F452736

General Info

Members Datasets Scaffolds Average Seq Length
483 267 482 364

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100026978|Ga0068853_1000269781
Length 352
Sequence MSFNTFGRALRFTTWGESHGPAIGAVVDGCPPGLPLSEADIQPWLDRRKPGTSRFTTQRREPDAVRILSGVFEGRTTGTPISLIIENVDQRSKDYSDVAVTYRPGHADQVYDIKYGLRDYRGGGRSSARETAVIPGVSIRGWVSAIGGDAIDYANFDAAEIDKNPFFCPDALAAERWEKLVDEVRKAGSSVGAVVECEATGVPAGWGAPLYAKLDSELAAACMSINAVKGVEIGDGFEAAAARGEDNADAIRPGPAGSNSGPRILSNHAGGILGGISNGQPIRIRVAFKPTSSILIPIETVTRDGAAAEVITKGRHDPCVGIRGVPVVEAMMALVLADQYLLDRAQMGFQRR

Samples

Sample ID Description Type Environment
1 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
181 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
204 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 2.9
Rhizosphere 87.78
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10152448 3300003322 Bacteria 4873
2 rootH1_10294463 3300003323 Bacteria 3716
3 Ga0055526_1002136 3300003771 Bacteria 13561
4 Ga0070676_10135679 3300005328 Bacteria 1561
5 Ga0070690_100037027 3300005330 Bacteria 3071
6 Ga0070670_100007813 3300005331 Bacteria 9100
7 Ga0070670_100033048 3300005331 Bacteria 4457
8 Ga0070670_100205678 3300005331 Bacteria 1711
9 Ga0070677_10013192 3300005333 Bacteria 2884
10 Ga0070666_10016555 3300005335 Bacteria 4717
11 Ga0070666_10103969 3300005335 Bacteria 1960
12 Ga0070680_100008056 3300005336 Bacteria 8045
13 Ga0070680_100109042 3300005336 Bacteria 2303
14 Ga0070682_100069044 3300005337 Bacteria 2256
15 Ga0070682_100076479 3300005337 Bacteria 2155
16 Ga0068868_100000140 3300005338 Bacteria 46540
17 Ga0070689_100002094 3300005340 Bacteria 12961
18 Ga0070689_100019054 3300005340 Bacteria 5068
19 Ga0070687_100151182 3300005343 Bacteria 1363
20 Ga0070692_10044986 3300005345 Bacteria 2276
21 Ga0070668_100026731 3300005347 Bacteria 4381
22 Ga0070675_100001548 3300005354 Bacteria 17017
23 Ga0070675_100089650 3300005354 Bacteria 2575
24 Ga0070675_100132399 3300005354 Bacteria 2125
25 Ga0070671_100001122 3300005355 Bacteria 19877
26 Ga0070671_100011867 3300005355 Bacteria 7008
27 Ga0070674_100048451 3300005356 Bacteria 2916
28 Ga0070673_100017955 3300005364 Bacteria 5044
29 Ga0070673_100022997 3300005364 Bacteria 4548
30 Ga0070673_100123663 3300005364 Bacteria 2162
31 Ga0070688_100077016 3300005365 Bacteria 2148
32 Ga0070659_100371533 3300005366 Bacteria 1203
33 Ga0070667_100028019 3300005367 Bacteria 4688
34 Ga0070667_100235148 3300005367 Bacteria 1635
35 Ga0070713_100073393 3300005436 Bacteria 2896
36 Ga0070713_100140055 3300005436 Bacteria 2142
37 Ga0070713_100416090 3300005436 Bacteria 1258
38 Ga0070701_10000431 3300005438 Bacteria 14307
39 Ga0070701_10008839 3300005438 Bacteria 4379
40 Ga0070711_100095854 3300005439 Bacteria 2148
41 Ga0070705_100008220 3300005440 Bacteria 5163
42 Ga0070700_100007785 3300005441 Bacteria 5806
43 Ga0070700_100016204 3300005441 Bacteria 4243
44 Ga0070700_100171059 3300005441 Bacteria 1504
45 Ga0070694_100033883 3300005444 Bacteria 3365
46 Ga0070678_100008413 3300005456 Bacteria 6178
47 Ga0070678_100238027 3300005456 Bacteria 1521
48 Ga0070662_100068972 3300005457 Bacteria 2601
49 Ga0070681_10008879 3300005458 Bacteria 9877
50 Ga0070681_10012315 3300005458 Bacteria 8480
51 Ga0070681_10066387 3300005458 Bacteria 3576
52 Ga0070681_10102044 3300005458 Bacteria 2814
53 Ga0070685_10005916 3300005466 Bacteria 6224
54 Ga0070699_100190862 3300005518 Bacteria 1820
55 Ga0070679_100025542 3300005530 Bacteria 5798
56 Ga0070679_100052292 3300005530 Bacteria 4070
57 Ga0070679_100069610 3300005530 Bacteria 3509
58 Ga0070679_100229084 3300005530 Bacteria 1818
59 Ga0070684_100002177 3300005535 Bacteria 14467
60 Ga0070684_100002931 3300005535 Bacteria 12684
61 Ga0070684_100015580 3300005535 Bacteria 6197
62 Ga0068853_100026978 3300005539 Bacteria 4826
63 Ga0070686_100006322 3300005544 Bacteria 6578
64 Ga0070686_100010638 3300005544 Bacteria 5198
65 Ga0070696_100008903 3300005546 Bacteria 6719
66 Ga0070696_100167295 3300005546 Bacteria 1623
67 Ga0070693_100138969 3300005547 Bacteria 1527
68 Ga0070665_100001536 3300005548 Bacteria 26669
69 Ga0070665_100003668 3300005548 Bacteria 16269
70 Ga0070665_100018086 3300005548 Bacteria 7075
71 Ga0070665_100027915 3300005548 Bacteria 5684
72 Ga0070665_100030433 3300005548 Bacteria 5431
73 Ga0070665_100046103 3300005548 Bacteria 4378
74 Ga0070665_100057574 3300005548 Bacteria 3896
75 Ga0068855_100000562 3300005563 Bacteria 45523
76 Ga0068855_100014452 3300005563 Bacteria 9505
77 Ga0068855_100029840 3300005563 Bacteria 6521
78 Ga0068855_100217633 3300005563 Bacteria 2143
79 Ga0068855_100269160 3300005563 Bacteria 1895
80 Ga0070664_100005398 3300005564 Bacteria 10261
81 Ga0070664_100044591 3300005564 Bacteria 3744
82 Ga0070664_100110445 3300005564 Bacteria 2399
83 Ga0068857_100011898 3300005577 Bacteria 7569
84 Ga0068857_100066094 3300005577 Bacteria 3217
85 Ga0068857_100222080 3300005577 Bacteria 1726
86 Ga0068856_100133570 3300005614 Bacteria 2487
87 Ga0070702_100003887 3300005615 Bacteria 6766
88 Ga0070702_100006036 3300005615 Bacteria 5703
89 Ga0068852_100068566 3300005616 Bacteria 3105
90 Ga0068852_100114550 3300005616 Bacteria 2457
91 Ga0068859_100000172 3300005617 Bacteria 62990
92 Ga0068859_100006664 3300005617 Bacteria 11727
93 Ga0068859_100019018 3300005617 Bacteria 6898
94 Ga0068859_100021669 3300005617 Bacteria 6449
95 Ga0068864_100003919 3300005618 Bacteria 12262
96 Ga0068864_100009799 3300005618 Bacteria 7900
97 Ga0068861_100004302 3300005719 Bacteria 9551
98 Ga0068861_100058786 3300005719 Bacteria 2941
99 Ga0068861_100066944 3300005719 Bacteria 2770
100 Ga0068861_100072452 3300005719 Bacteria 2673
101 Ga0068861_100080463 3300005719 Bacteria 2549
102 Ga0068851_10024936 3300005834 Bacteria 2930
103 Ga0068870_10003132 3300005840 Bacteria 6977
104 Ga0068863_100001117 3300005841 Bacteria 26783
105 Ga0068863_100002743 3300005841 Bacteria 17423
106 Ga0068863_100006049 3300005841 Bacteria 11875
107 Ga0068863_100048271 3300005841 Bacteria 4037
108 Ga0068863_100233297 3300005841 Bacteria 1775
109 Ga0068858_100000406 3300005842 Bacteria 44839
110 Ga0068858_100014718 3300005842 Bacteria 7363
111 Ga0068860_100011976 3300005843 Bacteria 8545
112 Ga0068860_100017378 3300005843 Bacteria 7009
113 Ga0068860_100053595 3300005843 Bacteria 3835
114 Ga0068860_100054216 3300005843 Bacteria 3811
115 Ga0068862_100008766 3300005844 Bacteria 8377
116 Ga0068862_100015840 3300005844 Bacteria 6263
117 Ga0068862_100021077 3300005844 Bacteria 5448
118 Ga0068862_100123669 3300005844 Bacteria 2282
119 Ga0068862_100210762 3300005844 Bacteria 1756
120 Ga0081455_10000656 3300005937 Bacteria 44828
121 Ga0081539_10000058 3300005985 Bacteria 256212
122 Ga0070717_10022516 3300006028 Bacteria 4980
123 Ga0068871_100095317 3300006358 Bacteria 2485
124 Ga0075428_100006380 3300006844 Bacteria 13126
125 Ga0075428_100023951 3300006844 Bacteria 6754
126 Ga0075430_100003451 3300006846 Bacteria 13224
127 Ga0075430_100069306 3300006846 Bacteria 2958
128 Ga0075431_100000091 3300006847 Bacteria 55827
129 Ga0075431_100035584 3300006847 Bacteria 5127
130 Ga0075433_10023945 3300006852 Bacteria 5148
131 Ga0075429_100003083 3300006880 Bacteria 14137
132 Ga0097620_100000172 3300006931 Bacteria 62990
133 Ga0097620_100006664 3300006931 Bacteria 11727
134 Ga0097620_100019017 3300006931 Bacteria 6898
135 Ga0097620_100021667 3300006931 Bacteria 6449
136 Ga0099794_10014179 3300007265 Bacteria 3486
137 Ga0099795_10000004 3300007788 Bacteria 108633
138 Ga0099795_10000472 3300007788 Bacteria 7484
139 Ga0105250_10000024 3300009092 Bacteria 218115
140 Ga0105250_10025793 3300009092 Bacteria 2368
141 Ga0105240_10002675 3300009093 Bacteria 28365
142 Ga0105240_10014372 3300009093 Bacteria 10810
143 Ga0105240_10016668 3300009093 Bacteria 9939
144 Ga0105240_10027153 3300009093 Bacteria 7500
145 Ga0105240_10032315 3300009093 Bacteria 6777
146 Ga0105240_10078077 3300009093 Bacteria 4078
147 Ga0105240_10110960 3300009093 Bacteria 3319
148 Ga0105240_10113671 3300009093 Bacteria 3271
149 Ga0105240_10179020 3300009093 Bacteria 2504
150 Ga0105240_10197594 3300009093 Bacteria 2359
151 Ga0111539_10006586 3300009094 Bacteria 14967
152 Ga0111539_10009504 3300009094 Bacteria 12272
153 Ga0111539_10036816 3300009094 Bacteria 5913
154 Ga0111539_10185713 3300009094 Bacteria 2428
155 Ga0105245_10002513 3300009098 Bacteria 16535
156 Ga0105245_10103683 3300009098 Bacteria 2636
157 Ga0105247_10000270 3300009101 Bacteria 48109
158 Ga0105247_10000853 3300009101 Bacteria 23079
159 Ga0114129_10000484 3300009147 Bacteria 48049
160 Ga0105243_10109301 3300009148 Bacteria 2309
161 Ga0105242_10186983 3300009176 Bacteria 1831
162 Ga0105248_10010700 3300009177 Bacteria 10124
163 Ga0105248_10051218 3300009177 Bacteria 4633
164 Ga0105248_10051726 3300009177 Bacteria 4609
165 Ga0105237_10013224 3300009545 Bacteria 8657
166 Ga0105237_10148222 3300009545 Bacteria 2342
167 Ga0105238_10002575 3300009551 Bacteria 18089
168 Ga0105238_10058962 3300009551 Bacteria 3847
169 Ga0105238_10074190 3300009551 Bacteria 3395
170 Ga0105238_10109079 3300009551 Bacteria 2749
171 Ga0105238_10112209 3300009551 Bacteria 2706
172 Ga0105238_10128243 3300009551 Bacteria 2515
173 Ga0105238_10151016 3300009551 Bacteria 2298
174 Ga0105249_10004587 3300009553 Bacteria 11939
175 Ga0105249_10036356 3300009553 Bacteria 4466
176 Ga0105249_10077304 3300009553 Bacteria 3086
177 Ga0105249_10221883 3300009553 Bacteria 1860
178 Ga0099796_10000006 3300010159 Bacteria 66689
179 Ga0105239_10020008 3300010375 Bacteria 7387
180 Ga0105246_10000648 3300011119 Bacteria 19460
181 Ga0157370_10001137 3300013104 Bacteria 33243
182 Ga0157370_10090146 3300013104 Bacteria 2879
183 Ga0157369_10008496 3300013105 Bacteria 11774
184 Ga0157369_10089349 3300013105 Bacteria 3289
185 Ga0157369_10286583 3300013105 Bacteria 1715
186 Ga0157374_10000998 3300013296 Bacteria 24538
187 Ga0157374_10333684 3300013296 Bacteria 1504
188 Ga0157374_10384637 3300013296 Bacteria 1398
189 Ga0157378_10142943 3300013297 Bacteria 2223
190 Ga0163162_10005163 3300013306 Bacteria 12587
191 Ga0163162_10091871 3300013306 Bacteria 3118
192 Ga0163162_10154988 3300013306 Bacteria 2410
193 Ga0163162_10229671 3300013306 Bacteria 1986
194 Ga0157372_10075950 3300013307 Bacteria 3793
195 Ga0163163_10001153 3300014325 Bacteria 22447
196 Ga0163163_10001836 3300014325 Bacteria 17917
197 Ga0163163_10050406 3300014325 Bacteria 4100
198 Ga0157380_10014279 3300014326 Bacteria 5810
199 Ga0157380_10161361 3300014326 Bacteria 1949
200 Ga0157377_10083404 3300014745 Bacteria 1873
201 Ga0157379_10001338 3300014968 Bacteria 20123
202 Ga0157379_10259285 3300014968 Bacteria 1579
203 Ga0157376_10014933 3300014969 Bacteria 5852
204 Ga0163161_10188205 3300017792 Bacteria 1586
205 Ga0213874_10007226 3300021377 Bacteria 2657
206 Ga0209564_1002644 3300025295 Bacteria 13687
207 Ga0207697_10006704 3300025315 Bacteria 5187
208 Ga0207696_1000383 3300025711 Bacteria 42719
209 Ga0207710_10000280 3300025900 Bacteria 41457
210 Ga0207710_10004906 3300025900 Bacteria 5802
211 Ga0207680_10010839 3300025903 Bacteria 4578
212 Ga0207685_10028339 3300025905 Bacteria 1971
213 Ga0207645_10071162 3300025907 Bacteria 2226
214 Ga0207643_10030597 3300025908 Bacteria 2997
215 Ga0207707_10000390 3300025912 Bacteria 45829
216 Ga0207707_10004165 3300025912 Bacteria 12811
217 Ga0207707_10029813 3300025912 Bacteria 4772
218 Ga0207707_10123116 3300025912 Bacteria 2268
219 Ga0207707_10148105 3300025912 Bacteria 2052
220 Ga0207707_10235277 3300025912 Bacteria 1593
221 Ga0207695_10003577 3300025913 Bacteria 21747
222 Ga0207695_10014705 3300025913 Bacteria 9255
223 Ga0207695_10031342 3300025913 Bacteria 5833
224 Ga0207695_10089230 3300025913 Bacteria 3101
225 Ga0207695_10096021 3300025913 Bacteria 2966
226 Ga0207695_10121021 3300025913 Bacteria 2585
227 Ga0207695_10347469 3300025913 Bacteria 1371
228 Ga0207671_10034467 3300025914 Bacteria 3760
229 Ga0207663_10042186 3300025916 Bacteria 2786
230 Ga0207660_10001712 3300025917 Bacteria 14711
231 Ga0207660_10077755 3300025917 Bacteria 2430
232 Ga0207652_10000362 3300025921 Bacteria 47186
233 Ga0207652_10019306 3300025921 Bacteria 5605
234 Ga0207652_10133026 3300025921 Bacteria 2219
235 Ga0207694_10096857 3300025924 Bacteria 2334
236 Ga0207650_10039896 3300025925 Bacteria 3433
237 Ga0207650_10080408 3300025925 Bacteria 2471
238 Ga0207650_10082141 3300025925 Bacteria 2445
239 Ga0207659_10013690 3300025926 Bacteria 5207
240 Ga0207687_10117132 3300025927 Bacteria 1987
241 Ga0207700_10051576 3300025928 Bacteria 3071
242 Ga0207700_10063142 3300025928 Bacteria 2816
243 Ga0207700_10084112 3300025928 Bacteria 2493
244 Ga0207664_10023877 3300025929 Bacteria 4588
245 Ga0207644_10012327 3300025931 Bacteria 5676
246 Ga0207706_10068696 3300025933 Bacteria 3117
247 Ga0207706_10104843 3300025933 Bacteria 2487
248 Ga0207706_10319639 3300025933 Bacteria 1351
249 Ga0207686_10051576 3300025934 Bacteria 2563
250 Ga0207709_10031426 3300025935 Bacteria 3101
251 Ga0207704_10204089 3300025938 Bacteria 1449
252 Ga0207691_10030738 3300025940 Bacteria 5016
253 Ga0207691_10162222 3300025940 Bacteria 1960
254 Ga0207711_10002654 3300025941 Bacteria 15811
255 Ga0207689_10009867 3300025942 Bacteria 8230
256 Ga0207689_10093467 3300025942 Bacteria 2470
257 Ga0207661_10032138 3300025944 Bacteria 4063
258 Ga0207679_10026155 3300025945 Bacteria 4023
259 Ga0207667_10001313 3300025949 Bacteria 31189
260 Ga0207667_10002859 3300025949 Bacteria 21419
261 Ga0207667_10077183 3300025949 Bacteria 3456
262 Ga0207651_10030241 3300025960 Bacteria 3445
263 Ga0207651_10122240 3300025960 Bacteria 1976
264 Ga0207712_10007380 3300025961 Bacteria 6943
265 Ga0207658_10060404 3300025986 Bacteria 2828
266 Ga0207658_10139566 3300025986 Bacteria 1959
267 Ga0207658_10196027 3300025986 Bacteria 1682
268 Ga0207703_10001744 3300026035 Bacteria 19465
269 Ga0207703_10002741 3300026035 Bacteria 15088
270 Ga0207703_10006124 3300026035 Bacteria 9627
271 Ga0207639_10020011 3300026041 Bacteria 4785
272 Ga0207678_10014042 3300026067 Bacteria 7042
273 Ga0207708_10007427 3300026075 Bacteria 8100
274 Ga0207708_10014840 3300026075 Bacteria 5830
275 Ga0207708_10042145 3300026075 Bacteria 3480
276 Ga0207702_10334909 3300026078 Bacteria 1444
277 Ga0207641_10000258 3300026088 Bacteria 67414
278 Ga0207641_10013307 3300026088 Bacteria 6748
279 Ga0207641_10014296 3300026088 Bacteria 6504
280 Ga0207641_10152323 3300026088 Bacteria 2095
281 Ga0207648_10002079 3300026089 Bacteria 21809
282 Ga0207648_10020677 3300026089 Bacteria 5925
283 Ga0207648_10044858 3300026089 Bacteria 3879
284 Ga0207676_10001802 3300026095 Bacteria 15704
285 Ga0207674_10022134 3300026116 Bacteria 6832
286 Ga0207675_100004588 3300026118 Bacteria 13316
287 Ga0207675_100008159 3300026118 Bacteria 9870
288 Ga0207675_100019481 3300026118 Bacteria 6331
289 Ga0207675_100025052 3300026118 Bacteria 5552
290 Ga0207675_100025506 3300026118 Bacteria 5502
291 Ga0207675_100026436 3300026118 Bacteria 5403
292 Ga0207675_100027649 3300026118 Bacteria 5282
293 Ga0207675_100034285 3300026118 Bacteria 4732
294 Ga0207675_100054852 3300026118 Bacteria 3718
295 Ga0207675_100253513 3300026118 Bacteria 1704
296 Ga0207675_100412543 3300026118 Bacteria 1333
297 Ga0207683_10009122 3300026121 Bacteria 8454
298 Ga0207683_10069943 3300026121 Bacteria 3100
299 Ga0207698_10094547 3300026142 Bacteria 2458
300 Ga0209179_1000092 3300027512 Bacteria 13096
301 Ga0207428_10011062 3300027907 Bacteria 8017
302 Ga0268266_10000434 3300028379 Bacteria 62882
303 Ga0268266_10002255 3300028379 Bacteria 20985
304 Ga0268266_10012211 3300028379 Bacteria 7431
305 Ga0268266_10012944 3300028379 Bacteria 7194
306 Ga0268266_10027825 3300028379 Bacteria 4807
307 Ga0268266_10074833 3300028379 Bacteria 2941
308 Ga0268266_10082500 3300028379 Bacteria 2805
309 Ga0268265_10008129 3300028380 Bacteria 7090
310 Ga0268265_10009404 3300028380 Bacteria 6603
311 Ga0268265_10017561 3300028380 Bacteria 4940
312 Ga0268265_10022078 3300028380 Bacteria 4468
313 Ga0268265_10025057 3300028380 Bacteria 4229
314 Ga0268265_10028878 3300028380 Bacteria 3976
315 Ga0268264_10000034 3300028381 Bacteria 401894
316 Ga0268264_10004901 3300028381 Bacteria 11338
317 Ga0268264_10076468 3300028381 Bacteria 2848
318 Ga0268264_10126559 3300028381 Bacteria 2259
319 Ga0265334_10000008 3300028573 Bacteria 200602
320 Ga0265318_10001166 3300028577 Bacteria 16279
321 Ga0307515_10007927 3300028794 Bacteria 20856
322 Ga0307515_10161418 3300028794 Bacteria 2283
323 Ga0265338_10015718 3300028800 Bacteria 8293
324 Ga0307511_10000260 3300030521 Bacteria 54540
325 Ga0307511_10002901 3300030521 Bacteria 17765
326 Ga0265330_10012426 3300031235 Bacteria 3981
327 Ga0265332_10001420 3300031238 Bacteria 13467
328 Ga0265328_10028428 3300031239 Bacteria 2091
329 Ga0265320_10005651 3300031240 Bacteria 7983
330 Ga0265329_10014612 3300031242 Bacteria 2767
331 Ga0265340_10006960 3300031247 Bacteria 6173
332 Ga0265340_10107668 3300031247 Bacteria 1291
333 Ga0265339_10030212 3300031249 Bacteria 3069
334 Ga0265331_10003187 3300031250 Bacteria 10708
335 Ga0265331_10006528 3300031250 Bacteria 6882
336 Ga0265316_10002874 3300031344 Bacteria 17631
337 Ga0307509_10000230 3300031507 Bacteria 90240
338 Ga0307509_10024157 3300031507 Bacteria 6811
339 Ga0307408_100093129 3300031548 Bacteria 2279
340 Ga0265313_10000807 3300031595 Bacteria 31618
341 Ga0265313_10004882 3300031595 Bacteria 10056
342 Ga0307508_10029327 3300031616 Bacteria 4975
343 Ga0316579_10004221 3300031691 Bacteria 5686
344 Ga0265314_10017406 3300031711 Bacteria 5643
345 Ga0265342_10009330 3300031712 Bacteria 6926
346 Ga0316576_10136120 3300031727 Bacteria 1848
347 Ga0316578_10014334 3300031728 Bacteria 4231
348 Ga0307405_10106237 3300031731 Bacteria 1893
349 Ga0316577_10012878 3300031733 Bacteria 4564
350 Ga0316577_10078132 3300031733 Bacteria 1848
351 Ga0307413_10004222 3300031824 Bacteria 6210
352 Ga0307413_10010556 3300031824 Bacteria 4489
353 Ga0307410_10030143 3300031852 Bacteria 3463
354 Ga0307410_10043195 3300031852 Bacteria 2985
355 Ga0307406_10016081 3300031901 Bacteria 4340
356 Ga0307406_10101213 3300031901 Bacteria 1963
357 Ga0307409_100004229 3300031995 Bacteria 8011
358 Ga0307416_100105812 3300032002 Bacteria 2464
359 Ga0307416_100134069 3300032002 Bacteria 2236
360 Ga0307416_100266983 3300032002 Bacteria 1677
361 Ga0307414_10200731 3300032004 Bacteria 1622
362 Ga0307411_10001359 3300032005 Bacteria 9903
363 Ga0307411_10104919 3300032005 Bacteria 2008
364 Ga0307411_10324473 3300032005 Bacteria 1245
365 Ga0316585_10016273 3300032137 Bacteria 2238
366 Ga0316580_10003296 3300032139 Bacteria 4563
367 Ga0307510_10000005 3300033180 Bacteria 633068
368 Ga0373936_0016056 3300035113 Bacteria 2875
369 Ga0373954_0061443 3300035118 Bacteria 1773
370 Ga0373956_0065269 3300035119 Bacteria 1654
371 Ga0373955_0033267 3300035172 Bacteria 2714
372 Ga0316574_0006599 3300035398 Bacteria 6285
373 Ga0316574_0019580 3300035398 Bacteria 3995
374 Ga0373931_0005264 3300035691 Bacteria 5966
375 Ga0373935_0235768 3300035692 Bacteria 1276
376 Ga0373927_0000010 3300035695 Bacteria 183458
377 Ga0373933_0205173 3300035724 Bacteria 1262
378 Ga0373937_0068023 3300036401 Bacteria 3283
379 Ga0316582_0085700 3300036647 Bacteria 2065
380 Ga0316582_0244873 3300036647 Bacteria 1228
381 Ga0316584_0003233 3300036712 Bacteria 10547
382 Ga0316584_0011108 3300036712 Bacteria 6316
383 Ga0316584_0062143 3300036712 Bacteria 2797
384 Ga0316584_0098676 3300036712 Bacteria 2187
385 Ga0373925_0097611 3300037068 Bacteria 2254
386 Ga0395900_0054518 3300037418 Bacteria 4117
387 Ga0395898_0067073 3300037466 Bacteria 3475
388 Ga0395905_0189782 3300037471 Bacteria 1928
389 Ga0436365_1487483 3300039437 Bacteria 2245
390 Ga0436360_0504587 3300039438 Bacteria 11481
391 Ga0436361_0364378 3300039447 Bacteria 2038
392 Ga0436363_0652634 3300039450 Bacteria 6791
393 Ga0439457_010026 3300042014 Bacteria 2190
394 Ga0450894_006762 3300042131 Bacteria 1479
395 Ga0451577_0011772 3300042876 Bacteria 8256
396 Ga0466969_0033435 3300044656 Bacteria 2610
397 Ga0466965_0026401 3300044683 Bacteria 2816
398 Ga0466966_0041338 3300044684 Bacteria 2962
399 Ga0466966_0050326 3300044684 Bacteria 2651
400 Ga0453684_0081490 3300044712 Bacteria 4036
401 Ga0466968_0052703 3300044735 Bacteria 1741
402 Ga0466970_0030194 3300044765 Bacteria 2857
403 Ga0451576_0177235 3300045051 Bacteria 2226
404 Ga0466958_0111262 3300045836 Bacteria 1710
405 Ga0495590_0016665 3300046457 Bacteria 2652
406 Ga0495638_0009998 3300046460 Bacteria 6617
407 Ga0495638_0014722 3300046460 Bacteria 5275
408 Ga0495638_0150318 3300046460 Bacteria 1351
409 Ga0495580_0027648 3300046472 Bacteria 4126
410 Ga0495585_0069334 3300046492 Bacteria 1925
411 Ga0495616_0008652 3300046513 Bacteria 6010
412 Ga0495654_0106461 3300046530 Bacteria 1284
413 Ga0495621_0000098 3300046539 Bacteria 17925
414 Ga0495625_0019771 3300046660 Bacteria 5213
415 Ga0495625_0058678 3300046660 Bacteria 2734
416 Ga0495647_0001846 3300046681 Bacteria 6566
417 Ga0495658_0017921 3300046683 Bacteria 3671
418 Ga0495658_0137161 3300046683 Bacteria 1494
419 Ga0495669_0081239 3300046684 Bacteria 1488
420 Ga0495613_0171208 3300046689 Bacteria 1541
421 Ga0495649_0047264 3300046694 Bacteria 2341
422 Ga0495604_0085790 3300047317 Bacteria 2349
423 Ga0495687_027749 3300047443 Bacteria 2645
424 Ga0496102_0013374 3300048905 Bacteria 7109
425 Ga0496102_0021184 3300048905 Bacteria 5748
426 Ga0496104_0012231 3300048907 Bacteria 7713
427 Ga0496107_0305262 3300048910 Bacteria 1185
428 Ga0496108_0075209 3300048911 Bacteria 2853
429 Ga0496108_0149409 3300048911 Bacteria 2016
430 Ga0496109_0038396 3300048912 Bacteria 4329
431 Ga0496110_0038902 3300048913 Bacteria 4141
432 Ga0496112_0001440 3300048915 Bacteria 18264
433 Ga0496112_0063813 3300048915 Bacteria 3634
434 Ga0496112_0370644 3300048915 Bacteria 1373
435 Ga0496114_0059651 3300048917 Bacteria 3188
436 Ga0496115_0002736 3300048918 Bacteria 12659
437 Ga0496115_0074101 3300048918 Bacteria 2764
438 Ga0496116_0008520 3300048919 Bacteria 8888
439 Ga0496117_0000012 3300048920 Bacteria 608530
440 Ga0496118_0000003 3300048921 Bacteria 773148
441 Ga0496119_0075283 3300048922 Bacteria 1962
442 Ga0496120_0000611 3300048923 Bacteria 54277
443 Ga0496120_0021414 3300048923 Bacteria 4087
444 Ga0496121_0005660 3300048924 Bacteria 15896
445 Ga0496121_0038301 3300048924 Bacteria 4249
446 Ga0496121_0053909 3300048924 Bacteria 3365
447 Ga0496124_0085428 3300048927 Bacteria 2586
448 Ga0496125_0003375 3300048928 Bacteria 19450
449 Ga0496125_0011969 3300048928 Bacteria 8639
450 Ga0496125_0030028 3300048928 Bacteria 4869
451 Ga0496126_0024765 3300048929 Bacteria 5787
452 Ga0496126_0199165 3300048929 Bacteria 1692
453 Ga0501031_0192745 3300049568 Bacteria 1331
454 Ga0501034_0434343 3300049571 Bacteria 1232
455 Ga0501036_0190276 3300049572 Bacteria 1727
456 Ga0501071_0053139 3300049587 Bacteria 2921
457 Ga0501072_0026504 3300049588 Bacteria 4520
458 nmdc:mga05p37_11639_c1 3300050507 Bacteria 10485
459 nmdc:mga09592_1590_c1 3300050508 Bacteria 18289
460 nmdc:mga06r32_2483_c1 3300050510 Bacteria 16504
461 nmdc:mga06r32_29_c1 3300050510 Bacteria 85620
462 nmdc:mga06r32_64140_c1 3300050510 Bacteria 3542
463 nmdc:mga08y16_12268_c1 3300050511 Bacteria 9007
464 nmdc:mga08y16_14469_c1 3300050511 Bacteria 8300
465 nmdc:mga08y16_180331_c1 3300050511 Bacteria 2193
466 nmdc:mga08y16_29298_c1 3300050511 Bacteria 5800
467 Ga0495601_0013225 3300053077 Bacteria 4963
468 Ga0500643_027914 3300053087 Bacteria 1749
469 Ga0500583_0011949 3300053092 Bacteria 3294
470 Ga0500583_0041494 3300053092 Bacteria 2090
471 Ga0500583_0045293 3300053092 Bacteria 2019
472 Ga0500641_0011417 3300053096 Bacteria 3224
473 Ga0500591_037993 3300053115 Bacteria 2303
474 Ga0500658_0010552 3300053134 Bacteria 3408
475 Ga0500588_0015997 3300053146 Bacteria 1932
476 Ga0500616_0000425 3300053153 Bacteria 56265
477 Ga0500622_0003929 3300053156 Bacteria 9610
478 Ga0500622_0006901 3300053156 Bacteria 6514
479 Ga0500624_000026 3300053157 Bacteria 109681
480 Ga0500636_0056130 3300053177 Bacteria 2307
481 Ga0500637_0007451 3300053178 Bacteria 5473
482 Ga0500637_0089805 3300053178 Bacteria 1778

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10014179 Ga0099794_100141794 323
2 3300007788 Ga0099795_10000472 Ga0099795_100004723 323
3 3300035398 Ga0316574_0019580 Ga0316574_0019580_454_1455 330
4 3300036712 Ga0316584_0062143 Ga0316584_0062143_1576_2577 330
5 3300042131 Ga0450894_006762 Ga0450894_006762_45_1043 330
6 3300048910 Ga0496107_0305262 Ga0496107_0305262_26_1027 330
7 3300046472 Ga0495580_0027648 Ga0495580_0027648_1212_2222 336
8 3300005331 Ga0070670_100205678 Ga0070670_1002056781 341
9 3300046689 Ga0495613_0171208 Ga0495613_0171208_459_1496 341
10 3300005539 Ga0068853_100026978 Ga0068853_1000269781 342
11 3300005577 Ga0068857_100066094 Ga0068857_1000660941 342
12 3300005614 Ga0068856_100133570 Ga0068856_1001335702 342
13 3300005834 Ga0068851_10024936 Ga0068851_100249364 342
14 3300026041 Ga0207639_10020011 Ga0207639_100200116 342
15 3300026075 Ga0207708_10042145 Ga0207708_100421452 342
16 3300026078 Ga0207702_10334909 Ga0207702_103349091 342
17 3300053087 Ga0500643_027914 Ga0500643_027914_66_1145 345
18 3300053157 Ga0500624_000026 Ga0500624_000026_25593_26672 345
19 3300053177 Ga0500636_0056130 Ga0500636_0056130_729_1808 345
20 3300013306 Ga0163162_10091871 Ga0163162_100918713 346
21 3300046694 Ga0495649_0047264 Ga0495649_0047264_1224_2300 346
22 3300048911 Ga0496108_0149409 Ga0496108_0149409_592_1668 347
23 3300005458 Ga0070681_10066387 Ga0070681_100663871 348
24 3300005535 Ga0070684_100015580 Ga0070684_1000155804 348
25 3300005548 Ga0070665_100003668 Ga0070665_10000366810 348
26 3300013296 Ga0157374_10333684 Ga0157374_103336842 348
27 3300025912 Ga0207707_10235277 Ga0207707_102352772 348
28 3300025917 Ga0207660_10077755 Ga0207660_100777552 348
29 3300025924 Ga0207694_10096857 Ga0207694_100968573 348
30 3300025944 Ga0207661_10032138 Ga0207661_100321383 348
31 3300028379 Ga0268266_10000434 Ga0268266_1000043425 348
32 3300031250 Ga0265331_10003187 Ga0265331_100031879 348
33 3300032002 Ga0307416_100266983 Ga0307416_1002669832 348
34 3300039437 Ga0436365_1487483 Ga0436365_1487483_254_1366 348
35 3300048929 Ga0496126_0199165 Ga0496126_0199165_497_1594 348
36 3300005331 Ga0070670_100033048 Ga0070670_1000330482 349
37 3300005564 Ga0070664_100044591 Ga0070664_1000445911 349
38 3300014325 Ga0163163_10050406 Ga0163163_100504061 349
39 3300014745 Ga0157377_10083404 Ga0157377_100834042 349
40 3300025925 Ga0207650_10080408 Ga0207650_100804081 349
41 3300030521 Ga0307511_10002901 Ga0307511_100029016 349
42 3300035113 Ga0373936_0016056 Ga0373936_0016056_588_1691 349
43 3300037471 Ga0395905_0189782 Ga0395905_0189782_98_1198 349
44 3300044712 Ga0453684_0081490 Ga0453684_0081490_1487_2584 349
45 3300047443 Ga0495687_027749 Ga0495687_027749_259_1371 349
46 3300053115 Ga0500591_037993 Ga0500591_037993_995_2098 349
47 3300005548 Ga0070665_100018086 Ga0070665_1000180862 350
48 3300021377 Ga0213874_10007226 Ga0213874_100072262 350
49 3300028379 Ga0268266_10012211 Ga0268266_100122112 350
50 3300039450 Ga0436363_0652634 Ga0436363_0652634_3509_4609 350
51 3300053092 Ga0500583_0011949 Ga0500583_0011949_1814_2923 350
52 3300053153 Ga0500616_0000425 Ga0500616_0000425_20904_22013 350
53 3300005337 Ga0070682_100069044 Ga0070682_1000690442 351
54 3300005719 Ga0068861_100004302 Ga0068861_1000043028 351
55 3300009093 Ga0105240_10078077 Ga0105240_100780775 351
56 3300026118 Ga0207675_100004588 Ga0207675_1000045883 351
57 3300031507 Ga0307509_10000230 Ga0307509_1000023011 351
58 3300031507 Ga0307509_10024157 Ga0307509_100241572 351
59 3300046460 Ga0495638_0009998 Ga0495638_0009998_3599_4702 351
60 3300046460 Ga0495638_0014722 Ga0495638_0014722_581_1690 351
61 3300046660 Ga0495625_0019771 Ga0495625_0019771_1061_2170 351
62 3300009551 Ga0105238_10151016 Ga0105238_101510161 352
63 3300025938 Ga0207704_10204089 Ga0207704_102040892 352
64 3300048923 Ga0496120_0000611 Ga0496120_0000611_51961_53061 352
65 3300005436 Ga0070713_100416090 Ga0070713_1004160901 354
66 3300009545 Ga0105237_10148222 Ga0105237_101482222 354
67 3300025928 Ga0207700_10063142 Ga0207700_100631421 354
68 3300025934 Ga0207686_10051576 Ga0207686_100515763 354
69 3300025942 Ga0207689_10093467 Ga0207689_100934672 354
70 3300026118 Ga0207675_100054852 Ga0207675_1000548523 354
71 3300046460 Ga0495638_0150318 Ga0495638_0150318_221_1324 354
72 3300046660 Ga0495625_0058678 Ga0495625_0058678_1062_2162 354
73 3300005333 Ga0070677_10013192 Ga0070677_100131922 355
74 3300005354 Ga0070675_100132399 Ga0070675_1001323992 355
75 3300005456 Ga0070678_100238027 Ga0070678_1002380271 355
76 3300005719 Ga0068861_100058786 Ga0068861_1000587863 355
77 3300005840 Ga0068870_10003132 Ga0068870_100031329 355
78 3300005844 Ga0068862_100123669 Ga0068862_1001236692 355
79 3300009093 Ga0105240_10016668 Ga0105240_100166686 355
80 3300025315 Ga0207697_10006704 Ga0207697_100067041 355
81 3300025908 Ga0207643_10030597 Ga0207643_100305972 355
82 3300025933 Ga0207706_10319639 Ga0207706_103196391 355
83 3300025940 Ga0207691_10162222 Ga0207691_101622222 355
84 3300026121 Ga0207683_10069943 Ga0207683_100699432 355
85 3300028380 Ga0268265_10028878 Ga0268265_100288782 355
86 3300036401 Ga0373937_0068023 Ga0373937_0068023_1637_2806 355
87 3300049572 Ga0501036_0190276 Ga0501036_0190276_193_1272 355
88 3300028794 Ga0307515_10007927 Ga0307515_100079273 356
89 3300053092 Ga0500583_0041494 Ga0500583_0041494_957_2027 356
90 3300037418 Ga0395900_0054518 Ga0395900_0054518_2740_3822 357
91 3300048927 Ga0496124_0085428 Ga0496124_0085428_110_1195 358
92 iso_pu_bacteria 2928503688 2928510092 359
93 3300005336 Ga0070680_100008056 Ga0070680_1000080564 361
94 3300005336 Ga0070680_100109042 Ga0070680_1001090422 361
95 3300005458 Ga0070681_10008879 Ga0070681_100088795 361
96 3300005458 Ga0070681_10012315 Ga0070681_100123152 361
97 3300005530 Ga0070679_100069610 Ga0070679_1000696103 361
98 3300005563 Ga0068855_100014452 Ga0068855_1000144526 361
99 3300005563 Ga0068855_100217633 Ga0068855_1002176332 361
100 3300009093 Ga0105240_10027153 Ga0105240_100271539 361
101 3300009093 Ga0105240_10179020 Ga0105240_101790202 361
102 3300009551 Ga0105238_10002575 Ga0105238_100025756 361
103 3300009551 Ga0105238_10112209 Ga0105238_101122092 361
104 3300013104 Ga0157370_10001137 Ga0157370_1000113716 361
105 3300013104 Ga0157370_10090146 Ga0157370_100901462 361
106 3300013105 Ga0157369_10008496 Ga0157369_1000849611 361
107 3300025912 Ga0207707_10000390 Ga0207707_1000039021 361
108 3300025912 Ga0207707_10004165 Ga0207707_1000416510 361
109 3300025912 Ga0207707_10029813 Ga0207707_100298133 361
110 3300025913 Ga0207695_10014705 Ga0207695_100147057 361
111 3300025917 Ga0207660_10001712 Ga0207660_1000171211 361
112 3300025921 Ga0207652_10000362 Ga0207652_1000036222 361
113 3300025949 Ga0207667_10002859 Ga0207667_100028596 361
114 3300025949 Ga0207667_10077183 Ga0207667_100771834 361
115 3300031247 Ga0265340_10006960 Ga0265340_100069602 361
116 3300046530 Ga0495654_0106461 Ga0495654_0106461_10_1116 361
117 3300046539 Ga0495621_0000098 Ga0495621_0000098_5238_6344 361
118 3300046681 Ga0495647_0001846 Ga0495647_0001846_4681_5787 361
119 3300046683 Ga0495658_0017921 Ga0495658_0017921_1555_2661 361
120 3300047317 Ga0495604_0085790 Ga0495604_0085790_648_1754 361
121 3300042014 Ga0439457_010026 Ga0439457_010026_502_1596 362
122 3300003322 rootL2_10152448 rootL2_101524486 363
123 3300003323 rootH1_10294463 rootH1_102944631 363
124 3300003771 Ga0055526_1002136 Ga0055526_10021363 363
125 3300005328 Ga0070676_10135679 Ga0070676_101356792 363
126 3300005330 Ga0070690_100037027 Ga0070690_1000370273 363
127 3300005331 Ga0070670_100007813 Ga0070670_1000078134 363
128 3300005335 Ga0070666_10016555 Ga0070666_100165554 363
129 3300005335 Ga0070666_10103969 Ga0070666_101039692 363
130 3300005337 Ga0070682_100076479 Ga0070682_1000764791 363
131 3300005338 Ga0068868_100000140 Ga0068868_1000001408 363
132 3300005340 Ga0070689_100002094 Ga0070689_1000020946 363
133 3300005340 Ga0070689_100019054 Ga0070689_1000190543 363
134 3300005343 Ga0070687_100151182 Ga0070687_1001511821 363
135 3300005345 Ga0070692_10044986 Ga0070692_100449861 363
136 3300005347 Ga0070668_100026731 Ga0070668_1000267312 363
137 3300005354 Ga0070675_100001548 Ga0070675_10000154816 363
138 3300005354 Ga0070675_100089650 Ga0070675_1000896502 363
139 3300005355 Ga0070671_100001122 Ga0070671_10000112211 363
140 3300005355 Ga0070671_100011867 Ga0070671_1000118675 363
141 3300005356 Ga0070674_100048451 Ga0070674_1000484512 363
142 3300005364 Ga0070673_100017955 Ga0070673_1000179552 363
143 3300005364 Ga0070673_100022997 Ga0070673_1000229972 363
144 3300005364 Ga0070673_100123663 Ga0070673_1001236632 363
145 3300005365 Ga0070688_100077016 Ga0070688_1000770162 363
146 3300005366 Ga0070659_100371533 Ga0070659_1003715331 363
147 3300005367 Ga0070667_100028019 Ga0070667_1000280192 363
148 3300005367 Ga0070667_100235148 Ga0070667_1002351482 363
149 3300005436 Ga0070713_100073393 Ga0070713_1000733932 363
150 3300005436 Ga0070713_100140055 Ga0070713_1001400552 363
151 3300005438 Ga0070701_10000431 Ga0070701_100004312 363
152 3300005438 Ga0070701_10008839 Ga0070701_100088393 363
153 3300005439 Ga0070711_100095854 Ga0070711_1000958542 363
154 3300005440 Ga0070705_100008220 Ga0070705_1000082204 363
155 3300005441 Ga0070700_100007785 Ga0070700_1000077852 363
156 3300005441 Ga0070700_100016204 Ga0070700_1000162042 363
157 3300005441 Ga0070700_100171059 Ga0070700_1001710592 363
158 3300005444 Ga0070694_100033883 Ga0070694_1000338831 363
159 3300005456 Ga0070678_100008413 Ga0070678_1000084135 363
160 3300005457 Ga0070662_100068972 Ga0070662_1000689722 363
161 3300005458 Ga0070681_10102044 Ga0070681_101020442 363
162 3300005466 Ga0070685_10005916 Ga0070685_100059162 363
163 3300005518 Ga0070699_100190862 Ga0070699_1001908622 363
164 3300005530 Ga0070679_100025542 Ga0070679_1000255424 363
165 3300005530 Ga0070679_100052292 Ga0070679_1000522922 363
166 3300005530 Ga0070679_100229084 Ga0070679_1002290842 363
167 3300005535 Ga0070684_100002177 Ga0070684_10000217710 363
168 3300005535 Ga0070684_100002931 Ga0070684_1000029314 363
169 3300005544 Ga0070686_100006322 Ga0070686_1000063222 363
170 3300005544 Ga0070686_100010638 Ga0070686_1000106384 363
171 3300005546 Ga0070696_100008903 Ga0070696_1000089034 363
172 3300005546 Ga0070696_100167295 Ga0070696_1001672952 363
173 3300005547 Ga0070693_100138969 Ga0070693_1001389692 363
174 3300005548 Ga0070665_100001536 Ga0070665_10000153611 363
175 3300005548 Ga0070665_100027915 Ga0070665_1000279152 363
176 3300005548 Ga0070665_100030433 Ga0070665_1000304336 363
177 3300005548 Ga0070665_100046103 Ga0070665_1000461033 363
178 3300005548 Ga0070665_100057574 Ga0070665_1000575742 363
179 3300005563 Ga0068855_100000562 Ga0068855_10000056221 363
180 3300005563 Ga0068855_100029840 Ga0068855_1000298401 363
181 3300005563 Ga0068855_100269160 Ga0068855_1002691602 363
182 3300005564 Ga0070664_100005398 Ga0070664_1000053986 363
183 3300005564 Ga0070664_100110445 Ga0070664_1001104452 363
184 3300005577 Ga0068857_100011898 Ga0068857_1000118982 363
185 3300005577 Ga0068857_100222080 Ga0068857_1002220802 363
186 3300005615 Ga0070702_100003887 Ga0070702_1000038872 363
187 3300005615 Ga0070702_100006036 Ga0070702_1000060361 363
188 3300005616 Ga0068852_100068566 Ga0068852_1000685662 363
189 3300005616 Ga0068852_100114550 Ga0068852_1001145502 363
190 3300005617 Ga0068859_100000172 Ga0068859_10000017253 363
191 3300005617 Ga0068859_100006664 Ga0068859_1000066649 363
192 3300005617 Ga0068859_100019018 Ga0068859_1000190184 363
193 3300005617 Ga0068859_100021669 Ga0068859_1000216692 363
194 3300005618 Ga0068864_100003919 Ga0068864_1000039199 363
195 3300005618 Ga0068864_100009799 Ga0068864_1000097992 363
196 3300005719 Ga0068861_100066944 Ga0068861_1000669441 363
197 3300005719 Ga0068861_100072452 Ga0068861_1000724522 363
198 3300005719 Ga0068861_100080463 Ga0068861_1000804632 363
199 3300005841 Ga0068863_100001117 Ga0068863_10000111717 363
200 3300005841 Ga0068863_100002743 Ga0068863_1000027435 363
201 3300005841 Ga0068863_100006049 Ga0068863_1000060493 363
202 3300005841 Ga0068863_100048271 Ga0068863_1000482712 363
203 3300005841 Ga0068863_100233297 Ga0068863_1002332971 363
204 3300005842 Ga0068858_100000406 Ga0068858_10000040636 363
205 3300005842 Ga0068858_100014718 Ga0068858_1000147185 363
206 3300005843 Ga0068860_100011976 Ga0068860_1000119762 363
207 3300005843 Ga0068860_100017378 Ga0068860_1000173783 363
208 3300005843 Ga0068860_100053595 Ga0068860_1000535955 363
209 3300005843 Ga0068860_100054216 Ga0068860_1000542162 363
210 3300005844 Ga0068862_100008766 Ga0068862_1000087664 363
211 3300005844 Ga0068862_100015840 Ga0068862_1000158402 363
212 3300005844 Ga0068862_100021077 Ga0068862_1000210773 363
213 3300005844 Ga0068862_100210762 Ga0068862_1002107622 363
214 3300005937 Ga0081455_10000656 Ga0081455_1000065643 363
215 3300005985 Ga0081539_10000058 Ga0081539_1000005858 363
216 3300006028 Ga0070717_10022516 Ga0070717_100225166 363
217 3300006358 Ga0068871_100095317 Ga0068871_1000953173 363
218 3300006844 Ga0075428_100006380 Ga0075428_1000063803 363
219 3300006844 Ga0075428_100023951 Ga0075428_1000239514 363
220 3300006846 Ga0075430_100003451 Ga0075430_10000345111 363
221 3300006846 Ga0075430_100069306 Ga0075430_1000693062 363
222 3300006847 Ga0075431_100000091 Ga0075431_1000000912 363
223 3300006847 Ga0075431_100035584 Ga0075431_1000355842 363
224 3300006852 Ga0075433_10023945 Ga0075433_100239452 363
225 3300006880 Ga0075429_100003083 Ga0075429_10000308311 363
226 3300006931 Ga0097620_100000172 Ga0097620_10000017253 363
227 3300006931 Ga0097620_100006664 Ga0097620_1000066649 363
228 3300006931 Ga0097620_100019017 Ga0097620_1000190172 363
229 3300006931 Ga0097620_100021667 Ga0097620_1000216675 363
230 3300007788 Ga0099795_10000004 Ga0099795_100000045 363
231 3300009092 Ga0105250_10000024 Ga0105250_10000024174 363
232 3300009092 Ga0105250_10025793 Ga0105250_100257932 363
233 3300009093 Ga0105240_10002675 Ga0105240_1000267525 363
234 3300009093 Ga0105240_10014372 Ga0105240_100143729 363
235 3300009093 Ga0105240_10032315 Ga0105240_100323157 363
236 3300009093 Ga0105240_10110960 Ga0105240_101109602 363
237 3300009093 Ga0105240_10113671 Ga0105240_101136712 363
238 3300009093 Ga0105240_10197594 Ga0105240_101975942 363
239 3300009094 Ga0111539_10006586 Ga0111539_100065869 363
240 3300009094 Ga0111539_10009504 Ga0111539_100095042 363
241 3300009094 Ga0111539_10036816 Ga0111539_100368166 363
242 3300009094 Ga0111539_10185713 Ga0111539_101857132 363
243 3300009098 Ga0105245_10002513 Ga0105245_100025139 363
244 3300009098 Ga0105245_10103683 Ga0105245_101036832 363
245 3300009101 Ga0105247_10000270 Ga0105247_1000027014 363
246 3300009101 Ga0105247_10000853 Ga0105247_1000085319 363
247 3300009147 Ga0114129_10000484 Ga0114129_1000048439 363
248 3300009148 Ga0105243_10109301 Ga0105243_101093011 363
249 3300009176 Ga0105242_10186983 Ga0105242_101869831 363
250 3300009177 Ga0105248_10010700 Ga0105248_100107009 363
251 3300009177 Ga0105248_10051218 Ga0105248_100512183 363
252 3300009177 Ga0105248_10051726 Ga0105248_100517262 363
253 3300009545 Ga0105237_10013224 Ga0105237_100132246 363
254 3300009551 Ga0105238_10058962 Ga0105238_100589622 363
255 3300009551 Ga0105238_10074190 Ga0105238_100741902 363
256 3300009551 Ga0105238_10109079 Ga0105238_101090791 363
257 3300009551 Ga0105238_10128243 Ga0105238_101282432 363
258 3300009553 Ga0105249_10004587 Ga0105249_100045871 363
259 3300009553 Ga0105249_10036356 Ga0105249_100363565 363
260 3300009553 Ga0105249_10077304 Ga0105249_100773042 363
261 3300009553 Ga0105249_10221883 Ga0105249_102218832 363
262 3300010159 Ga0099796_10000006 Ga0099796_1000000656 363
263 3300010375 Ga0105239_10020008 Ga0105239_100200082 363
264 3300011119 Ga0105246_10000648 Ga0105246_1000064817 363
265 3300013105 Ga0157369_10089349 Ga0157369_100893493 363
266 3300013105 Ga0157369_10286583 Ga0157369_102865832 363
267 3300013296 Ga0157374_10000998 Ga0157374_1000099817 363
268 3300013296 Ga0157374_10384637 Ga0157374_103846372 363
269 3300013297 Ga0157378_10142943 Ga0157378_101429432 363
270 3300013306 Ga0163162_10005163 Ga0163162_100051632 363
271 3300013306 Ga0163162_10154988 Ga0163162_101549882 363
272 3300013306 Ga0163162_10229671 Ga0163162_102296712 363
273 3300013307 Ga0157372_10075950 Ga0157372_100759502 363
274 3300014325 Ga0163163_10001153 Ga0163163_1000115310 363
275 3300014325 Ga0163163_10001836 Ga0163163_100018364 363
276 3300014326 Ga0157380_10014279 Ga0157380_100142795 363
277 3300014326 Ga0157380_10161361 Ga0157380_101613611 363
278 3300014968 Ga0157379_10001338 Ga0157379_100013382 363
279 3300014968 Ga0157379_10259285 Ga0157379_102592852 363
280 3300014969 Ga0157376_10014933 Ga0157376_100149332 363
281 3300017792 Ga0163161_10188205 Ga0163161_101882052 363
282 3300025295 Ga0209564_1002644 Ga0209564_10026443 363
283 3300025711 Ga0207696_1000383 Ga0207696_10003837 363
284 3300025900 Ga0207710_10000280 Ga0207710_1000028032 363
285 3300025900 Ga0207710_10004906 Ga0207710_100049062 363
286 3300025903 Ga0207680_10010839 Ga0207680_100108392 363
287 3300025905 Ga0207685_10028339 Ga0207685_100283392 363
288 3300025907 Ga0207645_10071162 Ga0207645_100711622 363
289 3300025912 Ga0207707_10123116 Ga0207707_101231162 363
290 3300025912 Ga0207707_10148105 Ga0207707_101481052 363
291 3300025913 Ga0207695_10003577 Ga0207695_100035773 363
292 3300025913 Ga0207695_10031342 Ga0207695_100313424 363
293 3300025913 Ga0207695_10089230 Ga0207695_100892303 363
294 3300025913 Ga0207695_10096021 Ga0207695_100960213 363
295 3300025913 Ga0207695_10121021 Ga0207695_101210211 363
296 3300025913 Ga0207695_10347469 Ga0207695_103474692 363
297 3300025914 Ga0207671_10034467 Ga0207671_100344671 363
298 3300025916 Ga0207663_10042186 Ga0207663_100421863 363
299 3300025921 Ga0207652_10019306 Ga0207652_100193062 363
300 3300025921 Ga0207652_10133026 Ga0207652_101330262 363
301 3300025925 Ga0207650_10039896 Ga0207650_100398962 363
302 3300025925 Ga0207650_10082141 Ga0207650_100821411 363
303 3300025926 Ga0207659_10013690 Ga0207659_100136903 363
304 3300025927 Ga0207687_10117132 Ga0207687_101171321 363
305 3300025928 Ga0207700_10051576 Ga0207700_100515762 363
306 3300025928 Ga0207700_10084112 Ga0207700_100841122 363
307 3300025929 Ga0207664_10023877 Ga0207664_100238776 363
308 3300025931 Ga0207644_10012327 Ga0207644_100123272 363
309 3300025933 Ga0207706_10068696 Ga0207706_100686962 363
310 3300025933 Ga0207706_10104843 Ga0207706_101048433 363
311 3300025935 Ga0207709_10031426 Ga0207709_100314262 363
312 3300025940 Ga0207691_10030738 Ga0207691_100307382 363
313 3300025941 Ga0207711_10002654 Ga0207711_100026548 363
314 3300025942 Ga0207689_10009867 Ga0207689_100098672 363
315 3300025945 Ga0207679_10026155 Ga0207679_100261552 363
316 3300025949 Ga0207667_10001313 Ga0207667_100013133 363
317 3300025960 Ga0207651_10030241 Ga0207651_100302413 363
318 3300025960 Ga0207651_10122240 Ga0207651_101222402 363
319 3300025961 Ga0207712_10007380 Ga0207712_100073802 363
320 3300025986 Ga0207658_10060404 Ga0207658_100604041 363
321 3300025986 Ga0207658_10139566 Ga0207658_101395662 363
322 3300025986 Ga0207658_10196027 Ga0207658_101960272 363
323 3300026035 Ga0207703_10001744 Ga0207703_1000174412 363
324 3300026035 Ga0207703_10002741 Ga0207703_1000274114 363
325 3300026035 Ga0207703_10006124 Ga0207703_100061247 363
326 3300026067 Ga0207678_10014042 Ga0207678_100140422 363
327 3300026075 Ga0207708_10007427 Ga0207708_100074272 363
328 3300026075 Ga0207708_10014840 Ga0207708_100148402 363
329 3300026088 Ga0207641_10000258 Ga0207641_1000025824 363
330 3300026088 Ga0207641_10013307 Ga0207641_100133076 363
331 3300026088 Ga0207641_10014296 Ga0207641_100142962 363
332 3300026088 Ga0207641_10152323 Ga0207641_101523231 363
333 3300026089 Ga0207648_10002079 Ga0207648_1000207921 363
334 3300026089 Ga0207648_10020677 Ga0207648_100206772 363
335 3300026089 Ga0207648_10044858 Ga0207648_100448582 363
336 3300026095 Ga0207676_10001802 Ga0207676_100018028 363
337 3300026116 Ga0207674_10022134 Ga0207674_100221343 363
338 3300026118 Ga0207675_100008159 Ga0207675_1000081596 363
339 3300026118 Ga0207675_100019481 Ga0207675_1000194817 363
340 3300026118 Ga0207675_100025052 Ga0207675_1000250527 363
341 3300026118 Ga0207675_100025506 Ga0207675_1000255062 363
342 3300026118 Ga0207675_100026436 Ga0207675_1000264366 363
343 3300026118 Ga0207675_100027649 Ga0207675_1000276494 363
344 3300026118 Ga0207675_100034285 Ga0207675_1000342852 363
345 3300026118 Ga0207675_100253513 Ga0207675_1002535132 363
346 3300026118 Ga0207675_100412543 Ga0207675_1004125432 363
347 3300026121 Ga0207683_10009122 Ga0207683_100091225 363
348 3300026142 Ga0207698_10094547 Ga0207698_100945472 363
349 3300027512 Ga0209179_1000092 Ga0209179_10000923 363
350 3300027907 Ga0207428_10011062 Ga0207428_100110622 363
351 3300028379 Ga0268266_10002255 Ga0268266_1000225516 363
352 3300028379 Ga0268266_10012944 Ga0268266_100129445 363
353 3300028379 Ga0268266_10027825 Ga0268266_100278252 363
354 3300028379 Ga0268266_10074833 Ga0268266_100748332 363
355 3300028379 Ga0268266_10082500 Ga0268266_100825001 363
356 3300028380 Ga0268265_10008129 Ga0268265_100081297 363
357 3300028380 Ga0268265_10009404 Ga0268265_100094042 363
358 3300028380 Ga0268265_10017561 Ga0268265_100175615 363
359 3300028380 Ga0268265_10022078 Ga0268265_100220784 363
360 3300028380 Ga0268265_10025057 Ga0268265_100250572 363
361 3300028381 Ga0268264_10000034 Ga0268264_10000034145 363
362 3300028381 Ga0268264_10004901 Ga0268264_100049017 363
363 3300028381 Ga0268264_10076468 Ga0268264_100764682 363
364 3300028381 Ga0268264_10126559 Ga0268264_101265592 363
365 3300028573 Ga0265334_10000008 Ga0265334_1000000820 363
366 3300028577 Ga0265318_10001166 Ga0265318_1000116612 363
367 3300028794 Ga0307515_10161418 Ga0307515_101614182 363
368 3300028800 Ga0265338_10015718 Ga0265338_100157183 363
369 3300030521 Ga0307511_10000260 Ga0307511_100002604 363
370 3300031235 Ga0265330_10012426 Ga0265330_100124265 363
371 3300031238 Ga0265332_10001420 Ga0265332_100014206 363
372 3300031239 Ga0265328_10028428 Ga0265328_100284282 363
373 3300031240 Ga0265320_10005651 Ga0265320_100056518 363
374 3300031242 Ga0265329_10014612 Ga0265329_100146122 363
375 3300031247 Ga0265340_10107668 Ga0265340_101076681 363
376 3300031249 Ga0265339_10030212 Ga0265339_100302124 363
377 3300031250 Ga0265331_10006528 Ga0265331_100065288 363
378 3300031344 Ga0265316_10002874 Ga0265316_100028747 363
379 3300031548 Ga0307408_100093129 Ga0307408_1000931292 363
380 3300031595 Ga0265313_10000807 Ga0265313_1000080711 363
381 3300031595 Ga0265313_10004882 Ga0265313_100048828 363
382 3300031616 Ga0307508_10029327 Ga0307508_100293274 363
383 3300031691 Ga0316579_10004221 Ga0316579_100042213 363
384 3300031711 Ga0265314_10017406 Ga0265314_100174063 363
385 3300031712 Ga0265342_10009330 Ga0265342_100093304 363
386 3300031727 Ga0316576_10136120 Ga0316576_101361202 363
387 3300031728 Ga0316578_10014334 Ga0316578_100143343 363
388 3300031731 Ga0307405_10106237 Ga0307405_101062372 363
389 3300031733 Ga0316577_10012878 Ga0316577_100128783 363
390 3300031733 Ga0316577_10078132 Ga0316577_100781321 363
391 3300031824 Ga0307413_10004222 Ga0307413_100042222 363
392 3300031824 Ga0307413_10010556 Ga0307413_100105561 363
393 3300031852 Ga0307410_10030143 Ga0307410_100301433 363
394 3300031852 Ga0307410_10043195 Ga0307410_100431952 363
395 3300031901 Ga0307406_10016081 Ga0307406_100160815 363
396 3300031901 Ga0307406_10101213 Ga0307406_101012132 363
397 3300031995 Ga0307409_100004229 Ga0307409_1000042293 363
398 3300032002 Ga0307416_100105812 Ga0307416_1001058122 363
399 3300032002 Ga0307416_100134069 Ga0307416_1001340692 363
400 3300032004 Ga0307414_10200731 Ga0307414_102007312 363
401 3300032005 Ga0307411_10001359 Ga0307411_100013592 363
402 3300032005 Ga0307411_10104919 Ga0307411_101049191 363
403 3300032005 Ga0307411_10324473 Ga0307411_103244732 363
404 3300032137 Ga0316585_10016273 Ga0316585_100162732 363
405 3300032139 Ga0316580_10003296 Ga0316580_100032964 363
406 3300033180 Ga0307510_10000005 Ga0307510_10000005306 363
407 3300035118 Ga0373954_0061443 Ga0373954_0061443_478_1581 363
408 3300035119 Ga0373956_0065269 Ga0373956_0065269_85_1182 363
409 3300035172 Ga0373955_0033267 Ga0373955_0033267_1358_2551 363
410 3300035398 Ga0316574_0006599 Ga0316574_0006599_5122_6219 363
411 3300035691 Ga0373931_0005264 Ga0373931_0005264_4845_5948 363
412 3300035692 Ga0373935_0235768 Ga0373935_0235768_119_1216 363
413 3300035695 Ga0373927_0000010 Ga0373927_0000010_103114_104220 363
414 3300035724 Ga0373933_0205173 Ga0373933_0205173_133_1236 363
415 3300036647 Ga0316582_0085700 Ga0316582_0085700_714_1814 363
416 3300036647 Ga0316582_0244873 Ga0316582_0244873_79_1176 363
417 3300036712 Ga0316584_0003233 Ga0316584_0003233_4668_5762 363
418 3300036712 Ga0316584_0011108 Ga0316584_0011108_4007_5104 363
419 3300036712 Ga0316584_0098676 Ga0316584_0098676_770_1870 363
420 3300037068 Ga0373925_0097611 Ga0373925_0097611_137_1237 363
421 3300037466 Ga0395898_0067073 Ga0395898_0067073_591_1697 363
422 3300039438 Ga0436360_0504587 Ga0436360_0504587_185_1285 363
423 3300039447 Ga0436361_0364378 Ga0436361_0364378_780_1880 363
424 3300042876 Ga0451577_0011772 Ga0451577_0011772_2770_3873 363
425 3300044656 Ga0466969_0033435 Ga0466969_0033435_701_1798 363
426 3300044683 Ga0466965_0026401 Ga0466965_0026401_167_1273 363
427 3300044684 Ga0466966_0041338 Ga0466966_0041338_1736_2833 363
428 3300044684 Ga0466966_0050326 Ga0466966_0050326_292_1386 363
429 3300044735 Ga0466968_0052703 Ga0466968_0052703_419_1516 363
430 3300044765 Ga0466970_0030194 Ga0466970_0030194_348_1445 363
431 3300045051 Ga0451576_0177235 Ga0451576_0177235_44_1147 363
432 3300045836 Ga0466958_0111262 Ga0466958_0111262_601_1695 363
433 3300046457 Ga0495590_0016665 Ga0495590_0016665_780_1883 363
434 3300046492 Ga0495585_0069334 Ga0495585_0069334_83_1186 363
435 3300046513 Ga0495616_0008652 Ga0495616_0008652_1674_2777 363
436 3300046683 Ga0495658_0137161 Ga0495658_0137161_35_1132 363
437 3300046684 Ga0495669_0081239 Ga0495669_0081239_151_1248 363
438 3300048905 Ga0496102_0013374 Ga0496102_0013374_4272_5372 363
439 3300048905 Ga0496102_0021184 Ga0496102_0021184_3978_5078 363
440 3300048907 Ga0496104_0012231 Ga0496104_0012231_4920_6017 363
441 3300048911 Ga0496108_0075209 Ga0496108_0075209_281_1384 363
442 3300048912 Ga0496109_0038396 Ga0496109_0038396_1716_2819 363
443 3300048913 Ga0496110_0038902 Ga0496110_0038902_1374_2477 363
444 3300048915 Ga0496112_0001440 Ga0496112_0001440_2523_3626 363
445 3300048915 Ga0496112_0063813 Ga0496112_0063813_23_1120 363
446 3300048915 Ga0496112_0370644 Ga0496112_0370644_117_1217 363
447 3300048917 Ga0496114_0059651 Ga0496114_0059651_1200_2303 363
448 3300048918 Ga0496115_0002736 Ga0496115_0002736_6524_7621 363
449 3300048918 Ga0496115_0074101 Ga0496115_0074101_1299_2402 363
450 3300048919 Ga0496116_0008520 Ga0496116_0008520_4660_5760 363
451 3300048920 Ga0496117_0000012 Ga0496117_0000012_285519_286619 363
452 3300048921 Ga0496118_0000003 Ga0496118_0000003_689911_691011 363
453 3300048922 Ga0496119_0075283 Ga0496119_0075283_598_1698 363
454 3300048923 Ga0496120_0021414 Ga0496120_0021414_1877_2977 363
455 3300048924 Ga0496121_0005660 Ga0496121_0005660_6675_7775 363
456 3300048924 Ga0496121_0038301 Ga0496121_0038301_559_1668 363
457 3300048924 Ga0496121_0053909 Ga0496121_0053909_1467_2582 363
458 3300048928 Ga0496125_0003375 Ga0496125_0003375_6399_7514 363
459 3300048928 Ga0496125_0011969 Ga0496125_0011969_5007_6107 363
460 3300048928 Ga0496125_0030028 Ga0496125_0030028_610_1710 363
461 3300048929 Ga0496126_0024765 Ga0496126_0024765_1956_3056 363
462 3300049568 Ga0501031_0192745 Ga0501031_0192745_186_1283 363
463 3300049571 Ga0501034_0434343 Ga0501034_0434343_87_1187 363
464 3300049587 Ga0501071_0053139 Ga0501071_0053139_1613_2773 363
465 3300049588 Ga0501072_0026504 Ga0501072_0026504_2685_3845 363
466 3300050507 nmdc:mga05p37_11639_c1 nmdc:mga05p37_11639_c1_6905_8002 363
467 3300050508 nmdc:mga09592_1590_c1 nmdc:mga09592_1590_c1_9805_10902 363
468 3300050510 nmdc:mga06r32_2483_c1 nmdc:mga06r32_2483_c1_7759_8856 363
469 3300050510 nmdc:mga06r32_29_c1 nmdc:mga06r32_29_c1_66802_67899 363
470 3300050510 nmdc:mga06r32_64140_c1 nmdc:mga06r32_64140_c1_1958_3055 363
471 3300050511 nmdc:mga08y16_12268_c1 nmdc:mga08y16_12268_c1_1172_2269 363
472 3300050511 nmdc:mga08y16_14469_c1 nmdc:mga08y16_14469_c1_5390_6493 363
473 3300050511 nmdc:mga08y16_180331_c1 nmdc:mga08y16_180331_c1_726_1829 363
474 3300050511 nmdc:mga08y16_29298_c1 nmdc:mga08y16_29298_c1_3602_4699 363
475 3300053077 Ga0495601_0013225 Ga0495601_0013225_520_1623 363
476 3300053092 Ga0500583_0045293 Ga0500583_0045293_881_1978 363
477 3300053096 Ga0500641_0011417 Ga0500641_0011417_1384_2478 363
478 3300053134 Ga0500658_0010552 Ga0500658_0010552_499_1593 363
479 3300053146 Ga0500588_0015997 Ga0500588_0015997_486_1589 363
480 3300053156 Ga0500622_0003929 Ga0500622_0003929_8012_9118 363
481 3300053156 Ga0500622_0006901 Ga0500622_0006901_4315_5421 363
482 3300053178 Ga0500637_0007451 Ga0500637_0007451_1035_2132 363
483 3300053178 Ga0500637_0089805 Ga0500637_0089805_203_1303 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01264

Chorismate_synt

Chorismate synthase

10

341

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9724 1 350
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9686 1 350
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9679 1 350
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9641 1 350
5wuy-assembly1.cif.gz_B crystal structure of chorismate synthase from acinetobacter baumannii at 2.50a resolution 0.944 1 351
ID Description Score Start End Superfamily
af_P12008_1_360_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9731 1 359 3.60.150.10
5z9aA00 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9724 1 350 3.60.150.10
5z9aA00 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9686 1 350 3.60.150.10
af_P12008_1_360_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9678 1 359 3.60.150.10
af_Q58575_11_372_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9427 10 346 3.60.150.10
ID Description Score Start End GO Terms
AF-A0A351A1A1-F1-model_v4 chorismate synthase (EC 4.2.3.5) 0.9845 122 297 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A3M3I9W9-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.984 133 360 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A3M5ZMD9-F1-model_v4 deleted 0.9831 133 360
AF-A0A3M4VIF7-F1-model_v4 deleted 0.9826 133 360
AF-A0A6D2G5Y5-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.9805 195 325 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181

Feature Viewer

pLDDT pTM Quality
86.46 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map