 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
290 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
291 2791355199
292 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
293 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
294 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
295 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
296 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
297 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
298 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
299 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
300 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
301 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
302 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
303 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
304 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
305 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
306 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
307 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
308 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
309 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
310 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
311 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
312 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
313 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
314 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
315 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
316 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
317 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
318 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
319 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
320 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.91
Metatranscriptomes 0
Isolates 8.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.39
Nodule 6.21
Rhizoplane 5.18
Rhizosphere 63.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10025858 3300009101 Bacteria 3542
2 Ga0055543_1007116 3300004625 Bacteria 2621
3 Ga0065165_1000394 3300005262 Bacteria 70991
4 Ga0070683_100080050 3300005329 Bacteria 3058
5 Ga0070670_100113336 3300005331 Bacteria 2337
6 Ga0070670_100225665 3300005331 Bacteria 1630
7 Ga0068869_100092274 3300005334 Bacteria 2279
8 Ga0070666_10202964 3300005335 Bacteria 1395
9 Ga0070680_100013961 3300005336 Bacteria 6269
10 Ga0070682_100038483 3300005337 Bacteria 2934
11 Ga0070689_100173752 3300005340 Bacteria 1747
12 Ga0070661_100095803 3300005344 Bacteria 2202
13 Ga0070668_100017987 3300005347 Bacteria 5302
14 Ga0070668_100037953 3300005347 Bacteria 3680
15 Ga0070668_100075853 3300005347 Bacteria 2625
16 Ga0070674_100226602 3300005356 Bacteria 1457
17 Ga0070709_10024229 3300005434 Bacteria 3571
18 Ga0070714_100459130 3300005435 Bacteria 1211
19 Ga0070713_100013716 3300005436 Bacteria 5992
20 Ga0070713_100061985 3300005436 Bacteria 3131
21 Ga0070710_10000373 3300005437 Bacteria 20977
22 Ga0070711_100001919 3300005439 Bacteria 11633
23 Ga0070663_100033270 3300005455 Bacteria 3560
24 Ga0070678_100097208 3300005456 Bacteria 2273
25 Ga0070678_100262234 3300005456 Bacteria 1454
26 Ga0070681_10027588 3300005458 Bacteria 5709
27 Ga0070681_10092034 3300005458 Bacteria 2982
28 Ga0068867_100446780 3300005459 Bacteria 1101
29 Ga0070679_100055646 3300005530 Bacteria 3940
30 Ga0070684_100011492 3300005535 Bacteria 7052
31 Ga0070684_100026633 3300005535 Bacteria 4872
32 Ga0068853_100083206 3300005539 Bacteria 2804
33 Ga0070695_100397085 3300005545 Bacteria 1044
34 Ga0070696_100083221 3300005546 Bacteria 2269
35 Ga0070693_100100431 3300005547 Bacteria 1762
36 Ga0070665_100006562 3300005548 Bacteria 11829
37 Ga0068855_100019333 3300005563 Bacteria 8185
38 Ga0070664_100193753 3300005564 Bacteria 1811
39 Ga0068857_100534941 3300005577 Bacteria 1103
40 Ga0068856_100292562 3300005614 Bacteria 1645
41 Ga0068852_100102733 3300005616 Bacteria 2583
42 Ga0068852_100148370 3300005616 Bacteria 2178
43 Ga0068858_100329824 3300005842 Bacteria 1459
44 Ga0068860_100000448 3300005843 Bacteria 52034
45 Ga0068862_100224100 3300005844 Bacteria 1703
46 Ga0081455_10012604 3300005937 Bacteria 8426
47 Ga0081455_10046590 3300005937 Bacteria 3760
48 Ga0081455_10056500 3300005937 Bacteria 3332
49 Ga0081540_1008488 3300005983 Bacteria 7171
50 Ga0081540_1015592 3300005983 Bacteria 4805
51 Ga0081540_1038456 3300005983 Bacteria 2522
52 Ga0081540_1072669 3300005983 Bacteria 1583
53 Ga0070717_10000850 3300006028 Bacteria 20235
54 Ga0070717_10537790 3300006028 Bacteria 1058
55 Ga0075365_10144368 3300006038 Bacteria 1653
56 Ga0075365_10190436 3300006038 Bacteria 1435
57 Ga0075368_10003571 3300006042 Bacteria 5212
58 Ga0075363_100001811 3300006048 Bacteria 8371
59 Ga0075364_10122602 3300006051 Bacteria 1741
60 Ga0075364_10220016 3300006051 Bacteria 1288
61 Ga0070715_10013554 3300006163 Bacteria 2998
62 Ga0070716_100065653 3300006173 Bacteria 2114
63 Ga0070712_100039211 3300006175 Bacteria 3241
64 Ga0070712_100048115 3300006175 Bacteria 2955
65 Ga0070712_100053242 3300006175 Bacteria 2826
66 Ga0075369_10015540 3300006186 Bacteria 3057
67 Ga0097621_100097907 3300006237 Bacteria 2463
68 Ga0097621_100458985 3300006237 Bacteria 1149
69 Ga0075370_10146497 3300006353 Bacteria 1382
70 Ga0075370_10152920 3300006353 Bacteria 1352
71 Ga0068871_100177197 3300006358 Bacteria 1830
72 Ga0068871_100315715 3300006358 Bacteria 1375
73 Ga0075434_100054590 3300006871 Bacteria 3969
74 Ga0105250_10031802 3300009092 Bacteria 2119
75 Ga0105240_10043793 3300009093 Bacteria 5692
76 Ga0105240_10056482 3300009093 Bacteria 4912
77 Ga0105240_10111725 3300009093 Bacteria 3305
78 Ga0105240_10143228 3300009093 Bacteria 2855
79 Ga0105240_10614251 3300009093 Bacteria 1196
80 Ga0111539_10370065 3300009094 Bacteria 1668
81 Ga0105245_10101550 3300009098 Bacteria 2663
82 Ga0105247_10027320 3300009101 Bacteria 3452
83 Ga0105247_10039989 3300009101 Bacteria 2865
84 Ga0105247_10128241 3300009101 Bacteria 1651
85 Ga0114129_10231426 3300009147 Bacteria 2489
86 Ga0114129_11076287 3300009147 Bacteria 1008
87 Ga0105243_10110606 3300009148 Bacteria 2298
88 Ga0105243_10168401 3300009148 Bacteria 1895
89 Ga0105241_10041218 3300009174 Bacteria 3488
90 Ga0105242_10079436 3300009176 Bacteria 2740
91 Ga0105242_10104112 3300009176 Bacteria 2409
92 Ga0105248_10052374 3300009177 Bacteria 4580
93 Ga0105248_10266541 3300009177 Bacteria 1928
94 Ga0105237_10166385 3300009545 Bacteria 2204
95 Ga0105237_10430387 3300009545 Bacteria 1325
96 Ga0105237_10557748 3300009545 Bacteria 1152
97 Ga0105237_10740396 3300009545 Bacteria 989
98 Ga0105238_10017212 3300009551 Bacteria 7342
99 Ga0105238_10274394 3300009551 Bacteria 1667
100 Ga0105238_10352533 3300009551 Bacteria 1461
101 Ga0105239_10019887 3300010375 Bacteria 7411
102 Ga0105239_10180262 3300010375 Bacteria 2363
103 Ga0105239_10325356 3300010375 Bacteria 1734
104 Ga0105239_10367325 3300010375 Bacteria 1626
105 Ga0105246_10313556 3300011119 Bacteria 1271
106 Ga0157370_10036889 3300013104 Bacteria 4742
107 Ga0157369_10024893 3300013105 Bacteria 6651
108 Ga0157369_10040262 3300013105 Bacteria 5102
109 Ga0163162_10039835 3300013306 Bacteria 4696
110 Ga0163162_10135880 3300013306 Bacteria 2569
111 Ga0157372_10094335 3300013307 Bacteria 3407
112 Ga0157372_10099206 3300013307 Bacteria 3322
113 Ga0157375_10232256 3300013308 Bacteria 2003
114 Ga0157375_10695767 3300013308 Bacteria 1170
115 Ga0163163_10015963 3300014325 Bacteria 6960
116 Ga0163163_10044461 3300014325 Bacteria 4357
117 Ga0213876_10003255 3300021384 Bacteria 9317
118 Ga0213875_10002889 3300021388 Bacteria 10043
119 Ga0213875_10053105 3300021388 Bacteria 1898
120 Ga0213871_10000540 3300021441 Bacteria 5268
121 Ga0209148_1000616 3300025254 Bacteria 31649
122 Ga0209148_1008764 3300025254 Bacteria 2014
123 Ga0209233_1004877 3300025261 Bacteria 4515
124 Ga0209233_1009147 3300025261 Bacteria 3027
125 Ga0209455_1001649 3300025272 Bacteria 9692
126 Ga0209455_1006587 3300025272 Bacteria 3412
127 Ga0209455_1009657 3300025272 Bacteria 2514
128 Ga0209758_1002140 3300025297 Bacteria 20814
129 Ga0209758_1002422 3300025297 Bacteria 19095
130 Ga0207697_10068429 3300025315 Bacteria 1485
131 Ga0207696_1022016 3300025711 Bacteria 2032
132 Ga0207692_10000069 3300025898 Bacteria 30165
133 Ga0207710_10187291 3300025900 Bacteria 1018
134 Ga0207680_10168353 3300025903 Bacteria 1474
135 Ga0207647_10091168 3300025904 Bacteria 1817
136 Ga0207647_10135280 3300025904 Bacteria 1447
137 Ga0207699_10000289 3300025906 Bacteria 27192
138 Ga0207699_10144911 3300025906 Bacteria 1565
139 Ga0207699_10275299 3300025906 Bacteria 1168
140 Ga0207707_10001525 3300025912 Bacteria 21374
141 Ga0207707_10033868 3300025912 Bacteria 4470
142 Ga0207695_10031690 3300025913 Bacteria 5794
143 Ga0207695_10033817 3300025913 Bacteria 5569
144 Ga0207695_10145684 3300025913 Bacteria 2313
145 Ga0207671_10344346 3300025914 Bacteria 1181
146 Ga0207693_10058435 3300025915 Bacteria 3021
147 Ga0207693_10180098 3300025915 Bacteria 1663
148 Ga0207663_10006878 3300025916 Bacteria 5859
149 Ga0207660_10024100 3300025917 Bacteria 4116
150 Ga0207657_10112736 3300025919 Bacteria 2244
151 Ga0207652_10027003 3300025921 Bacteria 4784
152 Ga0207681_10121813 3300025923 Bacteria 1914
153 Ga0207700_10018176 3300025928 Bacteria 4717
154 Ga0207700_10026659 3300025928 Bacteria 4033
155 Ga0207664_10043317 3300025929 Bacteria 3519
156 Ga0207664_10177840 3300025929 Bacteria 1825
157 Ga0207644_10175097 3300025931 Bacteria 1678
158 Ga0207709_10131853 3300025935 Bacteria 1704
159 Ga0207709_10545647 3300025935 Bacteria 911
160 Ga0207669_10387788 3300025937 Bacteria 1090
161 Ga0207704_10106404 3300025938 Bacteria 1884
162 Ga0207704_10160393 3300025938 Bacteria 1599
163 Ga0207665_10022818 3300025939 Bacteria 4119
164 Ga0207691_10155153 3300025940 Bacteria 2011
165 Ga0207711_10131140 3300025941 Bacteria 2247
166 Ga0207661_10000309 3300025944 Bacteria 31114
167 Ga0207667_10054896 3300025949 Bacteria 4190
168 Ga0207667_10254041 3300025949 Bacteria 1798
169 Ga0207668_10043930 3300025972 Bacteria 3036
170 Ga0207668_10348623 3300025972 Bacteria 1237
171 Ga0207640_10178508 3300025981 Bacteria 1590
172 Ga0207703_10121235 3300026035 Bacteria 2245
173 Ga0207703_10198468 3300026035 Bacteria 1782
174 Ga0207639_10065800 3300026041 Bacteria 2815
175 Ga0207639_10235349 3300026041 Bacteria 1590
176 Ga0207678_10080355 3300026067 Bacteria 2792
177 Ga0207678_10126450 3300026067 Bacteria 2180
178 Ga0207678_10128925 3300026067 Bacteria 2157
179 Ga0207708_10042574 3300026075 Bacteria 3460
180 Ga0207702_10000640 3300026078 Bacteria 38336
181 Ga0207702_10198846 3300026078 Bacteria 1857
182 Ga0207641_10878932 3300026088 Bacteria 889
183 Ga0207648_10147946 3300026089 Bacteria 2072
184 Ga0207648_10345848 3300026089 Bacteria 1340
185 Ga0207683_10117183 3300026121 Bacteria 2388
186 Ga0207683_10135423 3300026121 Bacteria 2217
187 Ga0207698_10476847 3300026142 Bacteria 1209
188 Ga0207698_10528908 3300026142 Bacteria 1152
189 Ga0268266_10000857 3300028379 Bacteria 39606
190 Ga0268266_10005502 3300028379 Bacteria 11795
191 Ga0268266_10082679 3300028379 Bacteria 2801
192 Ga0268265_10145871 3300028380 Bacteria 1988
193 Ga0268265_10307730 3300028380 Bacteria 1429
194 Ga0268265_10433233 3300028380 Bacteria 1224
195 Ga0268264_10000162 3300028381 Bacteria 148472
196 Ga0268264_10433661 3300028381 Bacteria 1270
197 Ga0265334_10017492 3300028573 Bacteria 2959
198 Ga0265323_10015443 3300028653 Bacteria 3003
199 Ga0265336_10000612 3300028666 Bacteria 19831
200 Ga0307517_10000419 3300028786 Bacteria 72682
201 Ga0307515_10003270 3300028794 Bacteria 34266
202 Ga0265338_10015087 3300028800 Bacteria 8525
203 Ga0265324_10003556 3300029957 Bacteria 7346
204 Ga0307511_10078827 3300030521 Bacteria 2333
205 Ga0265330_10020144 3300031235 Bacteria 3049
206 Ga0265330_10059552 3300031235 Bacteria 1663
207 Ga0265325_10002010 3300031241 Bacteria 13971
208 Ga0265325_10004528 3300031241 Bacteria 8760
209 Ga0265331_10011276 3300031250 Bacteria 4901
210 Ga0307509_10033562 3300031507 Bacteria 5648
211 Ga0307509_10074944 3300031507 Bacteria 3516
212 Ga0265313_10017263 3300031595 Bacteria 4109
213 Ga0265314_10076235 3300031711 Bacteria 2229
214 Ga0265342_10018304 3300031712 Bacteria 4541
215 Ga0265342_10077506 3300031712 Bacteria 1925
216 Ga0307516_10013317 3300031730 Bacteria 8778
217 Ga0307516_10062369 3300031730 Bacteria 3613
218 Ga0307516_10076821 3300031730 Bacteria 3190
219 Ga0316583_10003650 3300032133 Bacteria 5438
220 Ga0307507_10074624 3300033179 Bacteria 3040
221 Ga0307510_10028819 3300033180 Bacteria 6334
222 Ga0307510_10068719 3300033180 Bacteria 3553
223 Ga0307510_10126985 3300033180 Bacteria 2237
224 Ga0315911_1000001 3300033442 Bacteria 1088602
225 Ga0316215_1001630 3300033544 Bacteria 2145
226 Ga0373934_0000648 3300035086 Bacteria 12338
227 Ga0373953_0002709 3300035117 Bacteria 5373
228 Ga0373954_0000575 3300035118 Bacteria 13881
229 Ga0373956_0001979 3300035119 Bacteria 8496
230 Ga0373957_0000310 3300035120 Bacteria 12240
231 Ga0373955_0007504 3300035172 Bacteria 5015
232 Ga0373924_0030423 3300035410 Bacteria 2164
233 Ga0373931_0003125 3300035691 Bacteria 7397
234 Ga0373935_0211899 3300035692 Bacteria 1343
235 Ga0373927_0008987 3300035695 Bacteria 6708
236 Ga0373927_0013989 3300035695 Bacteria 5320
237 Ga0373927_0089298 3300035695 Bacteria 2001
238 Ga0373933_0010296 3300035724 Bacteria 5123
239 Ga0373947_0129933 3300035725 Bacteria 1607
240 Ga0373937_0009038 3300036401 Bacteria 8650
241 Ga0373925_0036709 3300037068 Bacteria 3616
242 Ga0373925_0195704 3300037068 Bacteria 1606
243 Ga0395900_0048131 3300037418 Bacteria 4392
244 Ga0395900_0086892 3300037418 Bacteria 3214
245 Ga0395898_0014068 3300037466 Bacteria 8223
246 Ga0395898_0059899 3300037466 Bacteria 3702
247 Ga0436364_0006957 3300037853 Bacteria 1951
248 Ga0436364_0075874 3300037853 Bacteria 2570
249 Ga0436364_0237576 3300037853 Bacteria 24975
250 Ga0436365_0515059 3300039437 Bacteria 1753
251 Ga0436365_1905262 3300039437 Bacteria 993
252 Ga0436360_0483282 3300039438 Bacteria 1390
253 Ga0436360_1141543 3300039438 Bacteria 3113
254 Ga0436360_1254231 3300039438 Bacteria 3085
255 Ga0436361_0209966 3300039447 Bacteria 1414
256 Ga0436361_0614376 3300039447 Bacteria 3136
257 Ga0436363_0355660 3300039450 Bacteria 2061
258 Ga0436363_1443898 3300039450 Bacteria 2388
259 Ga0436362_0459409 3300039453 Bacteria 4389
260 Ga0436362_0970513 3300039453 Bacteria 3044
261 Ga0436362_1279475 3300039453 Bacteria 1252
262 Ga0466969_0021812 3300044656 Bacteria 3310
263 Ga0466966_0010150 3300044684 Bacteria 6245
264 Ga0466961_0000007 3300044693 Bacteria 146374
265 Ga0466963_0024984 3300044694 Bacteria 3806
266 Ga0466970_0161143 3300044765 Bacteria 1241
267 Ga0466957_0037825 3300044842 Bacteria 2906
268 Ga0466957_0067869 3300044842 Bacteria 2201
269 Ga0466967_0165195 3300045976 Bacteria 2080
270 Ga0495592_0013466 3300046454 Bacteria 6222
271 Ga0495603_0002860 3300046455 Bacteria 10199
272 Ga0495603_0172239 3300046455 Bacteria 1253
273 Ga0495629_0000274 3300046459 Bacteria 44731
274 Ga0495629_0028891 3300046459 Bacteria 3936
275 Ga0495641_0039373 3300046461 Bacteria 2205
276 Ga0495651_0018101 3300046462 Bacteria 5454
277 Ga0495651_0159381 3300046462 Bacteria 1618
278 Ga0495653_0009986 3300046463 Bacteria 7764
279 Ga0495582_0052810 3300046473 Bacteria 2241
280 Ga0495664_0429986 3300046477 Bacteria 792
281 Ga0495606_0013201 3300046507 Bacteria 6553
282 Ga0495608_0004333 3300046511 Bacteria 10163
283 Ga0495628_0010786 3300046516 Bacteria 7738
284 Ga0495628_0247436 3300046516 Bacteria 1332
285 Ga0495630_0235283 3300046517 Bacteria 1400
286 Ga0495637_0154248 3300046520 Bacteria 865
287 Ga0495648_0081766 3300046524 Bacteria 1836
288 Ga0495663_0089258 3300046525 Bacteria 1003
289 Ga0495654_0034042 3300046530 Bacteria 2574
290 Ga0495640_0043851 3300046533 Bacteria 3112
291 Ga0495586_0152939 3300046535 Bacteria 1299
292 Ga0495587_0009816 3300046536 Bacteria 6116
293 Ga0495598_0010628 3300046537 Bacteria 2209
294 Ga0495667_0003046 3300046559 Bacteria 11238
295 Ga0495634_0010881 3300046642 Bacteria 6645
296 Ga0495634_0064429 3300046642 Bacteria 2430
297 Ga0495635_0000937 3300046663 Bacteria 19250
298 Ga0495588_0107327 3300046674 Bacteria 1470
299 Ga0495657_0020312 3300046675 Bacteria 4776
300 Ga0495599_0011494 3300046678 Bacteria 5441
301 Ga0495623_0021371 3300046679 Bacteria 4178
302 Ga0495613_0009401 3300046689 Bacteria 7252
303 Ga0495613_0295511 3300046689 Bacteria 1122
304 Ga0495589_0176130 3300046794 Bacteria 1016
305 Ga0495600_0002390 3300046809 Bacteria 10746
306 Ga0495604_0003680 3300047317 Bacteria 12219
307 Ga0495674_0035539 3300047319 Bacteria 4493
308 Ga0495674_0078391 3300047319 Bacteria 2838
309 Ga0495672_0003162 3300047320 Bacteria 14327
310 Ga0495672_0099566 3300047320 Bacteria 1580
311 Ga0495680_0071225 3300047322 Bacteria 2647
312 Ga0495675_0004987 3300047444 Bacteria 8080
313 Ga0495677_0062051 3300047445 Bacteria 1387
314 Ga0495685_100990 3300047447 Bacteria 953
315 Ga0495684_0000202 3300047471 Bacteria 45900
316 Ga0495686_0080625 3300047472 Bacteria 1989
317 Ga0495686_0255600 3300047472 Bacteria 983
318 Ga0495593_0000326 3300047673 Bacteria 26397
319 Ga0495602_0096529 3300048088 Bacteria 2437
320 Ga0496101_0305267 3300048904 Bacteria 1247
321 Ga0496102_0080662 3300048905 Bacteria 2998
322 Ga0496104_0010344 3300048907 Bacteria 8332
323 Ga0496104_0024914 3300048907 Bacteria 5510
324 Ga0496105_0014215 3300048908 Bacteria 6335
325 Ga0496105_0051206 3300048908 Bacteria 3411
326 Ga0496106_0001757 3300048909 Bacteria 16174
327 Ga0496107_0014662 3300048910 Bacteria 5487
328 Ga0496107_0031033 3300048910 Bacteria 3811
329 Ga0496108_0120079 3300048911 Bacteria 2254
330 Ga0496108_0146660 3300048911 Bacteria 2035
331 Ga0496109_0037883 3300048912 Bacteria 4358
332 Ga0496109_0183578 3300048912 Bacteria 1965
333 Ga0496110_0103945 3300048913 Bacteria 2548
334 Ga0496110_0142486 3300048913 Bacteria 2167
335 Ga0496110_0239700 3300048913 Bacteria 1650
336 Ga0496112_0004527 3300048915 Bacteria 11808
337 Ga0496112_0027960 3300048915 Bacteria 5440
338 Ga0496112_0038009 3300048915 Bacteria 4700
339 Ga0496113_0049528 3300048916 Bacteria 3128
340 Ga0496113_0140870 3300048916 Bacteria 1897
341 Ga0496113_0154760 3300048916 Bacteria 1810
342 Ga0496113_0249478 3300048916 Bacteria 1417
343 Ga0496114_0142311 3300048917 Bacteria 2077
344 Ga0496115_0085158 3300048918 Bacteria 2578
345 Ga0496117_0024444 3300048920 Bacteria 4780
346 Ga0496118_0009808 3300048921 Bacteria 9599
347 Ga0496118_0090258 3300048921 Bacteria 2112
348 Ga0496118_0094688 3300048921 Bacteria 2041
349 Ga0496118_0203119 3300048921 Bacteria 1171
350 Ga0496119_0100369 3300048922 Bacteria 1626
351 Ga0496119_0163529 3300048922 Bacteria 1181
352 Ga0496120_0010137 3300048923 Bacteria 6601
353 Ga0496121_0000110 3300048924 Bacteria 186482
354 Ga0496121_0002579 3300048924 Bacteria 27413
355 Ga0496121_0052990 3300048924 Bacteria 3401
356 Ga0496121_0069966 3300048924 Bacteria 2829
357 Ga0496121_0130389 3300048924 Bacteria 1883
358 Ga0496121_0194123 3300048924 Bacteria 1453
359 Ga0496121_0417026 3300048924 Bacteria 875
360 Ga0496124_0000779 3300048927 Bacteria 51994
361 Ga0496124_0349024 3300048927 Bacteria 1047
362 Ga0496125_0038683 3300048928 Bacteria 4123
363 Ga0496125_0100176 3300048928 Bacteria 2137
364 Ga0496125_0130468 3300048928 Bacteria 1770
365 Ga0496125_0131816 3300048928 Bacteria 1758
366 Ga0496126_0006731 3300048929 Bacteria 12759
367 Ga0496126_0007737 3300048929 Bacteria 11719
368 Ga0496126_0009002 3300048929 Bacteria 10682
369 Ga0496126_0011845 3300048929 Bacteria 8972
370 Ga0496126_0119314 3300048929 Bacteria 2289
371 Ga0496126_0160472 3300048929 Bacteria 1921
372 Ga0496126_0197368 3300048929 Bacteria 1701
373 Ga0496126_0251401 3300048929 Bacteria 1473
374 Ga0496126_0270457 3300048929 Bacteria 1410
375 Ga0496126_0351900 3300048929 Bacteria 1205
376 Ga0495678_100306 3300049459 Bacteria 1004
377 Ga0501034_0044485 3300049571 Bacteria 4490
378 Ga0501036_0001151 3300049572 Bacteria 20099
379 Ga0501036_0467911 3300049572 Bacteria 1050
380 Ga0501039_0068999 3300049575 Bacteria 2745
381 Ga0501043_0001730 3300049579 Bacteria 18857
382 Ga0501046_0020717 3300049580 Bacteria 5435
383 Ga0501047_0001306 3300049581 Bacteria 24572
384 Ga0501047_0029040 3300049581 Bacteria 5334
385 Ga0501047_0268691 3300049581 Bacteria 1552
386 Ga0501048_0002101 3300049582 Bacteria 15183
387 Ga0501069_0027432 3300049585 Bacteria 3120
388 Ga0501069_0064996 3300049585 Bacteria 2039
389 Ga0501070_0007916 3300049586 Bacteria 9000
390 Ga0501070_0019664 3300049586 Bacteria 5662
391 Ga0501070_0093143 3300049586 Bacteria 2493
392 Ga0501070_0122685 3300049586 Bacteria 2147
393 Ga0501072_0170424 3300049588 Bacteria 1737
394 Ga0501073_0084100 3300049589 Bacteria 2214
395 Ga0501074_0069746 3300049590 Bacteria 2527
396 Ga0501080_0097721 3300049742 Bacteria 2726
397 Ga0501083_0000166 3300049744 Bacteria 43156
398 Ga0501035_0001481 3300049822 Bacteria 24033
399 Ga0501035_0083025 3300049822 Bacteria 2827
400 Ga0501035_0144196 3300049822 Bacteria 2069
401 Ga0501044_0003316 3300049823 Bacteria 18134
402 Ga0501044_0112217 3300049823 Bacteria 2733
403 nmdc:mga03n38_12498_c1 3300050490 Bacteria 3198
404 nmdc:mga00v17_168923_c1 3300050491 Bacteria 1410
405 nmdc:mga0yw44_49418_c1 3300050492 Bacteria 2539
406 nmdc:mga0yw44_75625_c1 3300050492 Bacteria 2100
407 nmdc:mga0k408_146920_c1 3300050493 Bacteria 1403
408 nmdc:mga0k408_54573_c1 3300050493 Bacteria 2316
409 nmdc:mga06z11_50642_c1 3300050494 Bacteria 2123
410 nmdc:mga07m45_78468_c1 3300050496 Bacteria 1884
411 nmdc:mga05p37_136723_c1 3300050507 Bacteria 3004
412 nmdc:mga0n895_455904_c1 3300050512 Bacteria 1291
413 nmdc:mga0sz30_117513_c1 3300050516 Bacteria 1168
414 Ga0500635_0010137 3300053080 Bacteria 2637
415 Ga0500635_0011572 3300053080 Bacteria 2511
416 Ga0495595_0007110 3300053084 Bacteria 4574
417 Ga0495619_0002426 3300053085 Bacteria 12237
418 Ga0495619_0118754 3300053085 Bacteria 1812
419 Ga0500583_0009979 3300053092 Bacteria 3498
420 Ga0500651_0004378 3300053093 Bacteria 7890
421 Ga0500566_0012862 3300053094 Bacteria 4928
422 Ga0500572_000448 3300053111 Bacteria 14369
423 Ga0500595_036274 3300053119 Bacteria 1616
424 Ga0500595_073885 3300053119 Bacteria 1007
425 Ga0500559_0206364 3300053136 Bacteria 927
426 Ga0500568_0133197 3300053139 Bacteria 923
427 Ga0500573_0136743 3300053140 Bacteria 1352
428 Ga0500588_0034582 3300053146 Bacteria 1481
429 Ga0500590_068810 3300053148 Bacteria 1763
430 Ga0500590_114793 3300053148 Bacteria 1272
431 Ga0500590_146620 3300053148 Bacteria 1071
432 Ga0500603_000063 3300053150 Bacteria 24913
433 Ga0500634_0037468 3300053161 Bacteria 2637
434 Ga0500634_0174573 3300053161 Bacteria 974
435 Ga0500638_000053 3300053162 Bacteria 23611
436 Ga0500638_079969 3300053162 Bacteria 1553
437 Ga0500636_0199473 3300053177 Bacteria 1060
438 Ga0500637_0000149 3300053178 Bacteria 25364
439 Ga0500645_019210 3300053730 Bacteria 2127
440 Ga0500552_019552 3300053733 Bacteria 950
441 Ga0500596_002912 3300053735 Bacteria 3317
442 Ga0500661_000226 3300055283 Bacteria 10060
443 Ga0466962_0074162 3300061719 Bacteria 1626
444 2509151767 2508501128 Bacteria 8613869
445 2513642047 2513237094 Bacteria 8789602
446 2513654416 2513237096 Bacteria 8722461
447 2513718073 2513237104 Bacteria 10034502
448 2513859213 2513237137 Bacteria 9558895
449 2513893500 2513237141 Bacteria 8496279
450 2513915405 2513237145 Bacteria 8979722
451 2517892719 2517572143 Bacteria 9484767
452 2643757041 2643221547 Bacteria 4740017
453 2793068277 2791355197 Bacteria 8420563
454 2793084290
455 2844318669 2844315083 Bacteria 8138177
456 2876813011 2876808645 Bacteria 8824342
457 2879115349 2879110137 Bacteria 8907982
458 2885376993 2885374607 Bacteria 8927485
459 2903752055 2903748898 Bacteria 9972761
460 2904696070 2904690495 Bacteria 9412302
461 2906604502 2906602504 Bacteria 8295279
462 2906643277 2906635258 Bacteria 8601019
463 2906664355 2906660503 Bacteria 8595048
464 2908743076 2908739725 Bacteria 8628932
465 2908760703 2908756301 Bacteria 8864324
466 2922368171 2922361189 Bacteria 7436256
467 2922388357 2922386360 Bacteria 7017218
468 2932798505 2932794094 Bacteria 7915132
469 2932803197 2932801729 Bacteria 7987968
470 2935633444 2935630451 Bacteria 8169952
471 2935887972 2935883170 Bacteria 7964738
472 2941510335 2941507105 Bacteria 8166816
473 2941517928 2941515067 Bacteria 8166720
474 2941525944 2941523033 Bacteria 8169134
475 3005479843 3005474847 Bacteria 9259049
476 3005593292 3005587118 Bacteria 7794411
477 3005598827 3005594810 Bacteria 8716512
478 3005714455 3005710791 Bacteria 7622528
479 3005721969 3005718088 Bacteria 8283608
480 8006985612 8006984368 Bacteria 9651211
481 8019627652 8019619141 Bacteria 9218857
482 8056689922 8056689827 Bacteria 6712655
483 8056973036 8056967851 Bacteria 9038162
484 Ga0105247_10025858
485 Ga0055543_1007116
486 Ga0065165_1000394
487 Ga0070683_100080050
488 Ga0070670_100113336
489 Ga0070670_100225665
490 Ga0068869_100092274
491 Ga0070666_10202964
492 Ga0070680_100013961
493 Ga0070682_100038483
494 Ga0070689_100173752
495 Ga0070661_100095803
496 Ga0070668_100017987
497 Ga0070668_100037953
498 Ga0070668_100075853
499 Ga0070674_100226602
500 Ga0070709_10024229
501 Ga0070714_100459130
502 Ga0070713_100013716
503 Ga0070713_100061985
504 Ga0070710_10000373
505 Ga0070711_100001919
506 Ga0070663_100033270
507 Ga0070678_100097208
508 Ga0070678_100262234
509 Ga0070681_10027588
510 Ga0070681_10092034
511 Ga0068867_100446780
512 Ga0070679_100055646
513 Ga0070684_100011492
514 Ga0070684_100026633
515 Ga0068853_100083206
516 Ga0070695_100397085
517 Ga0070696_100083221
518 Ga0070693_100100431
519 Ga0070665_100006562
520 Ga0068855_100019333
521 Ga0070664_100193753
522 Ga0068857_100534941
523 Ga0068856_100292562
524 Ga0068852_100102733
525 Ga0068852_100148370
526 Ga0068858_100329824
527 Ga0068860_100000448
528 Ga0068862_100224100
529 Ga0081455_10012604
530 Ga0081455_10046590
531 Ga0081455_10056500
532 Ga0081540_1008488
533 Ga0081540_1015592
534 Ga0081540_1038456
535 Ga0081540_1072669
536 Ga0070717_10000850
537 Ga0070717_10537790
538 Ga0075365_10144368
539 Ga0075365_10190436
540 Ga0075368_10003571
541 Ga0075363_100001811
542 Ga0075364_10122602
543 Ga0075364_10220016
544 Ga0070715_10013554
545 Ga0070716_100065653
546 Ga0070712_100039211
547 Ga0070712_100048115
548 Ga0070712_100053242
549 Ga0075369_10015540
550 Ga0097621_100097907
551 Ga0097621_100458985
552 Ga0075370_10146497
553 Ga0075370_10152920
554 Ga0068871_100177197
555 Ga0068871_100315715
556 Ga0075434_100054590
557 Ga0105250_10031802
558 Ga0105240_10043793
559 Ga0105240_10056482
560 Ga0105240_10111725
561 Ga0105240_10143228
562 Ga0105240_10614251
563 Ga0111539_10370065
564 Ga0105245_10101550
565 Ga0105247_10027320
566 Ga0105247_10039989
567 Ga0105247_10128241
568 Ga0114129_10231426
569 Ga0114129_11076287
570 Ga0105243_10110606
571 Ga0105243_10168401
572 Ga0105241_10041218
573 Ga0105242_10079436
574 Ga0105242_10104112
575 Ga0105248_10052374
576 Ga0105248_10266541
577 Ga0105237_10166385
578 Ga0105237_10430387
579 Ga0105237_10557748
580 Ga0105237_10740396
581 Ga0105238_10017212
582 Ga0105238_10274394
583 Ga0105238_10352533
584 Ga0105239_10019887
585 Ga0105239_10180262
586 Ga0105239_10325356
587 Ga0105239_10367325
588 Ga0105246_10313556
589 Ga0157370_10036889
590 Ga0157369_10024893
591 Ga0157369_10040262
592 Ga0163162_10039835
593 Ga0163162_10135880
594 Ga0157372_10094335
595 Ga0157372_10099206
596 Ga0157375_10232256
597 Ga0157375_10695767
598 Ga0163163_10015963
599 Ga0163163_10044461
600 Ga0213876_10003255
601 Ga0213875_10002889
602 Ga0213875_10053105
603 Ga0213871_10000540
604 Ga0209148_1000616
605 Ga0209148_1008764
606 Ga0209233_1004877
607 Ga0209233_1009147
608 Ga0209455_1001649
609 Ga0209455_1006587
610 Ga0209455_1009657
611 Ga0209758_1002140
612 Ga0209758_1002422
613 Ga0207697_10068429
614 Ga0207696_1022016
615 Ga0207692_10000069
616 Ga0207710_10187291
617 Ga0207680_10168353
618 Ga0207647_10091168
619 Ga0207647_10135280
620 Ga0207699_10000289
621 Ga0207699_10144911
622 Ga0207699_10275299
623 Ga0207707_10001525
624 Ga0207707_10033868
625 Ga0207695_10031690
626 Ga0207695_10033817
627 Ga0207695_10145684
628 Ga0207671_10344346
629 Ga0207693_10058435
630 Ga0207693_10180098
631 Ga0207663_10006878
632 Ga0207660_10024100
633 Ga0207657_10112736
634 Ga0207652_10027003
635 Ga0207681_10121813
636 Ga0207700_10018176
637 Ga0207700_10026659
638 Ga0207664_10043317
639 Ga0207664_10177840
640 Ga0207644_10175097
641 Ga0207709_10131853
642 Ga0207709_10545647
643 Ga0207669_10387788
644 Ga0207704_10106404
645 Ga0207704_10160393
646 Ga0207665_10022818
647 Ga0207691_10155153
648 Ga0207711_10131140
649 Ga0207661_10000309
650 Ga0207667_10054896
651 Ga0207667_10254041
652 Ga0207668_10043930
653 Ga0207668_10348623
654 Ga0207640_10178508
655 Ga0207703_10121235
656 Ga0207703_10198468
657 Ga0207639_10065800
658 Ga0207639_10235349
659 Ga0207678_10080355
660 Ga0207678_10126450
661 Ga0207678_10128925
662 Ga0207708_10042574
663 Ga0207702_10000640
664 Ga0207702_10198846
665 Ga0207641_10878932
666 Ga0207648_10147946
667 Ga0207648_10345848
668 Ga0207683_10117183
669 Ga0207683_10135423
670 Ga0207698_10476847
671 Ga0207698_10528908
672 Ga0268266_10000857
673 Ga0268266_10005502
674 Ga0268266_10082679
675 Ga0268265_10145871
676 Ga0268265_10307730
677 Ga0268265_10433233
678 Ga0268264_10000162
679 Ga0268264_10433661
680 Ga0265334_10017492
681 Ga0265323_10015443
682 Ga0265336_10000612
683 Ga0307517_10000419
684 Ga0307515_10003270
685 Ga0265338_10015087
686 Ga0265324_10003556
687 Ga0307511_10078827
688 Ga0265330_10020144
689 Ga0265330_10059552
690 Ga0265325_10002010
691 Ga0265325_10004528
692 Ga0265331_10011276
693 Ga0307509_10033562
694 Ga0307509_10074944
695 Ga0265313_10017263
696 Ga0265314_10076235
697 Ga0265342_10018304
698 Ga0265342_10077506
699 Ga0307516_10013317
700 Ga0307516_10062369
701 Ga0307516_10076821
702 Ga0316583_10003650
703 Ga0307507_10074624
704 Ga0307510_10028819
705 Ga0307510_10068719
706 Ga0307510_10126985
707 Ga0315911_1000001
708 Ga0316215_1001630
709 Ga0373934_0000648
710 Ga0373953_0002709
711 Ga0373954_0000575
712 Ga0373956_0001979
713 Ga0373957_0000310
714 Ga0373955_0007504
715 Ga0373924_0030423
716 Ga0373931_0003125
717 Ga0373935_0211899
718 Ga0373927_0008987
719 Ga0373927_0013989
720 Ga0373927_0089298
721 Ga0373933_0010296
722 Ga0373947_0129933
723 Ga0373937_0009038
724 Ga0373925_0036709
725 Ga0373925_0195704
726 Ga0395900_0048131
727 Ga0395900_0086892
728 Ga0395898_0014068
729 Ga0395898_0059899
730 Ga0436364_0006957
731 Ga0436364_0075874
732 Ga0436364_0237576
733 Ga0436365_0515059
734 Ga0436365_1905262
735 Ga0436360_0483282
736 Ga0436360_1141543
737 Ga0436360_1254231
738 Ga0436361_0209966
739 Ga0436361_0614376
740 Ga0436363_0355660
741 Ga0436363_1443898
742 Ga0436362_0459409
743 Ga0436362_0970513
744 Ga0436362_1279475
745 Ga0466969_0021812
746 Ga0466966_0010150
747 Ga0466961_0000007
748 Ga0466963_0024984
749 Ga0466970_0161143
750 Ga0466957_0037825
751 Ga0466957_0067869
752 Ga0466967_0165195
753 Ga0495592_0013466
754 Ga0495603_0002860
755 Ga0495603_0172239
756 Ga0495629_0000274
757 Ga0495629_0028891
758 Ga0495641_0039373
759 Ga0495651_0018101
760 Ga0495651_0159381
761 Ga0495653_0009986
762 Ga0495582_0052810
763 Ga0495664_0429986
764 Ga0495606_0013201
765 Ga0495608_0004333
766 Ga0495628_0010786
767 Ga0495628_0247436
768 Ga0495630_0235283
769 Ga0495637_0154248
770 Ga0495648_0081766
771 Ga0495663_0089258
772 Ga0495654_0034042
773 Ga0495640_0043851
774 Ga0495586_0152939
775 Ga0495587_0009816
776 Ga0495598_0010628
777 Ga0495667_0003046
778 Ga0495634_0010881
779 Ga0495634_0064429
780 Ga0495635_0000937
781 Ga0495588_0107327
782 Ga0495657_0020312
783 Ga0495599_0011494
784 Ga0495623_0021371
785 Ga0495613_0009401
786 Ga0495613_0295511
787 Ga0495589_0176130
788 Ga0495600_0002390
789 Ga0495604_0003680
790 Ga0495674_0035539
791 Ga0495674_0078391
792 Ga0495672_0003162
793 Ga0495672_0099566
794 Ga0495680_0071225
795 Ga0495675_0004987
796 Ga0495677_0062051
797 Ga0495685_100990
798 Ga0495684_0000202
799 Ga0495686_0080625
800 Ga0495686_0255600
801 Ga0495593_0000326
802 Ga0495602_0096529
803 Ga0496101_0305267
804 Ga0496102_0080662
805 Ga0496104_0010344
806 Ga0496104_0024914
807 Ga0496105_0014215
808 Ga0496105_0051206
809 Ga0496106_0001757
810 Ga0496107_0014662
811 Ga0496107_0031033
812 Ga0496108_0120079
813 Ga0496108_0146660
814 Ga0496109_0037883
815 Ga0496109_0183578
816 Ga0496110_0103945
817 Ga0496110_0142486
818 Ga0496110_0239700
819 Ga0496112_0004527
820 Ga0496112_0027960
821 Ga0496112_0038009
822 Ga0496113_0049528
823 Ga0496113_0140870
824 Ga0496113_0154760
825 Ga0496113_0249478
826 Ga0496114_0142311
827 Ga0496115_0085158
828 Ga0496117_0024444
829 Ga0496118_0009808
830 Ga0496118_0090258
831 Ga0496118_0094688
832 Ga0496118_0203119
833 Ga0496119_0100369
834 Ga0496119_0163529
835 Ga0496120_0010137
836 Ga0496121_0000110
837 Ga0496121_0002579
838 Ga0496121_0052990
839 Ga0496121_0069966
840 Ga0496121_0130389
841 Ga0496121_0194123
842 Ga0496121_0417026
843 Ga0496124_0000779
844 Ga0496124_0349024
845 Ga0496125_0038683
846 Ga0496125_0100176
847 Ga0496125_0130468
848 Ga0496125_0131816
849 Ga0496126_0006731
850 Ga0496126_0007737
851 Ga0496126_0009002
852 Ga0496126_0011845
853 Ga0496126_0119314
854 Ga0496126_0160472
855 Ga0496126_0197368
856 Ga0496126_0251401
857 Ga0496126_0270457
858 Ga0496126_0351900
859 Ga0495678_100306
860 Ga0501034_0044485
861 Ga0501036_0001151
862 Ga0501036_0467911
863 Ga0501039_0068999
864 Ga0501043_0001730
865 Ga0501046_0020717
866 Ga0501047_0001306
867 Ga0501047_0029040
868 Ga0501047_0268691
869 Ga0501048_0002101
870 Ga0501069_0027432
871 Ga0501069_0064996
872 Ga0501070_0007916
873 Ga0501070_0019664
874 Ga0501070_0093143
875 Ga0501070_0122685
876 Ga0501072_0170424
877 Ga0501073_0084100
878 Ga0501074_0069746
879 Ga0501080_0097721
880 Ga0501083_0000166
881 Ga0501035_0001481
882 Ga0501035_0083025
883 Ga0501035_0144196
884 Ga0501044_0003316
885 Ga0501044_0112217
886 nmdc:mga03n38_12498_c1
887 nmdc:mga00v17_168923_c1
888 nmdc:mga0yw44_49418_c1
889 nmdc:mga0yw44_75625_c1
890 nmdc:mga0k408_146920_c1
891 nmdc:mga0k408_54573_c1
892 nmdc:mga06z11_50642_c1
893 nmdc:mga07m45_78468_c1
894 nmdc:mga05p37_136723_c1
895 nmdc:mga0n895_455904_c1
896 nmdc:mga0sz30_117513_c1
897 Ga0500635_0010137
898 Ga0500635_0011572
899 Ga0495595_0007110
900 Ga0495619_0002426
901 Ga0495619_0118754
902 Ga0500583_0009979
903 Ga0500651_0004378
904 Ga0500566_0012862
905 Ga0500572_000448
906 Ga0500595_036274
907 Ga0500595_073885
908 Ga0500559_0206364
909 Ga0500568_0133197
910 Ga0500573_0136743
911 Ga0500588_0034582
912 Ga0500590_068810
913 Ga0500590_114793
914 Ga0500590_146620
915 Ga0500603_000063
916 Ga0500634_0037468
917 Ga0500634_0174573
918 Ga0500638_000053
919 Ga0500638_079969
920 Ga0500636_0199473
921 Ga0500637_0000149
922 Ga0500645_019210
923 Ga0500552_019552
924 Ga0500596_002912
925 Ga0500661_000226
926 Ga0466962_0074162
927 2509151767
928 2513642047
929 2513654416
930 2513718073
931 2513859213
932 2513893500
933 2513915405
934 2517892719
935 2643757041
936 2793068277
937 2793084290
938 2844318669
939 2876813011
940 2879115349
941 2885376993
942 2903752055
943 2904696070
944 2906604502
945 2906643277
946 2906664355
947 2908743076
948 2908760703
949 2922368171
950 2922388357
951 2932798505
952 2932803197
953 2935633444
954 2935887972
955 2941510335
956 2941517928
957 2941525944
958 3005479843
959 3005593292
960 3005598827
961 3005714455
962 3005721969
963 8006985612
964 8019627652
965 8056689922
966 8056973036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

72

294

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hpq-assembly1.cif.gz_A crystal structure of cyclohexadienyl dehydratase from pseudomonas aeruginosa bound to acetate 0.9831 27 260
8cq6-assembly1.cif.gz_D bifunctional cyclohexadienyl dehydratase/chorismate mutase from duganella sacchari 0.9746 29 259
8cq6-assembly1.cif.gz_A bifunctional cyclohexadienyl dehydratase/chorismate mutase from duganella sacchari 0.9719 28 259
5hpq-assembly1.cif.gz_A crystal structure of cyclohexadienyl dehydratase from pseudomonas aeruginosa bound to acetate 0.9546 27 260
8cq3-assembly1.cif.gz_A bifunctional chorismate mutase/cyclohexadienyl dehydratase from aequoribacter fuscus 0.9521 29 258
ID Description Score Start End Superfamily
3kbrA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9682 27 256 3.40.190.10
3kbrA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9647 125 216 3.40.190.10
3kbrA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9541 125 216 3.40.190.10
3kbrA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9405 27 256 3.40.190.10
5hmtA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9321 27 258 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q9VYM1-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9959 24 260 GO:0016836
GO:0030313
AF-A0A1C3XGQ7-F1-model_v4 Cyclohexadienyl dehydratase 0.9901 16 260 GO:0016836
GO:0030313
AF-A0A4Q2RC02-F1-model_v4 Amino acid ABC transporter 0.9879 25 260 GO:0030313
AF-A0A1F9E0R2-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9876 24 260 GO:0016836
GO:0030313
AF-A0A132ML96-F1-model_v4 Cyclohexadienyl dehydratase (EC 4.2.1.51) 0.9875 24 260 GO:0004664
GO:0030313

Map