F452736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 483 | 267 | 482 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100026978|Ga0068853_1000269781 |
| Length | 352 |
| Sequence | MSFNTFGRALRFTTWGESHGPAIGAVVDGCPPGLPLSEADIQPWLDRRKPGTSRFTTQRREPDAVRILSGVFEGRTTGTPISLIIENVDQRSKDYSDVAVTYRPGHADQVYDIKYGLRDYRGGGRSSARETAVIPGVSIRGWVSAIGGDAIDYANFDAAEIDKNPFFCPDALAAERWEKLVDEVRKAGSSVGAVVECEATGVPAGWGAPLYAKLDSELAAACMSINAVKGVEIGDGFEAAAARGEDNADAIRPGPAGSNSGPRILSNHAGGILGGISNGQPIRIRVAFKPTSSILIPIETVTRDGAAAEVITKGRHDPCVGIRGVPVVEAMMALVLADQYLLDRAQMGFQRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 170 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 181 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 194 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 204 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 245 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 258 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 259 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 260 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 261 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 263 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 265 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 266 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.52 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 87.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10152448 | 3300003322 | Bacteria | 4873 |
| 2 | rootH1_10294463 | 3300003323 | Bacteria | 3716 |
| 3 | Ga0055526_1002136 | 3300003771 | Bacteria | 13561 |
| 4 | Ga0070676_10135679 | 3300005328 | Bacteria | 1561 |
| 5 | Ga0070690_100037027 | 3300005330 | Bacteria | 3071 |
| 6 | Ga0070670_100007813 | 3300005331 | Bacteria | 9100 |
| 7 | Ga0070670_100033048 | 3300005331 | Bacteria | 4457 |
| 8 | Ga0070670_100205678 | 3300005331 | Bacteria | 1711 |
| 9 | Ga0070677_10013192 | 3300005333 | Bacteria | 2884 |
| 10 | Ga0070666_10016555 | 3300005335 | Bacteria | 4717 |
| 11 | Ga0070666_10103969 | 3300005335 | Bacteria | 1960 |
| 12 | Ga0070680_100008056 | 3300005336 | Bacteria | 8045 |
| 13 | Ga0070680_100109042 | 3300005336 | Bacteria | 2303 |
| 14 | Ga0070682_100069044 | 3300005337 | Bacteria | 2256 |
| 15 | Ga0070682_100076479 | 3300005337 | Bacteria | 2155 |
| 16 | Ga0068868_100000140 | 3300005338 | Bacteria | 46540 |
| 17 | Ga0070689_100002094 | 3300005340 | Bacteria | 12961 |
| 18 | Ga0070689_100019054 | 3300005340 | Bacteria | 5068 |
| 19 | Ga0070687_100151182 | 3300005343 | Bacteria | 1363 |
| 20 | Ga0070692_10044986 | 3300005345 | Bacteria | 2276 |
| 21 | Ga0070668_100026731 | 3300005347 | Bacteria | 4381 |
| 22 | Ga0070675_100001548 | 3300005354 | Bacteria | 17017 |
| 23 | Ga0070675_100089650 | 3300005354 | Bacteria | 2575 |
| 24 | Ga0070675_100132399 | 3300005354 | Bacteria | 2125 |
| 25 | Ga0070671_100001122 | 3300005355 | Bacteria | 19877 |
| 26 | Ga0070671_100011867 | 3300005355 | Bacteria | 7008 |
| 27 | Ga0070674_100048451 | 3300005356 | Bacteria | 2916 |
| 28 | Ga0070673_100017955 | 3300005364 | Bacteria | 5044 |
| 29 | Ga0070673_100022997 | 3300005364 | Bacteria | 4548 |
| 30 | Ga0070673_100123663 | 3300005364 | Bacteria | 2162 |
| 31 | Ga0070688_100077016 | 3300005365 | Bacteria | 2148 |
| 32 | Ga0070659_100371533 | 3300005366 | Bacteria | 1203 |
| 33 | Ga0070667_100028019 | 3300005367 | Bacteria | 4688 |
| 34 | Ga0070667_100235148 | 3300005367 | Bacteria | 1635 |
| 35 | Ga0070713_100073393 | 3300005436 | Bacteria | 2896 |
| 36 | Ga0070713_100140055 | 3300005436 | Bacteria | 2142 |
| 37 | Ga0070713_100416090 | 3300005436 | Bacteria | 1258 |
| 38 | Ga0070701_10000431 | 3300005438 | Bacteria | 14307 |
| 39 | Ga0070701_10008839 | 3300005438 | Bacteria | 4379 |
| 40 | Ga0070711_100095854 | 3300005439 | Bacteria | 2148 |
| 41 | Ga0070705_100008220 | 3300005440 | Bacteria | 5163 |
| 42 | Ga0070700_100007785 | 3300005441 | Bacteria | 5806 |
| 43 | Ga0070700_100016204 | 3300005441 | Bacteria | 4243 |
| 44 | Ga0070700_100171059 | 3300005441 | Bacteria | 1504 |
| 45 | Ga0070694_100033883 | 3300005444 | Bacteria | 3365 |
| 46 | Ga0070678_100008413 | 3300005456 | Bacteria | 6178 |
| 47 | Ga0070678_100238027 | 3300005456 | Bacteria | 1521 |
| 48 | Ga0070662_100068972 | 3300005457 | Bacteria | 2601 |
| 49 | Ga0070681_10008879 | 3300005458 | Bacteria | 9877 |
| 50 | Ga0070681_10012315 | 3300005458 | Bacteria | 8480 |
| 51 | Ga0070681_10066387 | 3300005458 | Bacteria | 3576 |
| 52 | Ga0070681_10102044 | 3300005458 | Bacteria | 2814 |
| 53 | Ga0070685_10005916 | 3300005466 | Bacteria | 6224 |
| 54 | Ga0070699_100190862 | 3300005518 | Bacteria | 1820 |
| 55 | Ga0070679_100025542 | 3300005530 | Bacteria | 5798 |
| 56 | Ga0070679_100052292 | 3300005530 | Bacteria | 4070 |
| 57 | Ga0070679_100069610 | 3300005530 | Bacteria | 3509 |
| 58 | Ga0070679_100229084 | 3300005530 | Bacteria | 1818 |
| 59 | Ga0070684_100002177 | 3300005535 | Bacteria | 14467 |
| 60 | Ga0070684_100002931 | 3300005535 | Bacteria | 12684 |
| 61 | Ga0070684_100015580 | 3300005535 | Bacteria | 6197 |
| 62 | Ga0068853_100026978 | 3300005539 | Bacteria | 4826 |
| 63 | Ga0070686_100006322 | 3300005544 | Bacteria | 6578 |
| 64 | Ga0070686_100010638 | 3300005544 | Bacteria | 5198 |
| 65 | Ga0070696_100008903 | 3300005546 | Bacteria | 6719 |
| 66 | Ga0070696_100167295 | 3300005546 | Bacteria | 1623 |
| 67 | Ga0070693_100138969 | 3300005547 | Bacteria | 1527 |
| 68 | Ga0070665_100001536 | 3300005548 | Bacteria | 26669 |
| 69 | Ga0070665_100003668 | 3300005548 | Bacteria | 16269 |
| 70 | Ga0070665_100018086 | 3300005548 | Bacteria | 7075 |
| 71 | Ga0070665_100027915 | 3300005548 | Bacteria | 5684 |
| 72 | Ga0070665_100030433 | 3300005548 | Bacteria | 5431 |
| 73 | Ga0070665_100046103 | 3300005548 | Bacteria | 4378 |
| 74 | Ga0070665_100057574 | 3300005548 | Bacteria | 3896 |
| 75 | Ga0068855_100000562 | 3300005563 | Bacteria | 45523 |
| 76 | Ga0068855_100014452 | 3300005563 | Bacteria | 9505 |
| 77 | Ga0068855_100029840 | 3300005563 | Bacteria | 6521 |
| 78 | Ga0068855_100217633 | 3300005563 | Bacteria | 2143 |
| 79 | Ga0068855_100269160 | 3300005563 | Bacteria | 1895 |
| 80 | Ga0070664_100005398 | 3300005564 | Bacteria | 10261 |
| 81 | Ga0070664_100044591 | 3300005564 | Bacteria | 3744 |
| 82 | Ga0070664_100110445 | 3300005564 | Bacteria | 2399 |
| 83 | Ga0068857_100011898 | 3300005577 | Bacteria | 7569 |
| 84 | Ga0068857_100066094 | 3300005577 | Bacteria | 3217 |
| 85 | Ga0068857_100222080 | 3300005577 | Bacteria | 1726 |
| 86 | Ga0068856_100133570 | 3300005614 | Bacteria | 2487 |
| 87 | Ga0070702_100003887 | 3300005615 | Bacteria | 6766 |
| 88 | Ga0070702_100006036 | 3300005615 | Bacteria | 5703 |
| 89 | Ga0068852_100068566 | 3300005616 | Bacteria | 3105 |
| 90 | Ga0068852_100114550 | 3300005616 | Bacteria | 2457 |
| 91 | Ga0068859_100000172 | 3300005617 | Bacteria | 62990 |
| 92 | Ga0068859_100006664 | 3300005617 | Bacteria | 11727 |
| 93 | Ga0068859_100019018 | 3300005617 | Bacteria | 6898 |
| 94 | Ga0068859_100021669 | 3300005617 | Bacteria | 6449 |
| 95 | Ga0068864_100003919 | 3300005618 | Bacteria | 12262 |
| 96 | Ga0068864_100009799 | 3300005618 | Bacteria | 7900 |
| 97 | Ga0068861_100004302 | 3300005719 | Bacteria | 9551 |
| 98 | Ga0068861_100058786 | 3300005719 | Bacteria | 2941 |
| 99 | Ga0068861_100066944 | 3300005719 | Bacteria | 2770 |
| 100 | Ga0068861_100072452 | 3300005719 | Bacteria | 2673 |
| 101 | Ga0068861_100080463 | 3300005719 | Bacteria | 2549 |
| 102 | Ga0068851_10024936 | 3300005834 | Bacteria | 2930 |
| 103 | Ga0068870_10003132 | 3300005840 | Bacteria | 6977 |
| 104 | Ga0068863_100001117 | 3300005841 | Bacteria | 26783 |
| 105 | Ga0068863_100002743 | 3300005841 | Bacteria | 17423 |
| 106 | Ga0068863_100006049 | 3300005841 | Bacteria | 11875 |
| 107 | Ga0068863_100048271 | 3300005841 | Bacteria | 4037 |
| 108 | Ga0068863_100233297 | 3300005841 | Bacteria | 1775 |
| 109 | Ga0068858_100000406 | 3300005842 | Bacteria | 44839 |
| 110 | Ga0068858_100014718 | 3300005842 | Bacteria | 7363 |
| 111 | Ga0068860_100011976 | 3300005843 | Bacteria | 8545 |
| 112 | Ga0068860_100017378 | 3300005843 | Bacteria | 7009 |
| 113 | Ga0068860_100053595 | 3300005843 | Bacteria | 3835 |
| 114 | Ga0068860_100054216 | 3300005843 | Bacteria | 3811 |
| 115 | Ga0068862_100008766 | 3300005844 | Bacteria | 8377 |
| 116 | Ga0068862_100015840 | 3300005844 | Bacteria | 6263 |
| 117 | Ga0068862_100021077 | 3300005844 | Bacteria | 5448 |
| 118 | Ga0068862_100123669 | 3300005844 | Bacteria | 2282 |
| 119 | Ga0068862_100210762 | 3300005844 | Bacteria | 1756 |
| 120 | Ga0081455_10000656 | 3300005937 | Bacteria | 44828 |
| 121 | Ga0081539_10000058 | 3300005985 | Bacteria | 256212 |
| 122 | Ga0070717_10022516 | 3300006028 | Bacteria | 4980 |
| 123 | Ga0068871_100095317 | 3300006358 | Bacteria | 2485 |
| 124 | Ga0075428_100006380 | 3300006844 | Bacteria | 13126 |
| 125 | Ga0075428_100023951 | 3300006844 | Bacteria | 6754 |
| 126 | Ga0075430_100003451 | 3300006846 | Bacteria | 13224 |
| 127 | Ga0075430_100069306 | 3300006846 | Bacteria | 2958 |
| 128 | Ga0075431_100000091 | 3300006847 | Bacteria | 55827 |
| 129 | Ga0075431_100035584 | 3300006847 | Bacteria | 5127 |
| 130 | Ga0075433_10023945 | 3300006852 | Bacteria | 5148 |
| 131 | Ga0075429_100003083 | 3300006880 | Bacteria | 14137 |
| 132 | Ga0097620_100000172 | 3300006931 | Bacteria | 62990 |
| 133 | Ga0097620_100006664 | 3300006931 | Bacteria | 11727 |
| 134 | Ga0097620_100019017 | 3300006931 | Bacteria | 6898 |
| 135 | Ga0097620_100021667 | 3300006931 | Bacteria | 6449 |
| 136 | Ga0099794_10014179 | 3300007265 | Bacteria | 3486 |
| 137 | Ga0099795_10000004 | 3300007788 | Bacteria | 108633 |
| 138 | Ga0099795_10000472 | 3300007788 | Bacteria | 7484 |
| 139 | Ga0105250_10000024 | 3300009092 | Bacteria | 218115 |
| 140 | Ga0105250_10025793 | 3300009092 | Bacteria | 2368 |
| 141 | Ga0105240_10002675 | 3300009093 | Bacteria | 28365 |
| 142 | Ga0105240_10014372 | 3300009093 | Bacteria | 10810 |
| 143 | Ga0105240_10016668 | 3300009093 | Bacteria | 9939 |
| 144 | Ga0105240_10027153 | 3300009093 | Bacteria | 7500 |
| 145 | Ga0105240_10032315 | 3300009093 | Bacteria | 6777 |
| 146 | Ga0105240_10078077 | 3300009093 | Bacteria | 4078 |
| 147 | Ga0105240_10110960 | 3300009093 | Bacteria | 3319 |
| 148 | Ga0105240_10113671 | 3300009093 | Bacteria | 3271 |
| 149 | Ga0105240_10179020 | 3300009093 | Bacteria | 2504 |
| 150 | Ga0105240_10197594 | 3300009093 | Bacteria | 2359 |
| 151 | Ga0111539_10006586 | 3300009094 | Bacteria | 14967 |
| 152 | Ga0111539_10009504 | 3300009094 | Bacteria | 12272 |
| 153 | Ga0111539_10036816 | 3300009094 | Bacteria | 5913 |
| 154 | Ga0111539_10185713 | 3300009094 | Bacteria | 2428 |
| 155 | Ga0105245_10002513 | 3300009098 | Bacteria | 16535 |
| 156 | Ga0105245_10103683 | 3300009098 | Bacteria | 2636 |
| 157 | Ga0105247_10000270 | 3300009101 | Bacteria | 48109 |
| 158 | Ga0105247_10000853 | 3300009101 | Bacteria | 23079 |
| 159 | Ga0114129_10000484 | 3300009147 | Bacteria | 48049 |
| 160 | Ga0105243_10109301 | 3300009148 | Bacteria | 2309 |
| 161 | Ga0105242_10186983 | 3300009176 | Bacteria | 1831 |
| 162 | Ga0105248_10010700 | 3300009177 | Bacteria | 10124 |
| 163 | Ga0105248_10051218 | 3300009177 | Bacteria | 4633 |
| 164 | Ga0105248_10051726 | 3300009177 | Bacteria | 4609 |
| 165 | Ga0105237_10013224 | 3300009545 | Bacteria | 8657 |
| 166 | Ga0105237_10148222 | 3300009545 | Bacteria | 2342 |
| 167 | Ga0105238_10002575 | 3300009551 | Bacteria | 18089 |
| 168 | Ga0105238_10058962 | 3300009551 | Bacteria | 3847 |
| 169 | Ga0105238_10074190 | 3300009551 | Bacteria | 3395 |
| 170 | Ga0105238_10109079 | 3300009551 | Bacteria | 2749 |
| 171 | Ga0105238_10112209 | 3300009551 | Bacteria | 2706 |
| 172 | Ga0105238_10128243 | 3300009551 | Bacteria | 2515 |
| 173 | Ga0105238_10151016 | 3300009551 | Bacteria | 2298 |
| 174 | Ga0105249_10004587 | 3300009553 | Bacteria | 11939 |
| 175 | Ga0105249_10036356 | 3300009553 | Bacteria | 4466 |
| 176 | Ga0105249_10077304 | 3300009553 | Bacteria | 3086 |
| 177 | Ga0105249_10221883 | 3300009553 | Bacteria | 1860 |
| 178 | Ga0099796_10000006 | 3300010159 | Bacteria | 66689 |
| 179 | Ga0105239_10020008 | 3300010375 | Bacteria | 7387 |
| 180 | Ga0105246_10000648 | 3300011119 | Bacteria | 19460 |
| 181 | Ga0157370_10001137 | 3300013104 | Bacteria | 33243 |
| 182 | Ga0157370_10090146 | 3300013104 | Bacteria | 2879 |
| 183 | Ga0157369_10008496 | 3300013105 | Bacteria | 11774 |
| 184 | Ga0157369_10089349 | 3300013105 | Bacteria | 3289 |
| 185 | Ga0157369_10286583 | 3300013105 | Bacteria | 1715 |
| 186 | Ga0157374_10000998 | 3300013296 | Bacteria | 24538 |
| 187 | Ga0157374_10333684 | 3300013296 | Bacteria | 1504 |
| 188 | Ga0157374_10384637 | 3300013296 | Bacteria | 1398 |
| 189 | Ga0157378_10142943 | 3300013297 | Bacteria | 2223 |
| 190 | Ga0163162_10005163 | 3300013306 | Bacteria | 12587 |
| 191 | Ga0163162_10091871 | 3300013306 | Bacteria | 3118 |
| 192 | Ga0163162_10154988 | 3300013306 | Bacteria | 2410 |
| 193 | Ga0163162_10229671 | 3300013306 | Bacteria | 1986 |
| 194 | Ga0157372_10075950 | 3300013307 | Bacteria | 3793 |
| 195 | Ga0163163_10001153 | 3300014325 | Bacteria | 22447 |
| 196 | Ga0163163_10001836 | 3300014325 | Bacteria | 17917 |
| 197 | Ga0163163_10050406 | 3300014325 | Bacteria | 4100 |
| 198 | Ga0157380_10014279 | 3300014326 | Bacteria | 5810 |
| 199 | Ga0157380_10161361 | 3300014326 | Bacteria | 1949 |
| 200 | Ga0157377_10083404 | 3300014745 | Bacteria | 1873 |
| 201 | Ga0157379_10001338 | 3300014968 | Bacteria | 20123 |
| 202 | Ga0157379_10259285 | 3300014968 | Bacteria | 1579 |
| 203 | Ga0157376_10014933 | 3300014969 | Bacteria | 5852 |
| 204 | Ga0163161_10188205 | 3300017792 | Bacteria | 1586 |
| 205 | Ga0213874_10007226 | 3300021377 | Bacteria | 2657 |
| 206 | Ga0209564_1002644 | 3300025295 | Bacteria | 13687 |
| 207 | Ga0207697_10006704 | 3300025315 | Bacteria | 5187 |
| 208 | Ga0207696_1000383 | 3300025711 | Bacteria | 42719 |
| 209 | Ga0207710_10000280 | 3300025900 | Bacteria | 41457 |
| 210 | Ga0207710_10004906 | 3300025900 | Bacteria | 5802 |
| 211 | Ga0207680_10010839 | 3300025903 | Bacteria | 4578 |
| 212 | Ga0207685_10028339 | 3300025905 | Bacteria | 1971 |
| 213 | Ga0207645_10071162 | 3300025907 | Bacteria | 2226 |
| 214 | Ga0207643_10030597 | 3300025908 | Bacteria | 2997 |
| 215 | Ga0207707_10000390 | 3300025912 | Bacteria | 45829 |
| 216 | Ga0207707_10004165 | 3300025912 | Bacteria | 12811 |
| 217 | Ga0207707_10029813 | 3300025912 | Bacteria | 4772 |
| 218 | Ga0207707_10123116 | 3300025912 | Bacteria | 2268 |
| 219 | Ga0207707_10148105 | 3300025912 | Bacteria | 2052 |
| 220 | Ga0207707_10235277 | 3300025912 | Bacteria | 1593 |
| 221 | Ga0207695_10003577 | 3300025913 | Bacteria | 21747 |
| 222 | Ga0207695_10014705 | 3300025913 | Bacteria | 9255 |
| 223 | Ga0207695_10031342 | 3300025913 | Bacteria | 5833 |
| 224 | Ga0207695_10089230 | 3300025913 | Bacteria | 3101 |
| 225 | Ga0207695_10096021 | 3300025913 | Bacteria | 2966 |
| 226 | Ga0207695_10121021 | 3300025913 | Bacteria | 2585 |
| 227 | Ga0207695_10347469 | 3300025913 | Bacteria | 1371 |
| 228 | Ga0207671_10034467 | 3300025914 | Bacteria | 3760 |
| 229 | Ga0207663_10042186 | 3300025916 | Bacteria | 2786 |
| 230 | Ga0207660_10001712 | 3300025917 | Bacteria | 14711 |
| 231 | Ga0207660_10077755 | 3300025917 | Bacteria | 2430 |
| 232 | Ga0207652_10000362 | 3300025921 | Bacteria | 47186 |
| 233 | Ga0207652_10019306 | 3300025921 | Bacteria | 5605 |
| 234 | Ga0207652_10133026 | 3300025921 | Bacteria | 2219 |
| 235 | Ga0207694_10096857 | 3300025924 | Bacteria | 2334 |
| 236 | Ga0207650_10039896 | 3300025925 | Bacteria | 3433 |
| 237 | Ga0207650_10080408 | 3300025925 | Bacteria | 2471 |
| 238 | Ga0207650_10082141 | 3300025925 | Bacteria | 2445 |
| 239 | Ga0207659_10013690 | 3300025926 | Bacteria | 5207 |
| 240 | Ga0207687_10117132 | 3300025927 | Bacteria | 1987 |
| 241 | Ga0207700_10051576 | 3300025928 | Bacteria | 3071 |
| 242 | Ga0207700_10063142 | 3300025928 | Bacteria | 2816 |
| 243 | Ga0207700_10084112 | 3300025928 | Bacteria | 2493 |
| 244 | Ga0207664_10023877 | 3300025929 | Bacteria | 4588 |
| 245 | Ga0207644_10012327 | 3300025931 | Bacteria | 5676 |
| 246 | Ga0207706_10068696 | 3300025933 | Bacteria | 3117 |
| 247 | Ga0207706_10104843 | 3300025933 | Bacteria | 2487 |
| 248 | Ga0207706_10319639 | 3300025933 | Bacteria | 1351 |
| 249 | Ga0207686_10051576 | 3300025934 | Bacteria | 2563 |
| 250 | Ga0207709_10031426 | 3300025935 | Bacteria | 3101 |
| 251 | Ga0207704_10204089 | 3300025938 | Bacteria | 1449 |
| 252 | Ga0207691_10030738 | 3300025940 | Bacteria | 5016 |
| 253 | Ga0207691_10162222 | 3300025940 | Bacteria | 1960 |
| 254 | Ga0207711_10002654 | 3300025941 | Bacteria | 15811 |
| 255 | Ga0207689_10009867 | 3300025942 | Bacteria | 8230 |
| 256 | Ga0207689_10093467 | 3300025942 | Bacteria | 2470 |
| 257 | Ga0207661_10032138 | 3300025944 | Bacteria | 4063 |
| 258 | Ga0207679_10026155 | 3300025945 | Bacteria | 4023 |
| 259 | Ga0207667_10001313 | 3300025949 | Bacteria | 31189 |
| 260 | Ga0207667_10002859 | 3300025949 | Bacteria | 21419 |
| 261 | Ga0207667_10077183 | 3300025949 | Bacteria | 3456 |
| 262 | Ga0207651_10030241 | 3300025960 | Bacteria | 3445 |
| 263 | Ga0207651_10122240 | 3300025960 | Bacteria | 1976 |
| 264 | Ga0207712_10007380 | 3300025961 | Bacteria | 6943 |
| 265 | Ga0207658_10060404 | 3300025986 | Bacteria | 2828 |
| 266 | Ga0207658_10139566 | 3300025986 | Bacteria | 1959 |
| 267 | Ga0207658_10196027 | 3300025986 | Bacteria | 1682 |
| 268 | Ga0207703_10001744 | 3300026035 | Bacteria | 19465 |
| 269 | Ga0207703_10002741 | 3300026035 | Bacteria | 15088 |
| 270 | Ga0207703_10006124 | 3300026035 | Bacteria | 9627 |
| 271 | Ga0207639_10020011 | 3300026041 | Bacteria | 4785 |
| 272 | Ga0207678_10014042 | 3300026067 | Bacteria | 7042 |
| 273 | Ga0207708_10007427 | 3300026075 | Bacteria | 8100 |
| 274 | Ga0207708_10014840 | 3300026075 | Bacteria | 5830 |
| 275 | Ga0207708_10042145 | 3300026075 | Bacteria | 3480 |
| 276 | Ga0207702_10334909 | 3300026078 | Bacteria | 1444 |
| 277 | Ga0207641_10000258 | 3300026088 | Bacteria | 67414 |
| 278 | Ga0207641_10013307 | 3300026088 | Bacteria | 6748 |
| 279 | Ga0207641_10014296 | 3300026088 | Bacteria | 6504 |
| 280 | Ga0207641_10152323 | 3300026088 | Bacteria | 2095 |
| 281 | Ga0207648_10002079 | 3300026089 | Bacteria | 21809 |
| 282 | Ga0207648_10020677 | 3300026089 | Bacteria | 5925 |
| 283 | Ga0207648_10044858 | 3300026089 | Bacteria | 3879 |
| 284 | Ga0207676_10001802 | 3300026095 | Bacteria | 15704 |
| 285 | Ga0207674_10022134 | 3300026116 | Bacteria | 6832 |
| 286 | Ga0207675_100004588 | 3300026118 | Bacteria | 13316 |
| 287 | Ga0207675_100008159 | 3300026118 | Bacteria | 9870 |
| 288 | Ga0207675_100019481 | 3300026118 | Bacteria | 6331 |
| 289 | Ga0207675_100025052 | 3300026118 | Bacteria | 5552 |
| 290 | Ga0207675_100025506 | 3300026118 | Bacteria | 5502 |
| 291 | Ga0207675_100026436 | 3300026118 | Bacteria | 5403 |
| 292 | Ga0207675_100027649 | 3300026118 | Bacteria | 5282 |
| 293 | Ga0207675_100034285 | 3300026118 | Bacteria | 4732 |
| 294 | Ga0207675_100054852 | 3300026118 | Bacteria | 3718 |
| 295 | Ga0207675_100253513 | 3300026118 | Bacteria | 1704 |
| 296 | Ga0207675_100412543 | 3300026118 | Bacteria | 1333 |
| 297 | Ga0207683_10009122 | 3300026121 | Bacteria | 8454 |
| 298 | Ga0207683_10069943 | 3300026121 | Bacteria | 3100 |
| 299 | Ga0207698_10094547 | 3300026142 | Bacteria | 2458 |
| 300 | Ga0209179_1000092 | 3300027512 | Bacteria | 13096 |
| 301 | Ga0207428_10011062 | 3300027907 | Bacteria | 8017 |
| 302 | Ga0268266_10000434 | 3300028379 | Bacteria | 62882 |
| 303 | Ga0268266_10002255 | 3300028379 | Bacteria | 20985 |
| 304 | Ga0268266_10012211 | 3300028379 | Bacteria | 7431 |
| 305 | Ga0268266_10012944 | 3300028379 | Bacteria | 7194 |
| 306 | Ga0268266_10027825 | 3300028379 | Bacteria | 4807 |
| 307 | Ga0268266_10074833 | 3300028379 | Bacteria | 2941 |
| 308 | Ga0268266_10082500 | 3300028379 | Bacteria | 2805 |
| 309 | Ga0268265_10008129 | 3300028380 | Bacteria | 7090 |
| 310 | Ga0268265_10009404 | 3300028380 | Bacteria | 6603 |
| 311 | Ga0268265_10017561 | 3300028380 | Bacteria | 4940 |
| 312 | Ga0268265_10022078 | 3300028380 | Bacteria | 4468 |
| 313 | Ga0268265_10025057 | 3300028380 | Bacteria | 4229 |
| 314 | Ga0268265_10028878 | 3300028380 | Bacteria | 3976 |
| 315 | Ga0268264_10000034 | 3300028381 | Bacteria | 401894 |
| 316 | Ga0268264_10004901 | 3300028381 | Bacteria | 11338 |
| 317 | Ga0268264_10076468 | 3300028381 | Bacteria | 2848 |
| 318 | Ga0268264_10126559 | 3300028381 | Bacteria | 2259 |
| 319 | Ga0265334_10000008 | 3300028573 | Bacteria | 200602 |
| 320 | Ga0265318_10001166 | 3300028577 | Bacteria | 16279 |
| 321 | Ga0307515_10007927 | 3300028794 | Bacteria | 20856 |
| 322 | Ga0307515_10161418 | 3300028794 | Bacteria | 2283 |
| 323 | Ga0265338_10015718 | 3300028800 | Bacteria | 8293 |
| 324 | Ga0307511_10000260 | 3300030521 | Bacteria | 54540 |
| 325 | Ga0307511_10002901 | 3300030521 | Bacteria | 17765 |
| 326 | Ga0265330_10012426 | 3300031235 | Bacteria | 3981 |
| 327 | Ga0265332_10001420 | 3300031238 | Bacteria | 13467 |
| 328 | Ga0265328_10028428 | 3300031239 | Bacteria | 2091 |
| 329 | Ga0265320_10005651 | 3300031240 | Bacteria | 7983 |
| 330 | Ga0265329_10014612 | 3300031242 | Bacteria | 2767 |
| 331 | Ga0265340_10006960 | 3300031247 | Bacteria | 6173 |
| 332 | Ga0265340_10107668 | 3300031247 | Bacteria | 1291 |
| 333 | Ga0265339_10030212 | 3300031249 | Bacteria | 3069 |
| 334 | Ga0265331_10003187 | 3300031250 | Bacteria | 10708 |
| 335 | Ga0265331_10006528 | 3300031250 | Bacteria | 6882 |
| 336 | Ga0265316_10002874 | 3300031344 | Bacteria | 17631 |
| 337 | Ga0307509_10000230 | 3300031507 | Bacteria | 90240 |
| 338 | Ga0307509_10024157 | 3300031507 | Bacteria | 6811 |
| 339 | Ga0307408_100093129 | 3300031548 | Bacteria | 2279 |
| 340 | Ga0265313_10000807 | 3300031595 | Bacteria | 31618 |
| 341 | Ga0265313_10004882 | 3300031595 | Bacteria | 10056 |
| 342 | Ga0307508_10029327 | 3300031616 | Bacteria | 4975 |
| 343 | Ga0316579_10004221 | 3300031691 | Bacteria | 5686 |
| 344 | Ga0265314_10017406 | 3300031711 | Bacteria | 5643 |
| 345 | Ga0265342_10009330 | 3300031712 | Bacteria | 6926 |
| 346 | Ga0316576_10136120 | 3300031727 | Bacteria | 1848 |
| 347 | Ga0316578_10014334 | 3300031728 | Bacteria | 4231 |
| 348 | Ga0307405_10106237 | 3300031731 | Bacteria | 1893 |
| 349 | Ga0316577_10012878 | 3300031733 | Bacteria | 4564 |
| 350 | Ga0316577_10078132 | 3300031733 | Bacteria | 1848 |
| 351 | Ga0307413_10004222 | 3300031824 | Bacteria | 6210 |
| 352 | Ga0307413_10010556 | 3300031824 | Bacteria | 4489 |
| 353 | Ga0307410_10030143 | 3300031852 | Bacteria | 3463 |
| 354 | Ga0307410_10043195 | 3300031852 | Bacteria | 2985 |
| 355 | Ga0307406_10016081 | 3300031901 | Bacteria | 4340 |
| 356 | Ga0307406_10101213 | 3300031901 | Bacteria | 1963 |
| 357 | Ga0307409_100004229 | 3300031995 | Bacteria | 8011 |
| 358 | Ga0307416_100105812 | 3300032002 | Bacteria | 2464 |
| 359 | Ga0307416_100134069 | 3300032002 | Bacteria | 2236 |
| 360 | Ga0307416_100266983 | 3300032002 | Bacteria | 1677 |
| 361 | Ga0307414_10200731 | 3300032004 | Bacteria | 1622 |
| 362 | Ga0307411_10001359 | 3300032005 | Bacteria | 9903 |
| 363 | Ga0307411_10104919 | 3300032005 | Bacteria | 2008 |
| 364 | Ga0307411_10324473 | 3300032005 | Bacteria | 1245 |
| 365 | Ga0316585_10016273 | 3300032137 | Bacteria | 2238 |
| 366 | Ga0316580_10003296 | 3300032139 | Bacteria | 4563 |
| 367 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 368 | Ga0373936_0016056 | 3300035113 | Bacteria | 2875 |
| 369 | Ga0373954_0061443 | 3300035118 | Bacteria | 1773 |
| 370 | Ga0373956_0065269 | 3300035119 | Bacteria | 1654 |
| 371 | Ga0373955_0033267 | 3300035172 | Bacteria | 2714 |
| 372 | Ga0316574_0006599 | 3300035398 | Bacteria | 6285 |
| 373 | Ga0316574_0019580 | 3300035398 | Bacteria | 3995 |
| 374 | Ga0373931_0005264 | 3300035691 | Bacteria | 5966 |
| 375 | Ga0373935_0235768 | 3300035692 | Bacteria | 1276 |
| 376 | Ga0373927_0000010 | 3300035695 | Bacteria | 183458 |
| 377 | Ga0373933_0205173 | 3300035724 | Bacteria | 1262 |
| 378 | Ga0373937_0068023 | 3300036401 | Bacteria | 3283 |
| 379 | Ga0316582_0085700 | 3300036647 | Bacteria | 2065 |
| 380 | Ga0316582_0244873 | 3300036647 | Bacteria | 1228 |
| 381 | Ga0316584_0003233 | 3300036712 | Bacteria | 10547 |
| 382 | Ga0316584_0011108 | 3300036712 | Bacteria | 6316 |
| 383 | Ga0316584_0062143 | 3300036712 | Bacteria | 2797 |
| 384 | Ga0316584_0098676 | 3300036712 | Bacteria | 2187 |
| 385 | Ga0373925_0097611 | 3300037068 | Bacteria | 2254 |
| 386 | Ga0395900_0054518 | 3300037418 | Bacteria | 4117 |
| 387 | Ga0395898_0067073 | 3300037466 | Bacteria | 3475 |
| 388 | Ga0395905_0189782 | 3300037471 | Bacteria | 1928 |
| 389 | Ga0436365_1487483 | 3300039437 | Bacteria | 2245 |
| 390 | Ga0436360_0504587 | 3300039438 | Bacteria | 11481 |
| 391 | Ga0436361_0364378 | 3300039447 | Bacteria | 2038 |
| 392 | Ga0436363_0652634 | 3300039450 | Bacteria | 6791 |
| 393 | Ga0439457_010026 | 3300042014 | Bacteria | 2190 |
| 394 | Ga0450894_006762 | 3300042131 | Bacteria | 1479 |
| 395 | Ga0451577_0011772 | 3300042876 | Bacteria | 8256 |
| 396 | Ga0466969_0033435 | 3300044656 | Bacteria | 2610 |
| 397 | Ga0466965_0026401 | 3300044683 | Bacteria | 2816 |
| 398 | Ga0466966_0041338 | 3300044684 | Bacteria | 2962 |
| 399 | Ga0466966_0050326 | 3300044684 | Bacteria | 2651 |
| 400 | Ga0453684_0081490 | 3300044712 | Bacteria | 4036 |
| 401 | Ga0466968_0052703 | 3300044735 | Bacteria | 1741 |
| 402 | Ga0466970_0030194 | 3300044765 | Bacteria | 2857 |
| 403 | Ga0451576_0177235 | 3300045051 | Bacteria | 2226 |
| 404 | Ga0466958_0111262 | 3300045836 | Bacteria | 1710 |
| 405 | Ga0495590_0016665 | 3300046457 | Bacteria | 2652 |
| 406 | Ga0495638_0009998 | 3300046460 | Bacteria | 6617 |
| 407 | Ga0495638_0014722 | 3300046460 | Bacteria | 5275 |
| 408 | Ga0495638_0150318 | 3300046460 | Bacteria | 1351 |
| 409 | Ga0495580_0027648 | 3300046472 | Bacteria | 4126 |
| 410 | Ga0495585_0069334 | 3300046492 | Bacteria | 1925 |
| 411 | Ga0495616_0008652 | 3300046513 | Bacteria | 6010 |
| 412 | Ga0495654_0106461 | 3300046530 | Bacteria | 1284 |
| 413 | Ga0495621_0000098 | 3300046539 | Bacteria | 17925 |
| 414 | Ga0495625_0019771 | 3300046660 | Bacteria | 5213 |
| 415 | Ga0495625_0058678 | 3300046660 | Bacteria | 2734 |
| 416 | Ga0495647_0001846 | 3300046681 | Bacteria | 6566 |
| 417 | Ga0495658_0017921 | 3300046683 | Bacteria | 3671 |
| 418 | Ga0495658_0137161 | 3300046683 | Bacteria | 1494 |
| 419 | Ga0495669_0081239 | 3300046684 | Bacteria | 1488 |
| 420 | Ga0495613_0171208 | 3300046689 | Bacteria | 1541 |
| 421 | Ga0495649_0047264 | 3300046694 | Bacteria | 2341 |
| 422 | Ga0495604_0085790 | 3300047317 | Bacteria | 2349 |
| 423 | Ga0495687_027749 | 3300047443 | Bacteria | 2645 |
| 424 | Ga0496102_0013374 | 3300048905 | Bacteria | 7109 |
| 425 | Ga0496102_0021184 | 3300048905 | Bacteria | 5748 |
| 426 | Ga0496104_0012231 | 3300048907 | Bacteria | 7713 |
| 427 | Ga0496107_0305262 | 3300048910 | Bacteria | 1185 |
| 428 | Ga0496108_0075209 | 3300048911 | Bacteria | 2853 |
| 429 | Ga0496108_0149409 | 3300048911 | Bacteria | 2016 |
| 430 | Ga0496109_0038396 | 3300048912 | Bacteria | 4329 |
| 431 | Ga0496110_0038902 | 3300048913 | Bacteria | 4141 |
| 432 | Ga0496112_0001440 | 3300048915 | Bacteria | 18264 |
| 433 | Ga0496112_0063813 | 3300048915 | Bacteria | 3634 |
| 434 | Ga0496112_0370644 | 3300048915 | Bacteria | 1373 |
| 435 | Ga0496114_0059651 | 3300048917 | Bacteria | 3188 |
| 436 | Ga0496115_0002736 | 3300048918 | Bacteria | 12659 |
| 437 | Ga0496115_0074101 | 3300048918 | Bacteria | 2764 |
| 438 | Ga0496116_0008520 | 3300048919 | Bacteria | 8888 |
| 439 | Ga0496117_0000012 | 3300048920 | Bacteria | 608530 |
| 440 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 441 | Ga0496119_0075283 | 3300048922 | Bacteria | 1962 |
| 442 | Ga0496120_0000611 | 3300048923 | Bacteria | 54277 |
| 443 | Ga0496120_0021414 | 3300048923 | Bacteria | 4087 |
| 444 | Ga0496121_0005660 | 3300048924 | Bacteria | 15896 |
| 445 | Ga0496121_0038301 | 3300048924 | Bacteria | 4249 |
| 446 | Ga0496121_0053909 | 3300048924 | Bacteria | 3365 |
| 447 | Ga0496124_0085428 | 3300048927 | Bacteria | 2586 |
| 448 | Ga0496125_0003375 | 3300048928 | Bacteria | 19450 |
| 449 | Ga0496125_0011969 | 3300048928 | Bacteria | 8639 |
| 450 | Ga0496125_0030028 | 3300048928 | Bacteria | 4869 |
| 451 | Ga0496126_0024765 | 3300048929 | Bacteria | 5787 |
| 452 | Ga0496126_0199165 | 3300048929 | Bacteria | 1692 |
| 453 | Ga0501031_0192745 | 3300049568 | Bacteria | 1331 |
| 454 | Ga0501034_0434343 | 3300049571 | Bacteria | 1232 |
| 455 | Ga0501036_0190276 | 3300049572 | Bacteria | 1727 |
| 456 | Ga0501071_0053139 | 3300049587 | Bacteria | 2921 |
| 457 | Ga0501072_0026504 | 3300049588 | Bacteria | 4520 |
| 458 | nmdc:mga05p37_11639_c1 | 3300050507 | Bacteria | 10485 |
| 459 | nmdc:mga09592_1590_c1 | 3300050508 | Bacteria | 18289 |
| 460 | nmdc:mga06r32_2483_c1 | 3300050510 | Bacteria | 16504 |
| 461 | nmdc:mga06r32_29_c1 | 3300050510 | Bacteria | 85620 |
| 462 | nmdc:mga06r32_64140_c1 | 3300050510 | Bacteria | 3542 |
| 463 | nmdc:mga08y16_12268_c1 | 3300050511 | Bacteria | 9007 |
| 464 | nmdc:mga08y16_14469_c1 | 3300050511 | Bacteria | 8300 |
| 465 | nmdc:mga08y16_180331_c1 | 3300050511 | Bacteria | 2193 |
| 466 | nmdc:mga08y16_29298_c1 | 3300050511 | Bacteria | 5800 |
| 467 | Ga0495601_0013225 | 3300053077 | Bacteria | 4963 |
| 468 | Ga0500643_027914 | 3300053087 | Bacteria | 1749 |
| 469 | Ga0500583_0011949 | 3300053092 | Bacteria | 3294 |
| 470 | Ga0500583_0041494 | 3300053092 | Bacteria | 2090 |
| 471 | Ga0500583_0045293 | 3300053092 | Bacteria | 2019 |
| 472 | Ga0500641_0011417 | 3300053096 | Bacteria | 3224 |
| 473 | Ga0500591_037993 | 3300053115 | Bacteria | 2303 |
| 474 | Ga0500658_0010552 | 3300053134 | Bacteria | 3408 |
| 475 | Ga0500588_0015997 | 3300053146 | Bacteria | 1932 |
| 476 | Ga0500616_0000425 | 3300053153 | Bacteria | 56265 |
| 477 | Ga0500622_0003929 | 3300053156 | Bacteria | 9610 |
| 478 | Ga0500622_0006901 | 3300053156 | Bacteria | 6514 |
| 479 | Ga0500624_000026 | 3300053157 | Bacteria | 109681 |
| 480 | Ga0500636_0056130 | 3300053177 | Bacteria | 2307 |
| 481 | Ga0500637_0007451 | 3300053178 | Bacteria | 5473 |
| 482 | Ga0500637_0089805 | 3300053178 | Bacteria | 1778 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10014179 | Ga0099794_100141794 | 323 |
| 2 | 3300007788 | Ga0099795_10000472 | Ga0099795_100004723 | 323 |
| 3 | 3300035398 | Ga0316574_0019580 | Ga0316574_0019580_454_1455 | 330 |
| 4 | 3300036712 | Ga0316584_0062143 | Ga0316584_0062143_1576_2577 | 330 |
| 5 | 3300042131 | Ga0450894_006762 | Ga0450894_006762_45_1043 | 330 |
| 6 | 3300048910 | Ga0496107_0305262 | Ga0496107_0305262_26_1027 | 330 |
| 7 | 3300046472 | Ga0495580_0027648 | Ga0495580_0027648_1212_2222 | 336 |
| 8 | 3300005331 | Ga0070670_100205678 | Ga0070670_1002056781 | 341 |
| 9 | 3300046689 | Ga0495613_0171208 | Ga0495613_0171208_459_1496 | 341 |
| 10 | 3300005539 | Ga0068853_100026978 | Ga0068853_1000269781 | 342 |
| 11 | 3300005577 | Ga0068857_100066094 | Ga0068857_1000660941 | 342 |
| 12 | 3300005614 | Ga0068856_100133570 | Ga0068856_1001335702 | 342 |
| 13 | 3300005834 | Ga0068851_10024936 | Ga0068851_100249364 | 342 |
| 14 | 3300026041 | Ga0207639_10020011 | Ga0207639_100200116 | 342 |
| 15 | 3300026075 | Ga0207708_10042145 | Ga0207708_100421452 | 342 |
| 16 | 3300026078 | Ga0207702_10334909 | Ga0207702_103349091 | 342 |
| 17 | 3300053087 | Ga0500643_027914 | Ga0500643_027914_66_1145 | 345 |
| 18 | 3300053157 | Ga0500624_000026 | Ga0500624_000026_25593_26672 | 345 |
| 19 | 3300053177 | Ga0500636_0056130 | Ga0500636_0056130_729_1808 | 345 |
| 20 | 3300013306 | Ga0163162_10091871 | Ga0163162_100918713 | 346 |
| 21 | 3300046694 | Ga0495649_0047264 | Ga0495649_0047264_1224_2300 | 346 |
| 22 | 3300048911 | Ga0496108_0149409 | Ga0496108_0149409_592_1668 | 347 |
| 23 | 3300005458 | Ga0070681_10066387 | Ga0070681_100663871 | 348 |
| 24 | 3300005535 | Ga0070684_100015580 | Ga0070684_1000155804 | 348 |
| 25 | 3300005548 | Ga0070665_100003668 | Ga0070665_10000366810 | 348 |
| 26 | 3300013296 | Ga0157374_10333684 | Ga0157374_103336842 | 348 |
| 27 | 3300025912 | Ga0207707_10235277 | Ga0207707_102352772 | 348 |
| 28 | 3300025917 | Ga0207660_10077755 | Ga0207660_100777552 | 348 |
| 29 | 3300025924 | Ga0207694_10096857 | Ga0207694_100968573 | 348 |
| 30 | 3300025944 | Ga0207661_10032138 | Ga0207661_100321383 | 348 |
| 31 | 3300028379 | Ga0268266_10000434 | Ga0268266_1000043425 | 348 |
| 32 | 3300031250 | Ga0265331_10003187 | Ga0265331_100031879 | 348 |
| 33 | 3300032002 | Ga0307416_100266983 | Ga0307416_1002669832 | 348 |
| 34 | 3300039437 | Ga0436365_1487483 | Ga0436365_1487483_254_1366 | 348 |
| 35 | 3300048929 | Ga0496126_0199165 | Ga0496126_0199165_497_1594 | 348 |
| 36 | 3300005331 | Ga0070670_100033048 | Ga0070670_1000330482 | 349 |
| 37 | 3300005564 | Ga0070664_100044591 | Ga0070664_1000445911 | 349 |
| 38 | 3300014325 | Ga0163163_10050406 | Ga0163163_100504061 | 349 |
| 39 | 3300014745 | Ga0157377_10083404 | Ga0157377_100834042 | 349 |
| 40 | 3300025925 | Ga0207650_10080408 | Ga0207650_100804081 | 349 |
| 41 | 3300030521 | Ga0307511_10002901 | Ga0307511_100029016 | 349 |
| 42 | 3300035113 | Ga0373936_0016056 | Ga0373936_0016056_588_1691 | 349 |
| 43 | 3300037471 | Ga0395905_0189782 | Ga0395905_0189782_98_1198 | 349 |
| 44 | 3300044712 | Ga0453684_0081490 | Ga0453684_0081490_1487_2584 | 349 |
| 45 | 3300047443 | Ga0495687_027749 | Ga0495687_027749_259_1371 | 349 |
| 46 | 3300053115 | Ga0500591_037993 | Ga0500591_037993_995_2098 | 349 |
| 47 | 3300005548 | Ga0070665_100018086 | Ga0070665_1000180862 | 350 |
| 48 | 3300021377 | Ga0213874_10007226 | Ga0213874_100072262 | 350 |
| 49 | 3300028379 | Ga0268266_10012211 | Ga0268266_100122112 | 350 |
| 50 | 3300039450 | Ga0436363_0652634 | Ga0436363_0652634_3509_4609 | 350 |
| 51 | 3300053092 | Ga0500583_0011949 | Ga0500583_0011949_1814_2923 | 350 |
| 52 | 3300053153 | Ga0500616_0000425 | Ga0500616_0000425_20904_22013 | 350 |
| 53 | 3300005337 | Ga0070682_100069044 | Ga0070682_1000690442 | 351 |
| 54 | 3300005719 | Ga0068861_100004302 | Ga0068861_1000043028 | 351 |
| 55 | 3300009093 | Ga0105240_10078077 | Ga0105240_100780775 | 351 |
| 56 | 3300026118 | Ga0207675_100004588 | Ga0207675_1000045883 | 351 |
| 57 | 3300031507 | Ga0307509_10000230 | Ga0307509_1000023011 | 351 |
| 58 | 3300031507 | Ga0307509_10024157 | Ga0307509_100241572 | 351 |
| 59 | 3300046460 | Ga0495638_0009998 | Ga0495638_0009998_3599_4702 | 351 |
| 60 | 3300046460 | Ga0495638_0014722 | Ga0495638_0014722_581_1690 | 351 |
| 61 | 3300046660 | Ga0495625_0019771 | Ga0495625_0019771_1061_2170 | 351 |
| 62 | 3300009551 | Ga0105238_10151016 | Ga0105238_101510161 | 352 |
| 63 | 3300025938 | Ga0207704_10204089 | Ga0207704_102040892 | 352 |
| 64 | 3300048923 | Ga0496120_0000611 | Ga0496120_0000611_51961_53061 | 352 |
| 65 | 3300005436 | Ga0070713_100416090 | Ga0070713_1004160901 | 354 |
| 66 | 3300009545 | Ga0105237_10148222 | Ga0105237_101482222 | 354 |
| 67 | 3300025928 | Ga0207700_10063142 | Ga0207700_100631421 | 354 |
| 68 | 3300025934 | Ga0207686_10051576 | Ga0207686_100515763 | 354 |
| 69 | 3300025942 | Ga0207689_10093467 | Ga0207689_100934672 | 354 |
| 70 | 3300026118 | Ga0207675_100054852 | Ga0207675_1000548523 | 354 |
| 71 | 3300046460 | Ga0495638_0150318 | Ga0495638_0150318_221_1324 | 354 |
| 72 | 3300046660 | Ga0495625_0058678 | Ga0495625_0058678_1062_2162 | 354 |
| 73 | 3300005333 | Ga0070677_10013192 | Ga0070677_100131922 | 355 |
| 74 | 3300005354 | Ga0070675_100132399 | Ga0070675_1001323992 | 355 |
| 75 | 3300005456 | Ga0070678_100238027 | Ga0070678_1002380271 | 355 |
| 76 | 3300005719 | Ga0068861_100058786 | Ga0068861_1000587863 | 355 |
| 77 | 3300005840 | Ga0068870_10003132 | Ga0068870_100031329 | 355 |
| 78 | 3300005844 | Ga0068862_100123669 | Ga0068862_1001236692 | 355 |
| 79 | 3300009093 | Ga0105240_10016668 | Ga0105240_100166686 | 355 |
| 80 | 3300025315 | Ga0207697_10006704 | Ga0207697_100067041 | 355 |
| 81 | 3300025908 | Ga0207643_10030597 | Ga0207643_100305972 | 355 |
| 82 | 3300025933 | Ga0207706_10319639 | Ga0207706_103196391 | 355 |
| 83 | 3300025940 | Ga0207691_10162222 | Ga0207691_101622222 | 355 |
| 84 | 3300026121 | Ga0207683_10069943 | Ga0207683_100699432 | 355 |
| 85 | 3300028380 | Ga0268265_10028878 | Ga0268265_100288782 | 355 |
| 86 | 3300036401 | Ga0373937_0068023 | Ga0373937_0068023_1637_2806 | 355 |
| 87 | 3300049572 | Ga0501036_0190276 | Ga0501036_0190276_193_1272 | 355 |
| 88 | 3300028794 | Ga0307515_10007927 | Ga0307515_100079273 | 356 |
| 89 | 3300053092 | Ga0500583_0041494 | Ga0500583_0041494_957_2027 | 356 |
| 90 | 3300037418 | Ga0395900_0054518 | Ga0395900_0054518_2740_3822 | 357 |
| 91 | 3300048927 | Ga0496124_0085428 | Ga0496124_0085428_110_1195 | 358 |
| 92 | iso_pu_bacteria | 2928503688 | 2928510092 | 359 |
| 93 | 3300005336 | Ga0070680_100008056 | Ga0070680_1000080564 | 361 |
| 94 | 3300005336 | Ga0070680_100109042 | Ga0070680_1001090422 | 361 |
| 95 | 3300005458 | Ga0070681_10008879 | Ga0070681_100088795 | 361 |
| 96 | 3300005458 | Ga0070681_10012315 | Ga0070681_100123152 | 361 |
| 97 | 3300005530 | Ga0070679_100069610 | Ga0070679_1000696103 | 361 |
| 98 | 3300005563 | Ga0068855_100014452 | Ga0068855_1000144526 | 361 |
| 99 | 3300005563 | Ga0068855_100217633 | Ga0068855_1002176332 | 361 |
| 100 | 3300009093 | Ga0105240_10027153 | Ga0105240_100271539 | 361 |
| 101 | 3300009093 | Ga0105240_10179020 | Ga0105240_101790202 | 361 |
| 102 | 3300009551 | Ga0105238_10002575 | Ga0105238_100025756 | 361 |
| 103 | 3300009551 | Ga0105238_10112209 | Ga0105238_101122092 | 361 |
| 104 | 3300013104 | Ga0157370_10001137 | Ga0157370_1000113716 | 361 |
| 105 | 3300013104 | Ga0157370_10090146 | Ga0157370_100901462 | 361 |
| 106 | 3300013105 | Ga0157369_10008496 | Ga0157369_1000849611 | 361 |
| 107 | 3300025912 | Ga0207707_10000390 | Ga0207707_1000039021 | 361 |
| 108 | 3300025912 | Ga0207707_10004165 | Ga0207707_1000416510 | 361 |
| 109 | 3300025912 | Ga0207707_10029813 | Ga0207707_100298133 | 361 |
| 110 | 3300025913 | Ga0207695_10014705 | Ga0207695_100147057 | 361 |
| 111 | 3300025917 | Ga0207660_10001712 | Ga0207660_1000171211 | 361 |
| 112 | 3300025921 | Ga0207652_10000362 | Ga0207652_1000036222 | 361 |
| 113 | 3300025949 | Ga0207667_10002859 | Ga0207667_100028596 | 361 |
| 114 | 3300025949 | Ga0207667_10077183 | Ga0207667_100771834 | 361 |
| 115 | 3300031247 | Ga0265340_10006960 | Ga0265340_100069602 | 361 |
| 116 | 3300046530 | Ga0495654_0106461 | Ga0495654_0106461_10_1116 | 361 |
| 117 | 3300046539 | Ga0495621_0000098 | Ga0495621_0000098_5238_6344 | 361 |
| 118 | 3300046681 | Ga0495647_0001846 | Ga0495647_0001846_4681_5787 | 361 |
| 119 | 3300046683 | Ga0495658_0017921 | Ga0495658_0017921_1555_2661 | 361 |
| 120 | 3300047317 | Ga0495604_0085790 | Ga0495604_0085790_648_1754 | 361 |
| 121 | 3300042014 | Ga0439457_010026 | Ga0439457_010026_502_1596 | 362 |
| 122 | 3300003322 | rootL2_10152448 | rootL2_101524486 | 363 |
| 123 | 3300003323 | rootH1_10294463 | rootH1_102944631 | 363 |
| 124 | 3300003771 | Ga0055526_1002136 | Ga0055526_10021363 | 363 |
| 125 | 3300005328 | Ga0070676_10135679 | Ga0070676_101356792 | 363 |
| 126 | 3300005330 | Ga0070690_100037027 | Ga0070690_1000370273 | 363 |
| 127 | 3300005331 | Ga0070670_100007813 | Ga0070670_1000078134 | 363 |
| 128 | 3300005335 | Ga0070666_10016555 | Ga0070666_100165554 | 363 |
| 129 | 3300005335 | Ga0070666_10103969 | Ga0070666_101039692 | 363 |
| 130 | 3300005337 | Ga0070682_100076479 | Ga0070682_1000764791 | 363 |
| 131 | 3300005338 | Ga0068868_100000140 | Ga0068868_1000001408 | 363 |
| 132 | 3300005340 | Ga0070689_100002094 | Ga0070689_1000020946 | 363 |
| 133 | 3300005340 | Ga0070689_100019054 | Ga0070689_1000190543 | 363 |
| 134 | 3300005343 | Ga0070687_100151182 | Ga0070687_1001511821 | 363 |
| 135 | 3300005345 | Ga0070692_10044986 | Ga0070692_100449861 | 363 |
| 136 | 3300005347 | Ga0070668_100026731 | Ga0070668_1000267312 | 363 |
| 137 | 3300005354 | Ga0070675_100001548 | Ga0070675_10000154816 | 363 |
| 138 | 3300005354 | Ga0070675_100089650 | Ga0070675_1000896502 | 363 |
| 139 | 3300005355 | Ga0070671_100001122 | Ga0070671_10000112211 | 363 |
| 140 | 3300005355 | Ga0070671_100011867 | Ga0070671_1000118675 | 363 |
| 141 | 3300005356 | Ga0070674_100048451 | Ga0070674_1000484512 | 363 |
| 142 | 3300005364 | Ga0070673_100017955 | Ga0070673_1000179552 | 363 |
| 143 | 3300005364 | Ga0070673_100022997 | Ga0070673_1000229972 | 363 |
| 144 | 3300005364 | Ga0070673_100123663 | Ga0070673_1001236632 | 363 |
| 145 | 3300005365 | Ga0070688_100077016 | Ga0070688_1000770162 | 363 |
| 146 | 3300005366 | Ga0070659_100371533 | Ga0070659_1003715331 | 363 |
| 147 | 3300005367 | Ga0070667_100028019 | Ga0070667_1000280192 | 363 |
| 148 | 3300005367 | Ga0070667_100235148 | Ga0070667_1002351482 | 363 |
| 149 | 3300005436 | Ga0070713_100073393 | Ga0070713_1000733932 | 363 |
| 150 | 3300005436 | Ga0070713_100140055 | Ga0070713_1001400552 | 363 |
| 151 | 3300005438 | Ga0070701_10000431 | Ga0070701_100004312 | 363 |
| 152 | 3300005438 | Ga0070701_10008839 | Ga0070701_100088393 | 363 |
| 153 | 3300005439 | Ga0070711_100095854 | Ga0070711_1000958542 | 363 |
| 154 | 3300005440 | Ga0070705_100008220 | Ga0070705_1000082204 | 363 |
| 155 | 3300005441 | Ga0070700_100007785 | Ga0070700_1000077852 | 363 |
| 156 | 3300005441 | Ga0070700_100016204 | Ga0070700_1000162042 | 363 |
| 157 | 3300005441 | Ga0070700_100171059 | Ga0070700_1001710592 | 363 |
| 158 | 3300005444 | Ga0070694_100033883 | Ga0070694_1000338831 | 363 |
| 159 | 3300005456 | Ga0070678_100008413 | Ga0070678_1000084135 | 363 |
| 160 | 3300005457 | Ga0070662_100068972 | Ga0070662_1000689722 | 363 |
| 161 | 3300005458 | Ga0070681_10102044 | Ga0070681_101020442 | 363 |
| 162 | 3300005466 | Ga0070685_10005916 | Ga0070685_100059162 | 363 |
| 163 | 3300005518 | Ga0070699_100190862 | Ga0070699_1001908622 | 363 |
| 164 | 3300005530 | Ga0070679_100025542 | Ga0070679_1000255424 | 363 |
| 165 | 3300005530 | Ga0070679_100052292 | Ga0070679_1000522922 | 363 |
| 166 | 3300005530 | Ga0070679_100229084 | Ga0070679_1002290842 | 363 |
| 167 | 3300005535 | Ga0070684_100002177 | Ga0070684_10000217710 | 363 |
| 168 | 3300005535 | Ga0070684_100002931 | Ga0070684_1000029314 | 363 |
| 169 | 3300005544 | Ga0070686_100006322 | Ga0070686_1000063222 | 363 |
| 170 | 3300005544 | Ga0070686_100010638 | Ga0070686_1000106384 | 363 |
| 171 | 3300005546 | Ga0070696_100008903 | Ga0070696_1000089034 | 363 |
| 172 | 3300005546 | Ga0070696_100167295 | Ga0070696_1001672952 | 363 |
| 173 | 3300005547 | Ga0070693_100138969 | Ga0070693_1001389692 | 363 |
| 174 | 3300005548 | Ga0070665_100001536 | Ga0070665_10000153611 | 363 |
| 175 | 3300005548 | Ga0070665_100027915 | Ga0070665_1000279152 | 363 |
| 176 | 3300005548 | Ga0070665_100030433 | Ga0070665_1000304336 | 363 |
| 177 | 3300005548 | Ga0070665_100046103 | Ga0070665_1000461033 | 363 |
| 178 | 3300005548 | Ga0070665_100057574 | Ga0070665_1000575742 | 363 |
| 179 | 3300005563 | Ga0068855_100000562 | Ga0068855_10000056221 | 363 |
| 180 | 3300005563 | Ga0068855_100029840 | Ga0068855_1000298401 | 363 |
| 181 | 3300005563 | Ga0068855_100269160 | Ga0068855_1002691602 | 363 |
| 182 | 3300005564 | Ga0070664_100005398 | Ga0070664_1000053986 | 363 |
| 183 | 3300005564 | Ga0070664_100110445 | Ga0070664_1001104452 | 363 |
| 184 | 3300005577 | Ga0068857_100011898 | Ga0068857_1000118982 | 363 |
| 185 | 3300005577 | Ga0068857_100222080 | Ga0068857_1002220802 | 363 |
| 186 | 3300005615 | Ga0070702_100003887 | Ga0070702_1000038872 | 363 |
| 187 | 3300005615 | Ga0070702_100006036 | Ga0070702_1000060361 | 363 |
| 188 | 3300005616 | Ga0068852_100068566 | Ga0068852_1000685662 | 363 |
| 189 | 3300005616 | Ga0068852_100114550 | Ga0068852_1001145502 | 363 |
| 190 | 3300005617 | Ga0068859_100000172 | Ga0068859_10000017253 | 363 |
| 191 | 3300005617 | Ga0068859_100006664 | Ga0068859_1000066649 | 363 |
| 192 | 3300005617 | Ga0068859_100019018 | Ga0068859_1000190184 | 363 |
| 193 | 3300005617 | Ga0068859_100021669 | Ga0068859_1000216692 | 363 |
| 194 | 3300005618 | Ga0068864_100003919 | Ga0068864_1000039199 | 363 |
| 195 | 3300005618 | Ga0068864_100009799 | Ga0068864_1000097992 | 363 |
| 196 | 3300005719 | Ga0068861_100066944 | Ga0068861_1000669441 | 363 |
| 197 | 3300005719 | Ga0068861_100072452 | Ga0068861_1000724522 | 363 |
| 198 | 3300005719 | Ga0068861_100080463 | Ga0068861_1000804632 | 363 |
| 199 | 3300005841 | Ga0068863_100001117 | Ga0068863_10000111717 | 363 |
| 200 | 3300005841 | Ga0068863_100002743 | Ga0068863_1000027435 | 363 |
| 201 | 3300005841 | Ga0068863_100006049 | Ga0068863_1000060493 | 363 |
| 202 | 3300005841 | Ga0068863_100048271 | Ga0068863_1000482712 | 363 |
| 203 | 3300005841 | Ga0068863_100233297 | Ga0068863_1002332971 | 363 |
| 204 | 3300005842 | Ga0068858_100000406 | Ga0068858_10000040636 | 363 |
| 205 | 3300005842 | Ga0068858_100014718 | Ga0068858_1000147185 | 363 |
| 206 | 3300005843 | Ga0068860_100011976 | Ga0068860_1000119762 | 363 |
| 207 | 3300005843 | Ga0068860_100017378 | Ga0068860_1000173783 | 363 |
| 208 | 3300005843 | Ga0068860_100053595 | Ga0068860_1000535955 | 363 |
| 209 | 3300005843 | Ga0068860_100054216 | Ga0068860_1000542162 | 363 |
| 210 | 3300005844 | Ga0068862_100008766 | Ga0068862_1000087664 | 363 |
| 211 | 3300005844 | Ga0068862_100015840 | Ga0068862_1000158402 | 363 |
| 212 | 3300005844 | Ga0068862_100021077 | Ga0068862_1000210773 | 363 |
| 213 | 3300005844 | Ga0068862_100210762 | Ga0068862_1002107622 | 363 |
| 214 | 3300005937 | Ga0081455_10000656 | Ga0081455_1000065643 | 363 |
| 215 | 3300005985 | Ga0081539_10000058 | Ga0081539_1000005858 | 363 |
| 216 | 3300006028 | Ga0070717_10022516 | Ga0070717_100225166 | 363 |
| 217 | 3300006358 | Ga0068871_100095317 | Ga0068871_1000953173 | 363 |
| 218 | 3300006844 | Ga0075428_100006380 | Ga0075428_1000063803 | 363 |
| 219 | 3300006844 | Ga0075428_100023951 | Ga0075428_1000239514 | 363 |
| 220 | 3300006846 | Ga0075430_100003451 | Ga0075430_10000345111 | 363 |
| 221 | 3300006846 | Ga0075430_100069306 | Ga0075430_1000693062 | 363 |
| 222 | 3300006847 | Ga0075431_100000091 | Ga0075431_1000000912 | 363 |
| 223 | 3300006847 | Ga0075431_100035584 | Ga0075431_1000355842 | 363 |
| 224 | 3300006852 | Ga0075433_10023945 | Ga0075433_100239452 | 363 |
| 225 | 3300006880 | Ga0075429_100003083 | Ga0075429_10000308311 | 363 |
| 226 | 3300006931 | Ga0097620_100000172 | Ga0097620_10000017253 | 363 |
| 227 | 3300006931 | Ga0097620_100006664 | Ga0097620_1000066649 | 363 |
| 228 | 3300006931 | Ga0097620_100019017 | Ga0097620_1000190172 | 363 |
| 229 | 3300006931 | Ga0097620_100021667 | Ga0097620_1000216675 | 363 |
| 230 | 3300007788 | Ga0099795_10000004 | Ga0099795_100000045 | 363 |
| 231 | 3300009092 | Ga0105250_10000024 | Ga0105250_10000024174 | 363 |
| 232 | 3300009092 | Ga0105250_10025793 | Ga0105250_100257932 | 363 |
| 233 | 3300009093 | Ga0105240_10002675 | Ga0105240_1000267525 | 363 |
| 234 | 3300009093 | Ga0105240_10014372 | Ga0105240_100143729 | 363 |
| 235 | 3300009093 | Ga0105240_10032315 | Ga0105240_100323157 | 363 |
| 236 | 3300009093 | Ga0105240_10110960 | Ga0105240_101109602 | 363 |
| 237 | 3300009093 | Ga0105240_10113671 | Ga0105240_101136712 | 363 |
| 238 | 3300009093 | Ga0105240_10197594 | Ga0105240_101975942 | 363 |
| 239 | 3300009094 | Ga0111539_10006586 | Ga0111539_100065869 | 363 |
| 240 | 3300009094 | Ga0111539_10009504 | Ga0111539_100095042 | 363 |
| 241 | 3300009094 | Ga0111539_10036816 | Ga0111539_100368166 | 363 |
| 242 | 3300009094 | Ga0111539_10185713 | Ga0111539_101857132 | 363 |
| 243 | 3300009098 | Ga0105245_10002513 | Ga0105245_100025139 | 363 |
| 244 | 3300009098 | Ga0105245_10103683 | Ga0105245_101036832 | 363 |
| 245 | 3300009101 | Ga0105247_10000270 | Ga0105247_1000027014 | 363 |
| 246 | 3300009101 | Ga0105247_10000853 | Ga0105247_1000085319 | 363 |
| 247 | 3300009147 | Ga0114129_10000484 | Ga0114129_1000048439 | 363 |
| 248 | 3300009148 | Ga0105243_10109301 | Ga0105243_101093011 | 363 |
| 249 | 3300009176 | Ga0105242_10186983 | Ga0105242_101869831 | 363 |
| 250 | 3300009177 | Ga0105248_10010700 | Ga0105248_100107009 | 363 |
| 251 | 3300009177 | Ga0105248_10051218 | Ga0105248_100512183 | 363 |
| 252 | 3300009177 | Ga0105248_10051726 | Ga0105248_100517262 | 363 |
| 253 | 3300009545 | Ga0105237_10013224 | Ga0105237_100132246 | 363 |
| 254 | 3300009551 | Ga0105238_10058962 | Ga0105238_100589622 | 363 |
| 255 | 3300009551 | Ga0105238_10074190 | Ga0105238_100741902 | 363 |
| 256 | 3300009551 | Ga0105238_10109079 | Ga0105238_101090791 | 363 |
| 257 | 3300009551 | Ga0105238_10128243 | Ga0105238_101282432 | 363 |
| 258 | 3300009553 | Ga0105249_10004587 | Ga0105249_100045871 | 363 |
| 259 | 3300009553 | Ga0105249_10036356 | Ga0105249_100363565 | 363 |
| 260 | 3300009553 | Ga0105249_10077304 | Ga0105249_100773042 | 363 |
| 261 | 3300009553 | Ga0105249_10221883 | Ga0105249_102218832 | 363 |
| 262 | 3300010159 | Ga0099796_10000006 | Ga0099796_1000000656 | 363 |
| 263 | 3300010375 | Ga0105239_10020008 | Ga0105239_100200082 | 363 |
| 264 | 3300011119 | Ga0105246_10000648 | Ga0105246_1000064817 | 363 |
| 265 | 3300013105 | Ga0157369_10089349 | Ga0157369_100893493 | 363 |
| 266 | 3300013105 | Ga0157369_10286583 | Ga0157369_102865832 | 363 |
| 267 | 3300013296 | Ga0157374_10000998 | Ga0157374_1000099817 | 363 |
| 268 | 3300013296 | Ga0157374_10384637 | Ga0157374_103846372 | 363 |
| 269 | 3300013297 | Ga0157378_10142943 | Ga0157378_101429432 | 363 |
| 270 | 3300013306 | Ga0163162_10005163 | Ga0163162_100051632 | 363 |
| 271 | 3300013306 | Ga0163162_10154988 | Ga0163162_101549882 | 363 |
| 272 | 3300013306 | Ga0163162_10229671 | Ga0163162_102296712 | 363 |
| 273 | 3300013307 | Ga0157372_10075950 | Ga0157372_100759502 | 363 |
| 274 | 3300014325 | Ga0163163_10001153 | Ga0163163_1000115310 | 363 |
| 275 | 3300014325 | Ga0163163_10001836 | Ga0163163_100018364 | 363 |
| 276 | 3300014326 | Ga0157380_10014279 | Ga0157380_100142795 | 363 |
| 277 | 3300014326 | Ga0157380_10161361 | Ga0157380_101613611 | 363 |
| 278 | 3300014968 | Ga0157379_10001338 | Ga0157379_100013382 | 363 |
| 279 | 3300014968 | Ga0157379_10259285 | Ga0157379_102592852 | 363 |
| 280 | 3300014969 | Ga0157376_10014933 | Ga0157376_100149332 | 363 |
| 281 | 3300017792 | Ga0163161_10188205 | Ga0163161_101882052 | 363 |
| 282 | 3300025295 | Ga0209564_1002644 | Ga0209564_10026443 | 363 |
| 283 | 3300025711 | Ga0207696_1000383 | Ga0207696_10003837 | 363 |
| 284 | 3300025900 | Ga0207710_10000280 | Ga0207710_1000028032 | 363 |
| 285 | 3300025900 | Ga0207710_10004906 | Ga0207710_100049062 | 363 |
| 286 | 3300025903 | Ga0207680_10010839 | Ga0207680_100108392 | 363 |
| 287 | 3300025905 | Ga0207685_10028339 | Ga0207685_100283392 | 363 |
| 288 | 3300025907 | Ga0207645_10071162 | Ga0207645_100711622 | 363 |
| 289 | 3300025912 | Ga0207707_10123116 | Ga0207707_101231162 | 363 |
| 290 | 3300025912 | Ga0207707_10148105 | Ga0207707_101481052 | 363 |
| 291 | 3300025913 | Ga0207695_10003577 | Ga0207695_100035773 | 363 |
| 292 | 3300025913 | Ga0207695_10031342 | Ga0207695_100313424 | 363 |
| 293 | 3300025913 | Ga0207695_10089230 | Ga0207695_100892303 | 363 |
| 294 | 3300025913 | Ga0207695_10096021 | Ga0207695_100960213 | 363 |
| 295 | 3300025913 | Ga0207695_10121021 | Ga0207695_101210211 | 363 |
| 296 | 3300025913 | Ga0207695_10347469 | Ga0207695_103474692 | 363 |
| 297 | 3300025914 | Ga0207671_10034467 | Ga0207671_100344671 | 363 |
| 298 | 3300025916 | Ga0207663_10042186 | Ga0207663_100421863 | 363 |
| 299 | 3300025921 | Ga0207652_10019306 | Ga0207652_100193062 | 363 |
| 300 | 3300025921 | Ga0207652_10133026 | Ga0207652_101330262 | 363 |
| 301 | 3300025925 | Ga0207650_10039896 | Ga0207650_100398962 | 363 |
| 302 | 3300025925 | Ga0207650_10082141 | Ga0207650_100821411 | 363 |
| 303 | 3300025926 | Ga0207659_10013690 | Ga0207659_100136903 | 363 |
| 304 | 3300025927 | Ga0207687_10117132 | Ga0207687_101171321 | 363 |
| 305 | 3300025928 | Ga0207700_10051576 | Ga0207700_100515762 | 363 |
| 306 | 3300025928 | Ga0207700_10084112 | Ga0207700_100841122 | 363 |
| 307 | 3300025929 | Ga0207664_10023877 | Ga0207664_100238776 | 363 |
| 308 | 3300025931 | Ga0207644_10012327 | Ga0207644_100123272 | 363 |
| 309 | 3300025933 | Ga0207706_10068696 | Ga0207706_100686962 | 363 |
| 310 | 3300025933 | Ga0207706_10104843 | Ga0207706_101048433 | 363 |
| 311 | 3300025935 | Ga0207709_10031426 | Ga0207709_100314262 | 363 |
| 312 | 3300025940 | Ga0207691_10030738 | Ga0207691_100307382 | 363 |
| 313 | 3300025941 | Ga0207711_10002654 | Ga0207711_100026548 | 363 |
| 314 | 3300025942 | Ga0207689_10009867 | Ga0207689_100098672 | 363 |
| 315 | 3300025945 | Ga0207679_10026155 | Ga0207679_100261552 | 363 |
| 316 | 3300025949 | Ga0207667_10001313 | Ga0207667_100013133 | 363 |
| 317 | 3300025960 | Ga0207651_10030241 | Ga0207651_100302413 | 363 |
| 318 | 3300025960 | Ga0207651_10122240 | Ga0207651_101222402 | 363 |
| 319 | 3300025961 | Ga0207712_10007380 | Ga0207712_100073802 | 363 |
| 320 | 3300025986 | Ga0207658_10060404 | Ga0207658_100604041 | 363 |
| 321 | 3300025986 | Ga0207658_10139566 | Ga0207658_101395662 | 363 |
| 322 | 3300025986 | Ga0207658_10196027 | Ga0207658_101960272 | 363 |
| 323 | 3300026035 | Ga0207703_10001744 | Ga0207703_1000174412 | 363 |
| 324 | 3300026035 | Ga0207703_10002741 | Ga0207703_1000274114 | 363 |
| 325 | 3300026035 | Ga0207703_10006124 | Ga0207703_100061247 | 363 |
| 326 | 3300026067 | Ga0207678_10014042 | Ga0207678_100140422 | 363 |
| 327 | 3300026075 | Ga0207708_10007427 | Ga0207708_100074272 | 363 |
| 328 | 3300026075 | Ga0207708_10014840 | Ga0207708_100148402 | 363 |
| 329 | 3300026088 | Ga0207641_10000258 | Ga0207641_1000025824 | 363 |
| 330 | 3300026088 | Ga0207641_10013307 | Ga0207641_100133076 | 363 |
| 331 | 3300026088 | Ga0207641_10014296 | Ga0207641_100142962 | 363 |
| 332 | 3300026088 | Ga0207641_10152323 | Ga0207641_101523231 | 363 |
| 333 | 3300026089 | Ga0207648_10002079 | Ga0207648_1000207921 | 363 |
| 334 | 3300026089 | Ga0207648_10020677 | Ga0207648_100206772 | 363 |
| 335 | 3300026089 | Ga0207648_10044858 | Ga0207648_100448582 | 363 |
| 336 | 3300026095 | Ga0207676_10001802 | Ga0207676_100018028 | 363 |
| 337 | 3300026116 | Ga0207674_10022134 | Ga0207674_100221343 | 363 |
| 338 | 3300026118 | Ga0207675_100008159 | Ga0207675_1000081596 | 363 |
| 339 | 3300026118 | Ga0207675_100019481 | Ga0207675_1000194817 | 363 |
| 340 | 3300026118 | Ga0207675_100025052 | Ga0207675_1000250527 | 363 |
| 341 | 3300026118 | Ga0207675_100025506 | Ga0207675_1000255062 | 363 |
| 342 | 3300026118 | Ga0207675_100026436 | Ga0207675_1000264366 | 363 |
| 343 | 3300026118 | Ga0207675_100027649 | Ga0207675_1000276494 | 363 |
| 344 | 3300026118 | Ga0207675_100034285 | Ga0207675_1000342852 | 363 |
| 345 | 3300026118 | Ga0207675_100253513 | Ga0207675_1002535132 | 363 |
| 346 | 3300026118 | Ga0207675_100412543 | Ga0207675_1004125432 | 363 |
| 347 | 3300026121 | Ga0207683_10009122 | Ga0207683_100091225 | 363 |
| 348 | 3300026142 | Ga0207698_10094547 | Ga0207698_100945472 | 363 |
| 349 | 3300027512 | Ga0209179_1000092 | Ga0209179_10000923 | 363 |
| 350 | 3300027907 | Ga0207428_10011062 | Ga0207428_100110622 | 363 |
| 351 | 3300028379 | Ga0268266_10002255 | Ga0268266_1000225516 | 363 |
| 352 | 3300028379 | Ga0268266_10012944 | Ga0268266_100129445 | 363 |
| 353 | 3300028379 | Ga0268266_10027825 | Ga0268266_100278252 | 363 |
| 354 | 3300028379 | Ga0268266_10074833 | Ga0268266_100748332 | 363 |
| 355 | 3300028379 | Ga0268266_10082500 | Ga0268266_100825001 | 363 |
| 356 | 3300028380 | Ga0268265_10008129 | Ga0268265_100081297 | 363 |
| 357 | 3300028380 | Ga0268265_10009404 | Ga0268265_100094042 | 363 |
| 358 | 3300028380 | Ga0268265_10017561 | Ga0268265_100175615 | 363 |
| 359 | 3300028380 | Ga0268265_10022078 | Ga0268265_100220784 | 363 |
| 360 | 3300028380 | Ga0268265_10025057 | Ga0268265_100250572 | 363 |
| 361 | 3300028381 | Ga0268264_10000034 | Ga0268264_10000034145 | 363 |
| 362 | 3300028381 | Ga0268264_10004901 | Ga0268264_100049017 | 363 |
| 363 | 3300028381 | Ga0268264_10076468 | Ga0268264_100764682 | 363 |
| 364 | 3300028381 | Ga0268264_10126559 | Ga0268264_101265592 | 363 |
| 365 | 3300028573 | Ga0265334_10000008 | Ga0265334_1000000820 | 363 |
| 366 | 3300028577 | Ga0265318_10001166 | Ga0265318_1000116612 | 363 |
| 367 | 3300028794 | Ga0307515_10161418 | Ga0307515_101614182 | 363 |
| 368 | 3300028800 | Ga0265338_10015718 | Ga0265338_100157183 | 363 |
| 369 | 3300030521 | Ga0307511_10000260 | Ga0307511_100002604 | 363 |
| 370 | 3300031235 | Ga0265330_10012426 | Ga0265330_100124265 | 363 |
| 371 | 3300031238 | Ga0265332_10001420 | Ga0265332_100014206 | 363 |
| 372 | 3300031239 | Ga0265328_10028428 | Ga0265328_100284282 | 363 |
| 373 | 3300031240 | Ga0265320_10005651 | Ga0265320_100056518 | 363 |
| 374 | 3300031242 | Ga0265329_10014612 | Ga0265329_100146122 | 363 |
| 375 | 3300031247 | Ga0265340_10107668 | Ga0265340_101076681 | 363 |
| 376 | 3300031249 | Ga0265339_10030212 | Ga0265339_100302124 | 363 |
| 377 | 3300031250 | Ga0265331_10006528 | Ga0265331_100065288 | 363 |
| 378 | 3300031344 | Ga0265316_10002874 | Ga0265316_100028747 | 363 |
| 379 | 3300031548 | Ga0307408_100093129 | Ga0307408_1000931292 | 363 |
| 380 | 3300031595 | Ga0265313_10000807 | Ga0265313_1000080711 | 363 |
| 381 | 3300031595 | Ga0265313_10004882 | Ga0265313_100048828 | 363 |
| 382 | 3300031616 | Ga0307508_10029327 | Ga0307508_100293274 | 363 |
| 383 | 3300031691 | Ga0316579_10004221 | Ga0316579_100042213 | 363 |
| 384 | 3300031711 | Ga0265314_10017406 | Ga0265314_100174063 | 363 |
| 385 | 3300031712 | Ga0265342_10009330 | Ga0265342_100093304 | 363 |
| 386 | 3300031727 | Ga0316576_10136120 | Ga0316576_101361202 | 363 |
| 387 | 3300031728 | Ga0316578_10014334 | Ga0316578_100143343 | 363 |
| 388 | 3300031731 | Ga0307405_10106237 | Ga0307405_101062372 | 363 |
| 389 | 3300031733 | Ga0316577_10012878 | Ga0316577_100128783 | 363 |
| 390 | 3300031733 | Ga0316577_10078132 | Ga0316577_100781321 | 363 |
| 391 | 3300031824 | Ga0307413_10004222 | Ga0307413_100042222 | 363 |
| 392 | 3300031824 | Ga0307413_10010556 | Ga0307413_100105561 | 363 |
| 393 | 3300031852 | Ga0307410_10030143 | Ga0307410_100301433 | 363 |
| 394 | 3300031852 | Ga0307410_10043195 | Ga0307410_100431952 | 363 |
| 395 | 3300031901 | Ga0307406_10016081 | Ga0307406_100160815 | 363 |
| 396 | 3300031901 | Ga0307406_10101213 | Ga0307406_101012132 | 363 |
| 397 | 3300031995 | Ga0307409_100004229 | Ga0307409_1000042293 | 363 |
| 398 | 3300032002 | Ga0307416_100105812 | Ga0307416_1001058122 | 363 |
| 399 | 3300032002 | Ga0307416_100134069 | Ga0307416_1001340692 | 363 |
| 400 | 3300032004 | Ga0307414_10200731 | Ga0307414_102007312 | 363 |
| 401 | 3300032005 | Ga0307411_10001359 | Ga0307411_100013592 | 363 |
| 402 | 3300032005 | Ga0307411_10104919 | Ga0307411_101049191 | 363 |
| 403 | 3300032005 | Ga0307411_10324473 | Ga0307411_103244732 | 363 |
| 404 | 3300032137 | Ga0316585_10016273 | Ga0316585_100162732 | 363 |
| 405 | 3300032139 | Ga0316580_10003296 | Ga0316580_100032964 | 363 |
| 406 | 3300033180 | Ga0307510_10000005 | Ga0307510_10000005306 | 363 |
| 407 | 3300035118 | Ga0373954_0061443 | Ga0373954_0061443_478_1581 | 363 |
| 408 | 3300035119 | Ga0373956_0065269 | Ga0373956_0065269_85_1182 | 363 |
| 409 | 3300035172 | Ga0373955_0033267 | Ga0373955_0033267_1358_2551 | 363 |
| 410 | 3300035398 | Ga0316574_0006599 | Ga0316574_0006599_5122_6219 | 363 |
| 411 | 3300035691 | Ga0373931_0005264 | Ga0373931_0005264_4845_5948 | 363 |
| 412 | 3300035692 | Ga0373935_0235768 | Ga0373935_0235768_119_1216 | 363 |
| 413 | 3300035695 | Ga0373927_0000010 | Ga0373927_0000010_103114_104220 | 363 |
| 414 | 3300035724 | Ga0373933_0205173 | Ga0373933_0205173_133_1236 | 363 |
| 415 | 3300036647 | Ga0316582_0085700 | Ga0316582_0085700_714_1814 | 363 |
| 416 | 3300036647 | Ga0316582_0244873 | Ga0316582_0244873_79_1176 | 363 |
| 417 | 3300036712 | Ga0316584_0003233 | Ga0316584_0003233_4668_5762 | 363 |
| 418 | 3300036712 | Ga0316584_0011108 | Ga0316584_0011108_4007_5104 | 363 |
| 419 | 3300036712 | Ga0316584_0098676 | Ga0316584_0098676_770_1870 | 363 |
| 420 | 3300037068 | Ga0373925_0097611 | Ga0373925_0097611_137_1237 | 363 |
| 421 | 3300037466 | Ga0395898_0067073 | Ga0395898_0067073_591_1697 | 363 |
| 422 | 3300039438 | Ga0436360_0504587 | Ga0436360_0504587_185_1285 | 363 |
| 423 | 3300039447 | Ga0436361_0364378 | Ga0436361_0364378_780_1880 | 363 |
| 424 | 3300042876 | Ga0451577_0011772 | Ga0451577_0011772_2770_3873 | 363 |
| 425 | 3300044656 | Ga0466969_0033435 | Ga0466969_0033435_701_1798 | 363 |
| 426 | 3300044683 | Ga0466965_0026401 | Ga0466965_0026401_167_1273 | 363 |
| 427 | 3300044684 | Ga0466966_0041338 | Ga0466966_0041338_1736_2833 | 363 |
| 428 | 3300044684 | Ga0466966_0050326 | Ga0466966_0050326_292_1386 | 363 |
| 429 | 3300044735 | Ga0466968_0052703 | Ga0466968_0052703_419_1516 | 363 |
| 430 | 3300044765 | Ga0466970_0030194 | Ga0466970_0030194_348_1445 | 363 |
| 431 | 3300045051 | Ga0451576_0177235 | Ga0451576_0177235_44_1147 | 363 |
| 432 | 3300045836 | Ga0466958_0111262 | Ga0466958_0111262_601_1695 | 363 |
| 433 | 3300046457 | Ga0495590_0016665 | Ga0495590_0016665_780_1883 | 363 |
| 434 | 3300046492 | Ga0495585_0069334 | Ga0495585_0069334_83_1186 | 363 |
| 435 | 3300046513 | Ga0495616_0008652 | Ga0495616_0008652_1674_2777 | 363 |
| 436 | 3300046683 | Ga0495658_0137161 | Ga0495658_0137161_35_1132 | 363 |
| 437 | 3300046684 | Ga0495669_0081239 | Ga0495669_0081239_151_1248 | 363 |
| 438 | 3300048905 | Ga0496102_0013374 | Ga0496102_0013374_4272_5372 | 363 |
| 439 | 3300048905 | Ga0496102_0021184 | Ga0496102_0021184_3978_5078 | 363 |
| 440 | 3300048907 | Ga0496104_0012231 | Ga0496104_0012231_4920_6017 | 363 |
| 441 | 3300048911 | Ga0496108_0075209 | Ga0496108_0075209_281_1384 | 363 |
| 442 | 3300048912 | Ga0496109_0038396 | Ga0496109_0038396_1716_2819 | 363 |
| 443 | 3300048913 | Ga0496110_0038902 | Ga0496110_0038902_1374_2477 | 363 |
| 444 | 3300048915 | Ga0496112_0001440 | Ga0496112_0001440_2523_3626 | 363 |
| 445 | 3300048915 | Ga0496112_0063813 | Ga0496112_0063813_23_1120 | 363 |
| 446 | 3300048915 | Ga0496112_0370644 | Ga0496112_0370644_117_1217 | 363 |
| 447 | 3300048917 | Ga0496114_0059651 | Ga0496114_0059651_1200_2303 | 363 |
| 448 | 3300048918 | Ga0496115_0002736 | Ga0496115_0002736_6524_7621 | 363 |
| 449 | 3300048918 | Ga0496115_0074101 | Ga0496115_0074101_1299_2402 | 363 |
| 450 | 3300048919 | Ga0496116_0008520 | Ga0496116_0008520_4660_5760 | 363 |
| 451 | 3300048920 | Ga0496117_0000012 | Ga0496117_0000012_285519_286619 | 363 |
| 452 | 3300048921 | Ga0496118_0000003 | Ga0496118_0000003_689911_691011 | 363 |
| 453 | 3300048922 | Ga0496119_0075283 | Ga0496119_0075283_598_1698 | 363 |
| 454 | 3300048923 | Ga0496120_0021414 | Ga0496120_0021414_1877_2977 | 363 |
| 455 | 3300048924 | Ga0496121_0005660 | Ga0496121_0005660_6675_7775 | 363 |
| 456 | 3300048924 | Ga0496121_0038301 | Ga0496121_0038301_559_1668 | 363 |
| 457 | 3300048924 | Ga0496121_0053909 | Ga0496121_0053909_1467_2582 | 363 |
| 458 | 3300048928 | Ga0496125_0003375 | Ga0496125_0003375_6399_7514 | 363 |
| 459 | 3300048928 | Ga0496125_0011969 | Ga0496125_0011969_5007_6107 | 363 |
| 460 | 3300048928 | Ga0496125_0030028 | Ga0496125_0030028_610_1710 | 363 |
| 461 | 3300048929 | Ga0496126_0024765 | Ga0496126_0024765_1956_3056 | 363 |
| 462 | 3300049568 | Ga0501031_0192745 | Ga0501031_0192745_186_1283 | 363 |
| 463 | 3300049571 | Ga0501034_0434343 | Ga0501034_0434343_87_1187 | 363 |
| 464 | 3300049587 | Ga0501071_0053139 | Ga0501071_0053139_1613_2773 | 363 |
| 465 | 3300049588 | Ga0501072_0026504 | Ga0501072_0026504_2685_3845 | 363 |
| 466 | 3300050507 | nmdc:mga05p37_11639_c1 | nmdc:mga05p37_11639_c1_6905_8002 | 363 |
| 467 | 3300050508 | nmdc:mga09592_1590_c1 | nmdc:mga09592_1590_c1_9805_10902 | 363 |
| 468 | 3300050510 | nmdc:mga06r32_2483_c1 | nmdc:mga06r32_2483_c1_7759_8856 | 363 |
| 469 | 3300050510 | nmdc:mga06r32_29_c1 | nmdc:mga06r32_29_c1_66802_67899 | 363 |
| 470 | 3300050510 | nmdc:mga06r32_64140_c1 | nmdc:mga06r32_64140_c1_1958_3055 | 363 |
| 471 | 3300050511 | nmdc:mga08y16_12268_c1 | nmdc:mga08y16_12268_c1_1172_2269 | 363 |
| 472 | 3300050511 | nmdc:mga08y16_14469_c1 | nmdc:mga08y16_14469_c1_5390_6493 | 363 |
| 473 | 3300050511 | nmdc:mga08y16_180331_c1 | nmdc:mga08y16_180331_c1_726_1829 | 363 |
| 474 | 3300050511 | nmdc:mga08y16_29298_c1 | nmdc:mga08y16_29298_c1_3602_4699 | 363 |
| 475 | 3300053077 | Ga0495601_0013225 | Ga0495601_0013225_520_1623 | 363 |
| 476 | 3300053092 | Ga0500583_0045293 | Ga0500583_0045293_881_1978 | 363 |
| 477 | 3300053096 | Ga0500641_0011417 | Ga0500641_0011417_1384_2478 | 363 |
| 478 | 3300053134 | Ga0500658_0010552 | Ga0500658_0010552_499_1593 | 363 |
| 479 | 3300053146 | Ga0500588_0015997 | Ga0500588_0015997_486_1589 | 363 |
| 480 | 3300053156 | Ga0500622_0003929 | Ga0500622_0003929_8012_9118 | 363 |
| 481 | 3300053156 | Ga0500622_0006901 | Ga0500622_0006901_4315_5421 | 363 |
| 482 | 3300053178 | Ga0500637_0007451 | Ga0500637_0007451_1035_2132 | 363 |
| 483 | 3300053178 | Ga0500637_0089805 | Ga0500637_0089805_203_1303 | 363 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z9a-assembly1.cif.gz_A | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.9724 | 1 | 350 |
| 5z9a-assembly1.cif.gz_A | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.9686 | 1 | 350 |
| 5z9a-assembly1.cif.gz_B | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.9679 | 1 | 350 |
| 5z9a-assembly1.cif.gz_B | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.9641 | 1 | 350 |
| 5wuy-assembly1.cif.gz_B | crystal structure of chorismate synthase from acinetobacter baumannii at 2.50a resolution | 0.944 | 1 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P12008_1_360_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9731 | 1 | 359 | 3.60.150.10 |
| 5z9aA00 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9724 | 1 | 350 | 3.60.150.10 |
| 5z9aA00 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9686 | 1 | 350 | 3.60.150.10 |
| af_P12008_1_360_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9678 | 1 | 359 | 3.60.150.10 |
| af_Q58575_11_372_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9427 | 10 | 346 | 3.60.150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351A1A1-F1-model_v4 | chorismate synthase (EC 4.2.3.5) | 0.9845 | 122 | 297 |
GO:0004107
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
| AF-A0A3M3I9W9-F1-model_v4 | Chorismate synthase (EC 4.2.3.5) | 0.984 | 133 | 360 |
GO:0004107
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
| AF-A0A3M5ZMD9-F1-model_v4 | deleted | 0.9831 | 133 | 360 |
|
| AF-A0A3M4VIF7-F1-model_v4 | deleted | 0.9826 | 133 | 360 |
|
| AF-A0A6D2G5Y5-F1-model_v4 | Chorismate synthase (EC 4.2.3.5) | 0.9805 | 195 | 325 |
GO:0004107
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar