F452730

General Info

Members Datasets Scaffolds Average Seq Length
483 265 966 129

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100353295|Ga0070708_1003532951
Length 138
Sequence MAFGSFDRKSSSQPMAEINMVPLIDVALVLLVIFIVTAPLLTNAVKLDLPKATSNADIQKPEKVEFAIDATGALFWNGERLSREDAIGRFAEAGRKRPQPEVYLRADQNVAYRYVAEMLADASKAGLSKVAFVSEPAR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
191 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
192 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
256 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
257 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
262 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.15
Nodule 0
Rhizoplane 1.04
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100353295 3300005445 Bacteria 1385
2 rootL2_10081356 3300003322 Bacteria 3842
3 Ga0070658_10005430 3300005327 Bacteria 10340
4 Ga0070658_10359003 3300005327 Bacteria 1248
5 Ga0070658_10587857 3300005327 Bacteria 964
6 Ga0070676_10027747 3300005328 Bacteria 3212
7 Ga0070690_101421198 3300005330 Bacteria 559
8 Ga0070670_100470063 3300005331 Bacteria 1116
9 Ga0070670_101159335 3300005331 Bacteria 706
10 Ga0070670_101318997 3300005331 Bacteria 661
11 Ga0068869_100116126 3300005334 Bacteria 2041
12 Ga0068869_100328116 3300005334 Bacteria 1243
13 Ga0068869_101082869 3300005334 Bacteria 701
14 Ga0070666_10887729 3300005335 Bacteria 659
15 Ga0070680_100135902 3300005336 Bacteria 2059
16 Ga0070682_100853038 3300005337 Bacteria 744
17 Ga0068868_100150013 3300005338 Bacteria 1919
18 Ga0068868_100226827 3300005338 Bacteria 1566
19 Ga0070660_100259735 3300005339 Bacteria 1418
20 Ga0070668_101013529 3300005347 Bacteria 747
21 Ga0070668_101727980 3300005347 Bacteria 575
22 Ga0070669_100020358 3300005353 Bacteria 4738
23 Ga0070675_100005284 3300005354 Bacteria 9862
24 Ga0070675_100018240 3300005354 Bacteria 5586
25 Ga0070675_100057104 3300005354 Bacteria 3217
26 Ga0070671_100023226 3300005355 Bacteria 5073
27 Ga0070671_100177473 3300005355 Bacteria 1803
28 Ga0070671_100183791 3300005355 Bacteria 1770
29 Ga0070671_100207312 3300005355 Bacteria 1662
30 Ga0070671_100314268 3300005355 Bacteria 1335
31 Ga0070674_100357495 3300005356 Bacteria 1181
32 Ga0070673_100006784 3300005364 Bacteria 7475
33 Ga0070673_100198343 3300005364 Bacteria 1728
34 Ga0070673_100455441 3300005364 Bacteria 1151
35 Ga0070667_100649959 3300005367 Bacteria 974
36 Ga0070667_100790445 3300005367 Bacteria 881
37 Ga0070667_101918780 3300005367 Bacteria 558
38 Ga0070709_10128352 3300005434 Bacteria 1728
39 Ga0070714_101035712 3300005435 Bacteria 799
40 Ga0070713_100050518 3300005436 Bacteria 3435
41 Ga0070711_100353537 3300005439 Bacteria 1182
42 Ga0070678_100047368 3300005456 Bacteria 3088
43 Ga0070681_10091756 3300005458 Bacteria 2987
44 Ga0070681_11441667 3300005458 Bacteria 612
45 Ga0068867_100028097 3300005459 Bacteria 4048
46 Ga0068867_100204435 3300005459 Bacteria 1582
47 Ga0068867_100356876 3300005459 Bacteria 1221
48 Ga0070706_100003178 3300005467 Bacteria 16216
49 Ga0070706_101065530 3300005467 Bacteria 744
50 Ga0070706_101689770 3300005467 Bacteria 577
51 Ga0070707_100167452 3300005468 Bacteria 2142
52 Ga0070707_101247491 3300005468 Bacteria 710
53 Ga0070698_100000125 3300005471 Bacteria 66620
54 Ga0070699_100549095 3300005518 Bacteria 1051
55 Ga0070679_100392234 3300005530 Bacteria 1334
56 Ga0070697_100053846 3300005536 Bacteria 3270
57 Ga0070697_100212627 3300005536 Bacteria 1647
58 Ga0068853_100485628 3300005539 Bacteria 1165
59 Ga0070672_100011434 3300005543 Bacteria 6191
60 Ga0070672_100109047 3300005543 Bacteria 2254
61 Ga0070672_100126263 3300005543 Bacteria 2098
62 Ga0070665_100007197 3300005548 Bacteria 11313
63 Ga0070665_100046584 3300005548 Bacteria 4354
64 Ga0070665_100068910 3300005548 Bacteria 3546
65 Ga0070665_100344691 3300005548 Bacteria 1495
66 Ga0070665_100518529 3300005548 Bacteria 1203
67 Ga0068855_100013166 3300005563 Bacteria 9977
68 Ga0070664_100151073 3300005564 Bacteria 2050
69 Ga0070664_101171082 3300005564 Bacteria 725
70 Ga0068857_100046335 3300005577 Bacteria 3858
71 Ga0068857_100377694 3300005577 Bacteria 1315
72 Ga0068854_100428190 3300005578 Bacteria 1101
73 Ga0068854_100529249 3300005578 Bacteria 997
74 Ga0068854_100653893 3300005578 Bacteria 903
75 Ga0068859_100192528 3300005617 Bacteria 2124
76 Ga0068859_100213223 3300005617 Bacteria 2018
77 Ga0068859_100534102 3300005617 Bacteria 1268
78 Ga0068859_101882695 3300005617 Bacteria 661
79 Ga0068864_100006329 3300005618 Bacteria 9709
80 Ga0068864_100478846 3300005618 Bacteria 1194
81 Ga0068864_101224941 3300005618 Bacteria 749
82 Ga0068870_10078366 3300005840 Bacteria 1820
83 Ga0068863_100075528 3300005841 Bacteria 3188
84 Ga0068863_100688536 3300005841 Bacteria 1016
85 Ga0068863_100732550 3300005841 Bacteria 984
86 Ga0068858_100782207 3300005842 Bacteria 931
87 Ga0068858_100980933 3300005842 Bacteria 828
88 Ga0068860_100666493 3300005843 Bacteria 1049
89 Ga0068860_100851095 3300005843 Bacteria 927
90 Ga0068860_101219666 3300005843 Bacteria 773
91 Ga0068862_100753357 3300005844 Bacteria 948
92 Ga0068862_101536295 3300005844 Bacteria 672
93 Ga0081455_10001698 3300005937 Bacteria 26658
94 Ga0081455_10016674 3300005937 Bacteria 7077
95 Ga0081540_1058819 3300005983 Bacteria 1848
96 Ga0081539_10002476 3300005985 Bacteria 25988
97 Ga0081539_10016793 3300005985 Bacteria 5195
98 Ga0075365_10154725 3300006038 Bacteria 1596
99 Ga0075365_10163515 3300006038 Bacteria 1552
100 Ga0075368_10024894 3300006042 Bacteria 2294
101 Ga0075363_100019286 3300006048 Bacteria 3409
102 Ga0075363_100039255 3300006048 Bacteria 2491
103 Ga0070716_101099140 3300006173 Bacteria 634
104 Ga0075362_10005959 3300006177 Bacteria 4504
105 Ga0075362_10030559 3300006177 Bacteria 2326
106 Ga0075362_10031995 3300006177 Bacteria 2280
107 Ga0075367_10020219 3300006178 Bacteria 3704
108 Ga0075367_10098676 3300006178 Bacteria 1783
109 Ga0075367_10150159 3300006178 Bacteria 1446
110 Ga0075369_10002830 3300006186 Bacteria 6245
111 Ga0075369_10028194 3300006186 Bacteria 2352
112 Ga0075369_10031637 3300006186 Bacteria 2235
113 Ga0075369_10128681 3300006186 Bacteria 1149
114 Ga0075366_10106492 3300006195 Bacteria 1685
115 Ga0075366_10186202 3300006195 Bacteria 1261
116 Ga0075366_10443763 3300006195 Bacteria 800
117 Ga0075366_10489625 3300006195 Bacteria 760
118 Ga0097621_100034904 3300006237 Bacteria 4015
119 Ga0075370_10011719 3300006353 Bacteria 4615
120 Ga0075370_10043781 3300006353 Bacteria 2530
121 Ga0075370_10061476 3300006353 Bacteria 2140
122 Ga0075370_10161631 3300006353 Bacteria 1314
123 Ga0075370_10204457 3300006353 Bacteria 1165
124 Ga0075370_10407696 3300006353 Bacteria 816
125 Ga0068871_100116065 3300006358 Bacteria 2257
126 Ga0068871_100240781 3300006358 Bacteria 1573
127 Ga0075434_101021353 3300006871 Bacteria 841
128 Ga0068865_100147802 3300006881 Bacteria 1779
129 Ga0097620_100192535 3300006931 Bacteria 2124
130 Ga0097620_100213208 3300006931 Bacteria 2018
131 Ga0097620_100534112 3300006931 Bacteria 1268
132 Ga0097620_101882786 3300006931 Bacteria 661
133 Ga0099794_10117500 3300007265 Bacteria 1336
134 Ga0099795_10142298 3300007788 Bacteria 976
135 Ga0105240_10006208 3300009093 Bacteria 17574
136 Ga0105240_10305670 3300009093 Bacteria 1818
137 Ga0111539_11445261 3300009094 Bacteria 798
138 Ga0105245_10049824 3300009098 Bacteria 3752
139 Ga0105245_10360142 3300009098 Bacteria 1443
140 Ga0105245_11807020 3300009098 Bacteria 664
141 Ga0105245_12019612 3300009098 Bacteria 630
142 Ga0114129_12429738 3300009147 Bacteria 627
143 Ga0105243_10532271 3300009148 Bacteria 1119
144 Ga0105243_12214711 3300009148 Bacteria 586
145 Ga0105241_11653692 3300009174 Bacteria 621
146 Ga0105242_12577811 3300009176 Bacteria 557
147 Ga0105248_11624941 3300009177 Bacteria 732
148 Ga0105248_11796582 3300009177 Bacteria 695
149 Ga0105237_10594957 3300009545 Bacteria 1113
150 Ga0105237_11554547 3300009545 Bacteria 668
151 Ga0105238_10954396 3300009551 Bacteria 877
152 Ga0105238_11369161 3300009551 Bacteria 734
153 Ga0105249_10926557 3300009553 Bacteria 939
154 Ga0105239_11143068 3300010375 Bacteria 897
155 Ga0105246_10960088 3300011119 Bacteria 771
156 Ga0105246_10973317 3300011119 Bacteria 766
157 Ga0157370_10144634 3300013104 Bacteria 2214
158 Ga0157369_10725868 3300013105 Bacteria 1023
159 Ga0157374_10128395 3300013296 Bacteria 2452
160 Ga0157374_11230504 3300013296 Bacteria 770
161 Ga0157374_12637696 3300013296 Bacteria 530
162 Ga0157378_10062294 3300013297 Bacteria 3330
163 Ga0157378_10364422 3300013297 Bacteria 1415
164 Ga0157378_10633493 3300013297 Bacteria 1083
165 Ga0163162_10652529 3300013306 Bacteria 1176
166 Ga0163162_11280721 3300013306 Bacteria 833
167 Ga0163162_11382859 3300013306 Bacteria 801
168 Ga0157375_10012511 3300013308 Bacteria 7531
169 Ga0157375_10314236 3300013308 Bacteria 1731
170 Ga0157375_13635036 3300013308 Bacteria 513
171 Ga0157380_12622915 3300014326 Bacteria 570
172 Ga0157379_10154597 3300014968 Bacteria 2069
173 Ga0157379_10262876 3300014968 Bacteria 1568
174 Ga0157379_10672900 3300014968 Bacteria 970
175 Ga0157379_11219869 3300014968 Bacteria 724
176 Ga0157379_12316879 3300014968 Bacteria 535
177 Ga0157376_10018236 3300014969 Bacteria 5374
178 Ga0157376_11069790 3300014969 Bacteria 831
179 Ga0157376_11123073 3300014969 Bacteria 812
180 Ga0157376_11597772 3300014969 Bacteria 686
181 Ga0157376_12286382 3300014969 Bacteria 580
182 Ga0157376_12664428 3300014969 Bacteria 540
183 Ga0163161_10354186 3300017792 Bacteria 1167
184 Ga0163161_11041134 3300017792 Bacteria 701
185 Ga0207426_1020689 3300025302 Bacteria 2284
186 Ga0207656_10433302 3300025321 Bacteria 663
187 Ga0207682_10001917 3300025893 Bacteria 9449
188 Ga0207642_10444213 3300025899 Bacteria 784
189 Ga0207680_11338478 3300025903 Bacteria 509
190 Ga0207645_10002992 3300025907 Bacteria 13060
191 Ga0207645_10009736 3300025907 Bacteria 6637
192 Ga0207645_10138240 3300025907 Bacteria 1587
193 Ga0207645_10646009 3300025907 Bacteria 719
194 Ga0207705_10162966 3300025909 Bacteria 1676
195 Ga0207705_10190317 3300025909 Bacteria 1551
196 Ga0207684_10008871 3300025910 Bacteria 8927
197 Ga0207684_10712322 3300025910 Bacteria 852
198 Ga0207684_11135280 3300025910 Bacteria 649
199 Ga0207654_10397875 3300025911 Bacteria 957
200 Ga0207707_10019703 3300025912 Bacteria 5889
201 Ga0207695_10337628 3300025913 Bacteria 1395
202 Ga0207663_10199886 3300025916 Bacteria 1441
203 Ga0207660_10081905 3300025917 Bacteria 2373
204 Ga0207657_10171920 3300025919 Bacteria 1755
205 Ga0207652_10091323 3300025921 Bacteria 2677
206 Ga0207646_10090652 3300025922 Bacteria 2736
207 Ga0207681_10058976 3300025923 Bacteria 2630
208 Ga0207681_10458316 3300025923 Bacteria 1038
209 Ga0207694_10689672 3300025924 Bacteria 861
210 Ga0207650_10050506 3300025925 Bacteria 3076
211 Ga0207650_10435719 3300025925 Bacteria 1089
212 Ga0207659_10020488 3300025926 Bacteria 4372
213 Ga0207659_10081713 3300025926 Bacteria 2390
214 Ga0207659_10143290 3300025926 Bacteria 1857
215 Ga0207687_10015560 3300025927 Bacteria 4989
216 Ga0207687_10985258 3300025927 Bacteria 723
217 Ga0207700_10260851 3300025928 Bacteria 1484
218 Ga0207664_10320126 3300025929 Bacteria 1368
219 Ga0207644_10095813 3300025931 Bacteria 2220
220 Ga0207644_10127800 3300025931 Bacteria 1942
221 Ga0207644_10298864 3300025931 Bacteria 1297
222 Ga0207644_10761599 3300025931 Bacteria 809
223 Ga0207670_10146484 3300025936 Bacteria 1747
224 Ga0207669_10094647 3300025937 Bacteria 1955
225 Ga0207704_10260994 3300025938 Bacteria 1306
226 Ga0207665_10537918 3300025939 Bacteria 906
227 Ga0207691_10004283 3300025940 Bacteria 13863
228 Ga0207691_10019266 3300025940 Bacteria 6459
229 Ga0207691_10024147 3300025940 Bacteria 5717
230 Ga0207711_11507937 3300025941 Bacteria 615
231 Ga0207689_10010230 3300025942 Bacteria 8080
232 Ga0207689_10422976 3300025942 Bacteria 1112
233 Ga0207667_10131540 3300025949 Bacteria 2577
234 Ga0207651_10133315 3300025960 Bacteria 1906
235 Ga0207651_10742836 3300025960 Bacteria 867
236 Ga0207651_11727351 3300025960 Bacteria 563
237 Ga0207668_10782003 3300025972 Bacteria 844
238 Ga0207640_10092752 3300025981 Bacteria 2096
239 Ga0207640_10672422 3300025981 Bacteria 885
240 Ga0207658_10385525 3300025986 Bacteria 1228
241 Ga0207658_10676521 3300025986 Bacteria 931
242 Ga0207658_10817225 3300025986 Bacteria 847
243 Ga0207658_11236985 3300025986 Bacteria 683
244 Ga0207677_10228439 3300026023 Bacteria 1497
245 Ga0207677_10259215 3300026023 Bacteria 1416
246 Ga0207677_10389058 3300026023 Bacteria 1179
247 Ga0207677_10735003 3300026023 Bacteria 878
248 Ga0207677_10875162 3300026023 Bacteria 809
249 Ga0207677_10994367 3300026023 Bacteria 760
250 Ga0207639_10860767 3300026041 Bacteria 846
251 Ga0207678_10185853 3300026067 Bacteria 1775
252 Ga0207678_11768399 3300026067 Bacteria 542
253 Ga0207708_10886605 3300026075 Bacteria 771
254 Ga0207708_11049645 3300026075 Bacteria 709
255 Ga0207641_10251883 3300026088 Bacteria 1649
256 Ga0207641_10269694 3300026088 Bacteria 1597
257 Ga0207641_10638081 3300026088 Bacteria 1045
258 Ga0207641_11451869 3300026088 Bacteria 687
259 Ga0207648_10005448 3300026089 Bacteria 12822
260 Ga0207648_10090662 3300026089 Bacteria 2671
261 Ga0207648_10168404 3300026089 Bacteria 1936
262 Ga0207648_11545871 3300026089 Bacteria 624
263 Ga0207676_10041228 3300026095 Bacteria 3543
264 Ga0207676_10097904 3300026095 Bacteria 2424
265 Ga0207676_11163882 3300026095 Bacteria 764
266 Ga0207674_10056371 3300026116 Bacteria 3992
267 Ga0207674_10390228 3300026116 Bacteria 1346
268 Ga0207683_10006790 3300026121 Bacteria 9797
269 Ga0207698_11123723 3300026142 Bacteria 799
270 Ga0209813_10018976 3300027866 Bacteria 1906
271 Ga0268266_10049748 3300028379 Bacteria 3595
272 Ga0268266_10066102 3300028379 Bacteria 3126
273 Ga0268266_10079399 3300028379 Bacteria 2857
274 Ga0268266_10107630 3300028379 Bacteria 2466
275 Ga0268266_10552114 3300028379 Bacteria 1104
276 Ga0268265_11846408 3300028380 Bacteria 611
277 Ga0268264_10671117 3300028381 Bacteria 1027
278 Ga0268264_11176415 3300028381 Bacteria 776
279 Ga0268264_11573549 3300028381 Bacteria 668
280 Ga0265334_10243929 3300028573 Bacteria 619
281 Ga0307517_10007539 3300028786 Bacteria 15824
282 Ga0307517_10109952 3300028786 Bacteria 2104
283 Ga0307517_10200549 3300028786 Bacteria 1248
284 Ga0307515_10000398 3300028794 Bacteria 105087
285 Ga0307515_10027473 3300028794 Bacteria 9726
286 Ga0307515_10069365 3300028794 Bacteria 4820
287 Ga0307515_10168221 3300028794 Bacteria 2199
288 Ga0307512_10154145 3300030522 Bacteria 1365
289 Ga0307512_10192285 3300030522 Bacteria 1123
290 Ga0307512_10292203 3300030522 Bacteria 767
291 Ga0307512_10314212 3300030522 Bacteria 718
292 Ga0265328_10018416 3300031239 Bacteria 2694
293 Ga0265325_10162218 3300031241 Bacteria 1051
294 Ga0265340_10050655 3300031247 Bacteria 2013
295 Ga0265340_10283129 3300031247 Bacteria 736
296 Ga0307513_10004000 3300031456 Bacteria 19785
297 Ga0307513_10043324 3300031456 Bacteria 4945
298 Ga0307513_10178642 3300031456 Bacteria 1989
299 Ga0307513_10187189 3300031456 Bacteria 1926
300 Ga0307509_10004212 3300031507 Bacteria 20986
301 Ga0307509_10007168 3300031507 Bacteria 14690
302 Ga0307509_10020273 3300031507 Bacteria 7547
303 Ga0307509_10020923 3300031507 Bacteria 7414
304 Ga0307509_10044890 3300031507 Bacteria 4771
305 Ga0307509_10597489 3300031507 Bacteria 776
306 Ga0307408_100820387 3300031548 Bacteria 846
307 Ga0307408_101008970 3300031548 Bacteria 767
308 Ga0307508_10000048 3300031616 Bacteria 137587
309 Ga0307508_10021737 3300031616 Bacteria 5836
310 Ga0307508_10101034 3300031616 Bacteria 2479
311 Ga0307508_10110994 3300031616 Bacteria 2342
312 Ga0307508_10382729 3300031616 Bacteria 998
313 Ga0307514_10113502 3300031649 Bacteria 1912
314 Ga0307514_10217518 3300031649 Bacteria 1176
315 Ga0265314_10210292 3300031711 Bacteria 1143
316 Ga0265342_10458385 3300031712 Bacteria 654
317 Ga0307516_10555149 3300031730 Bacteria 802
318 Ga0307413_10908680 3300031824 Bacteria 748
319 Ga0307518_10058029 3300031838 Bacteria 2812
320 Ga0307410_10023578 3300031852 Bacteria 3829
321 Ga0307406_10607543 3300031901 Bacteria 902
322 Ga0307407_10265903 3300031903 Bacteria 1182
323 Ga0307412_10044369 3300031911 Bacteria 2900
324 Ga0307412_11775261 3300031911 Bacteria 567
325 Ga0307409_100019484 3300031995 Bacteria 4596
326 Ga0307416_100530813 3300032002 Bacteria 1247
327 Ga0307416_100853826 3300032002 Bacteria 1008
328 Ga0307414_10100677 3300032004 Bacteria 2174
329 Ga0307411_10035675 3300032005 Bacteria 3108
330 Ga0307415_100545487 3300032126 Bacteria 1022
331 Ga0307415_101971802 3300032126 Bacteria 568
332 Ga0307510_10000773 3300033180 Bacteria 33035
333 Ga0307510_10226250 3300033180 Bacteria 1377
334 Ga0307510_10229807 3300033180 Bacteria 1358
335 Ga0307510_10286317 3300033180 Bacteria 1116
336 Ga0307510_10293131 3300033180 Bacteria 1092
337 Ga0307510_10345364 3300033180 Bacteria 939
338 Ga0307510_10368920 3300033180 Bacteria 882
339 Ga0307510_10462937 3300033180 Bacteria 709
340 Ga0373930_0053378 3300034816 Bacteria 888
341 Ga0373926_0201552 3300035083 Bacteria 766
342 Ga0373928_0069868 3300035084 Bacteria 866
343 Ga0373928_0107332 3300035084 Bacteria 735
344 Ga0373932_0101889 3300035112 Bacteria 935
345 Ga0373932_0402369 3300035112 Bacteria 530
346 Ga0373939_0077674 3300035114 Bacteria 1096
347 Ga0373941_0093932 3300035115 Bacteria 1034
348 Ga0373945_0112403 3300035116 Bacteria 1076
349 Ga0373943_0687931 3300035170 Bacteria 606
350 Ga0373946_0251822 3300035171 Bacteria 862
351 Ga0373931_0021626 3300035691 Bacteria 3228
352 Ga0373931_0056090 3300035691 Bacteria 2110
353 Ga0373931_0203616 3300035691 Bacteria 1184
354 Ga0373933_0197489 3300035724 Bacteria 1287
355 Ga0373947_0692749 3300035725 Bacteria 695
356 Ga0373937_0744865 3300036401 Bacteria 927
357 Ga0395899_0297847 3300037312 Bacteria 1092
358 Ga0395905_0008570 3300037471 Bacteria 10079
359 Ga0395901_0272627 3300038443 Bacteria 1759
360 Ga0436360_0267943 3300039438 Bacteria 2485
361 Ga0436360_0333565 3300039438 Bacteria 749
362 Ga0436363_1198886 3300039450 Bacteria 567
363 Ga0436362_1142193 3300039453 Bacteria 568
364 Ga0439465_0123966 3300041413 Bacteria 908
365 Ga0451787_131678 3300041441 Bacteria 703
366 Ga0451793_1539797 3300041452 Bacteria 881
367 Ga0451798_0872761 3300041458 Bacteria 567
368 Ga0451807_2260021 3300041486 Bacteria 570
369 Ga0451807_2479728 3300041486 Bacteria 1315
370 Ga0451835_0785108 3300041492 Bacteria 521
371 Ga0451839_1243124 3300041496 Bacteria 651
372 Ga0439441_133522 3300042001 Bacteria 576
373 Ga0439458_0050717 3300042157 Bacteria 1024
374 Ga0439464_0161143 3300042439 Bacteria 705
375 Ga0466972_0083351 3300044658 Bacteria 1521
376 Ga0466965_0107631 3300044683 Bacteria 1430
377 Ga0453684_0004597 3300044712 Bacteria 28771
378 Ga0466968_0687771 3300044735 Bacteria 521
379 Ga0466959_0277416 3300045049 Bacteria 1151
380 Ga0495592_0000202 3300046454 Bacteria 50799
381 Ga0495590_0023112 3300046457 Bacteria 2197
382 Ga0495582_0755280 3300046473 Bacteria 563
383 Ga0495639_0258884 3300046475 Bacteria 862
384 Ga0495594_0461742 3300046499 Bacteria 722
385 Ga0495608_0155484 3300046511 Bacteria 1456
386 Ga0495610_0061449 3300046512 Bacteria 1785
387 Ga0495610_0206852 3300046512 Bacteria 800
388 Ga0495630_0021702 3300046517 Bacteria 4742
389 Ga0495632_0144715 3300046519 Bacteria 1101
390 Ga0495648_0068687 3300046524 Bacteria 2066
391 Ga0495648_0360501 3300046524 Bacteria 661
392 Ga0495648_0360984 3300046524 Bacteria 660
393 Ga0495648_0409258 3300046524 Bacteria 604
394 Ga0495666_0184851 3300046526 Bacteria 962
395 Ga0495642_0216517 3300046528 Bacteria 836
396 Ga0495586_0529385 3300046535 Bacteria 680
397 Ga0495668_0446100 3300046616 Bacteria 712
398 Ga0495668_0491549 3300046616 Bacteria 676
399 Ga0495668_0515559 3300046616 Bacteria 659
400 Ga0495625_0259424 3300046660 Bacteria 1125
401 Ga0495625_0515232 3300046660 Bacteria 729
402 Ga0495661_0135484 3300046665 Bacteria 1345
403 Ga0495646_0039375 3300046680 Bacteria 2915
404 Ga0495647_0291560 3300046681 Bacteria 734
405 Ga0495658_0544481 3300046683 Bacteria 743
406 Ga0495671_0208153 3300046692 Bacteria 948
407 Ga0495671_0308441 3300046692 Bacteria 761
408 Ga0495649_0000829 3300046694 Bacteria 24827
409 Ga0495660_0010301 3300046810 Bacteria 5435
410 Ga0495687_085765 3300047443 Bacteria 1219
411 Ga0495673_0117195 3300047469 Bacteria 1058
412 Ga0495593_0014304 3300047673 Bacteria 4512
413 Ga0495602_0057378 3300048088 Bacteria 3416
414 Ga0496121_0287472 3300048924 Bacteria 1122
415 Ga0495682_0215710 3300049460 Bacteria 680
416 Ga0495682_0296022 3300049460 Bacteria 571
417 Ga0501033_0199718 3300049570 Bacteria 1429
418 Ga0501034_0031351 3300049571 Bacteria 5400
419 Ga0501034_0265859 3300049571 Bacteria 1657
420 Ga0501034_0383640 3300049571 Bacteria 1330
421 Ga0501034_0687168 3300049571 Bacteria 923
422 Ga0501034_1595978 3300049571 Bacteria 525
423 Ga0501042_0769245 3300049578 Bacteria 701
424 Ga0501046_0194429 3300049580 Bacteria 1512
425 Ga0501047_0567857 3300049581 Bacteria 958
426 Ga0501068_0026564 3300049584 Bacteria 3412
427 Ga0501072_1129724 3300049588 Bacteria 609
428 Ga0501044_0215837 3300049823 Bacteria 1871
429 nmdc:mga03683_10437_c1 3300050489 Bacteria 3331
430 nmdc:mga03683_113285_c1 3300050489 Bacteria 1201
431 nmdc:mga03683_42997_c1 3300050489 Bacteria 1862
432 nmdc:mga03683_8346_c1 3300050489 Bacteria 3639
433 nmdc:mga03n38_41437_c1 3300050490 Bacteria 2007
434 nmdc:mga03n38_59099_c1 3300050490 Bacteria 1739
435 nmdc:mga00v17_774315_c1 3300050491 Bacteria 612
436 nmdc:mga00v17_824690_c1 3300050491 Bacteria 590
437 nmdc:mga0yw44_101311_c1 3300050492 Bacteria 1835
438 nmdc:mga0yw44_509474_c1 3300050492 Bacteria 817
439 nmdc:mga0k408_106016_c1 3300050493 Bacteria 1660
440 nmdc:mga0k408_164485_c1 3300050493 Bacteria 1322
441 nmdc:mga0k408_34809_c1 3300050493 Bacteria 2885
442 nmdc:mga0k408_7576_c1 3300050493 Bacteria 5796
443 nmdc:mga0k408_82881_c1 3300050493 Bacteria 1880
444 nmdc:mga06z11_22747_c1 3300050494 Bacteria 2933
445 nmdc:mga06z11_420313_c1 3300050494 Bacteria 806
446 nmdc:mga06z11_46056_c1 3300050494 Bacteria 2208
447 nmdc:mga04h51_18208_c1 3300050495 Bacteria 2065
448 nmdc:mga04h51_297456_c1 3300050495 Bacteria 657
449 nmdc:mga07m45_101952_c1 3300050496 Bacteria 1648
450 nmdc:mga07m45_11332_c1 3300050496 Bacteria 4682
451 nmdc:mga07m45_140433_c2 3300050496 Bacteria 863
452 nmdc:mga07m45_400324_c1 3300050496 Bacteria 797
453 nmdc:mga07m45_514786_c1 3300050496 Bacteria 693
454 nmdc:mga07m45_5812_c1 3300050496 Bacteria 6184
455 nmdc:mga0qj67_1578903_c1 3300050509 Bacteria 503
456 nmdc:mga08y16_1235347_c1 3300050511 Bacteria 716
457 nmdc:mga08y16_1595655_c1 3300050511 Bacteria 610
458 nmdc:mga0n895_740660_c1 3300050512 Bacteria 976
459 nmdc:mga0sz30_318118_c1 3300050516 Bacteria 695
460 nmdc:mga0sz30_4940_c1 3300050516 Bacteria 4859
461 nmdc:mga0sz30_56891_c1 3300050516 Bacteria 1666
462 Ga0500578_0577518 3300053086 Bacteria 621
463 Ga0500644_0123899 3300053088 Bacteria 1010
464 Ga0500644_0332161 3300053088 Bacteria 655
465 Ga0500647_0093002 3300053091 Bacteria 1443
466 Ga0500647_0313369 3300053091 Bacteria 666
467 Ga0500583_0060256 3300053092 Bacteria 1789
468 Ga0500651_0040716 3300053093 Bacteria 2927
469 Ga0500651_0062691 3300053093 Bacteria 2321
470 Ga0500566_0283564 3300053094 Bacteria 788
471 Ga0500641_0000217 3300053096 Bacteria 21511
472 Ga0500594_0004803 3300053118 Bacteria 2986
473 Ga0500607_054518 3300053121 Bacteria 2117
474 Ga0500614_042387 3300053123 Bacteria 1163
475 Ga0500658_0012354 3300053134 Bacteria 3150
476 Ga0500559_0000207 3300053136 Bacteria 46949
477 Ga0500568_0116792 3300053139 Bacteria 995
478 Ga0500619_107596 3300053154 Bacteria 948
479 Ga0500620_101394 3300053155 Bacteria 1007
480 Ga0500622_0004173 3300053156 Bacteria 9237
481 Ga0500636_0400281 3300053177 Bacteria 637
482 Ga0500636_0424805 3300053177 Bacteria 609
483 Ga0500587_004498 3300053739 Bacteria 1912
484 Ga0070708_100353295
485 rootL2_10081356
486 Ga0070658_10005430
487 Ga0070658_10359003
488 Ga0070658_10587857
489 Ga0070676_10027747
490 Ga0070690_101421198
491 Ga0070670_100470063
492 Ga0070670_101159335
493 Ga0070670_101318997
494 Ga0068869_100116126
495 Ga0068869_100328116
496 Ga0068869_101082869
497 Ga0070666_10887729
498 Ga0070680_100135902
499 Ga0070682_100853038
500 Ga0068868_100150013
501 Ga0068868_100226827
502 Ga0070660_100259735
503 Ga0070668_101013529
504 Ga0070668_101727980
505 Ga0070669_100020358
506 Ga0070675_100005284
507 Ga0070675_100018240
508 Ga0070675_100057104
509 Ga0070671_100023226
510 Ga0070671_100177473
511 Ga0070671_100183791
512 Ga0070671_100207312
513 Ga0070671_100314268
514 Ga0070674_100357495
515 Ga0070673_100006784
516 Ga0070673_100198343
517 Ga0070673_100455441
518 Ga0070667_100649959
519 Ga0070667_100790445
520 Ga0070667_101918780
521 Ga0070709_10128352
522 Ga0070714_101035712
523 Ga0070713_100050518
524 Ga0070711_100353537
525 Ga0070678_100047368
526 Ga0070681_10091756
527 Ga0070681_11441667
528 Ga0068867_100028097
529 Ga0068867_100204435
530 Ga0068867_100356876
531 Ga0070706_100003178
532 Ga0070706_101065530
533 Ga0070706_101689770
534 Ga0070707_100167452
535 Ga0070707_101247491
536 Ga0070698_100000125
537 Ga0070699_100549095
538 Ga0070679_100392234
539 Ga0070697_100053846
540 Ga0070697_100212627
541 Ga0068853_100485628
542 Ga0070672_100011434
543 Ga0070672_100109047
544 Ga0070672_100126263
545 Ga0070665_100007197
546 Ga0070665_100046584
547 Ga0070665_100068910
548 Ga0070665_100344691
549 Ga0070665_100518529
550 Ga0068855_100013166
551 Ga0070664_100151073
552 Ga0070664_101171082
553 Ga0068857_100046335
554 Ga0068857_100377694
555 Ga0068854_100428190
556 Ga0068854_100529249
557 Ga0068854_100653893
558 Ga0068859_100192528
559 Ga0068859_100213223
560 Ga0068859_100534102
561 Ga0068859_101882695
562 Ga0068864_100006329
563 Ga0068864_100478846
564 Ga0068864_101224941
565 Ga0068870_10078366
566 Ga0068863_100075528
567 Ga0068863_100688536
568 Ga0068863_100732550
569 Ga0068858_100782207
570 Ga0068858_100980933
571 Ga0068860_100666493
572 Ga0068860_100851095
573 Ga0068860_101219666
574 Ga0068862_100753357
575 Ga0068862_101536295
576 Ga0081455_10001698
577 Ga0081455_10016674
578 Ga0081540_1058819
579 Ga0081539_10002476
580 Ga0081539_10016793
581 Ga0075365_10154725
582 Ga0075365_10163515
583 Ga0075368_10024894
584 Ga0075363_100019286
585 Ga0075363_100039255
586 Ga0070716_101099140
587 Ga0075362_10005959
588 Ga0075362_10030559
589 Ga0075362_10031995
590 Ga0075367_10020219
591 Ga0075367_10098676
592 Ga0075367_10150159
593 Ga0075369_10002830
594 Ga0075369_10028194
595 Ga0075369_10031637
596 Ga0075369_10128681
597 Ga0075366_10106492
598 Ga0075366_10186202
599 Ga0075366_10443763
600 Ga0075366_10489625
601 Ga0097621_100034904
602 Ga0075370_10011719
603 Ga0075370_10043781
604 Ga0075370_10061476
605 Ga0075370_10161631
606 Ga0075370_10204457
607 Ga0075370_10407696
608 Ga0068871_100116065
609 Ga0068871_100240781
610 Ga0075434_101021353
611 Ga0068865_100147802
612 Ga0097620_100192535
613 Ga0097620_100213208
614 Ga0097620_100534112
615 Ga0097620_101882786
616 Ga0099794_10117500
617 Ga0099795_10142298
618 Ga0105240_10006208
619 Ga0105240_10305670
620 Ga0111539_11445261
621 Ga0105245_10049824
622 Ga0105245_10360142
623 Ga0105245_11807020
624 Ga0105245_12019612
625 Ga0114129_12429738
626 Ga0105243_10532271
627 Ga0105243_12214711
628 Ga0105241_11653692
629 Ga0105242_12577811
630 Ga0105248_11624941
631 Ga0105248_11796582
632 Ga0105237_10594957
633 Ga0105237_11554547
634 Ga0105238_10954396
635 Ga0105238_11369161
636 Ga0105249_10926557
637 Ga0105239_11143068
638 Ga0105246_10960088
639 Ga0105246_10973317
640 Ga0157370_10144634
641 Ga0157369_10725868
642 Ga0157374_10128395
643 Ga0157374_11230504
644 Ga0157374_12637696
645 Ga0157378_10062294
646 Ga0157378_10364422
647 Ga0157378_10633493
648 Ga0163162_10652529
649 Ga0163162_11280721
650 Ga0163162_11382859
651 Ga0157375_10012511
652 Ga0157375_10314236
653 Ga0157375_13635036
654 Ga0157380_12622915
655 Ga0157379_10154597
656 Ga0157379_10262876
657 Ga0157379_10672900
658 Ga0157379_11219869
659 Ga0157379_12316879
660 Ga0157376_10018236
661 Ga0157376_11069790
662 Ga0157376_11123073
663 Ga0157376_11597772
664 Ga0157376_12286382
665 Ga0157376_12664428
666 Ga0163161_10354186
667 Ga0163161_11041134
668 Ga0207426_1020689
669 Ga0207656_10433302
670 Ga0207682_10001917
671 Ga0207642_10444213
672 Ga0207680_11338478
673 Ga0207645_10002992
674 Ga0207645_10009736
675 Ga0207645_10138240
676 Ga0207645_10646009
677 Ga0207705_10162966
678 Ga0207705_10190317
679 Ga0207684_10008871
680 Ga0207684_10712322
681 Ga0207684_11135280
682 Ga0207654_10397875
683 Ga0207707_10019703
684 Ga0207695_10337628
685 Ga0207663_10199886
686 Ga0207660_10081905
687 Ga0207657_10171920
688 Ga0207652_10091323
689 Ga0207646_10090652
690 Ga0207681_10058976
691 Ga0207681_10458316
692 Ga0207694_10689672
693 Ga0207650_10050506
694 Ga0207650_10435719
695 Ga0207659_10020488
696 Ga0207659_10081713
697 Ga0207659_10143290
698 Ga0207687_10015560
699 Ga0207687_10985258
700 Ga0207700_10260851
701 Ga0207664_10320126
702 Ga0207644_10095813
703 Ga0207644_10127800
704 Ga0207644_10298864
705 Ga0207644_10761599
706 Ga0207670_10146484
707 Ga0207669_10094647
708 Ga0207704_10260994
709 Ga0207665_10537918
710 Ga0207691_10004283
711 Ga0207691_10019266
712 Ga0207691_10024147
713 Ga0207711_11507937
714 Ga0207689_10010230
715 Ga0207689_10422976
716 Ga0207667_10131540
717 Ga0207651_10133315
718 Ga0207651_10742836
719 Ga0207651_11727351
720 Ga0207668_10782003
721 Ga0207640_10092752
722 Ga0207640_10672422
723 Ga0207658_10385525
724 Ga0207658_10676521
725 Ga0207658_10817225
726 Ga0207658_11236985
727 Ga0207677_10228439
728 Ga0207677_10259215
729 Ga0207677_10389058
730 Ga0207677_10735003
731 Ga0207677_10875162
732 Ga0207677_10994367
733 Ga0207639_10860767
734 Ga0207678_10185853
735 Ga0207678_11768399
736 Ga0207708_10886605
737 Ga0207708_11049645
738 Ga0207641_10251883
739 Ga0207641_10269694
740 Ga0207641_10638081
741 Ga0207641_11451869
742 Ga0207648_10005448
743 Ga0207648_10090662
744 Ga0207648_10168404
745 Ga0207648_11545871
746 Ga0207676_10041228
747 Ga0207676_10097904
748 Ga0207676_11163882
749 Ga0207674_10056371
750 Ga0207674_10390228
751 Ga0207683_10006790
752 Ga0207698_11123723
753 Ga0209813_10018976
754 Ga0268266_10049748
755 Ga0268266_10066102
756 Ga0268266_10079399
757 Ga0268266_10107630
758 Ga0268266_10552114
759 Ga0268265_11846408
760 Ga0268264_10671117
761 Ga0268264_11176415
762 Ga0268264_11573549
763 Ga0265334_10243929
764 Ga0307517_10007539
765 Ga0307517_10109952
766 Ga0307517_10200549
767 Ga0307515_10000398
768 Ga0307515_10027473
769 Ga0307515_10069365
770 Ga0307515_10168221
771 Ga0307512_10154145
772 Ga0307512_10192285
773 Ga0307512_10292203
774 Ga0307512_10314212
775 Ga0265328_10018416
776 Ga0265325_10162218
777 Ga0265340_10050655
778 Ga0265340_10283129
779 Ga0307513_10004000
780 Ga0307513_10043324
781 Ga0307513_10178642
782 Ga0307513_10187189
783 Ga0307509_10004212
784 Ga0307509_10007168
785 Ga0307509_10020273
786 Ga0307509_10020923
787 Ga0307509_10044890
788 Ga0307509_10597489
789 Ga0307408_100820387
790 Ga0307408_101008970
791 Ga0307508_10000048
792 Ga0307508_10021737
793 Ga0307508_10101034
794 Ga0307508_10110994
795 Ga0307508_10382729
796 Ga0307514_10113502
797 Ga0307514_10217518
798 Ga0265314_10210292
799 Ga0265342_10458385
800 Ga0307516_10555149
801 Ga0307413_10908680
802 Ga0307518_10058029
803 Ga0307410_10023578
804 Ga0307406_10607543
805 Ga0307407_10265903
806 Ga0307412_10044369
807 Ga0307412_11775261
808 Ga0307409_100019484
809 Ga0307416_100530813
810 Ga0307416_100853826
811 Ga0307414_10100677
812 Ga0307411_10035675
813 Ga0307415_100545487
814 Ga0307415_101971802
815 Ga0307510_10000773
816 Ga0307510_10226250
817 Ga0307510_10229807
818 Ga0307510_10286317
819 Ga0307510_10293131
820 Ga0307510_10345364
821 Ga0307510_10368920
822 Ga0307510_10462937
823 Ga0373930_0053378
824 Ga0373926_0201552
825 Ga0373928_0069868
826 Ga0373928_0107332
827 Ga0373932_0101889
828 Ga0373932_0402369
829 Ga0373939_0077674
830 Ga0373941_0093932
831 Ga0373945_0112403
832 Ga0373943_0687931
833 Ga0373946_0251822
834 Ga0373931_0021626
835 Ga0373931_0056090
836 Ga0373931_0203616
837 Ga0373933_0197489
838 Ga0373947_0692749
839 Ga0373937_0744865
840 Ga0395899_0297847
841 Ga0395905_0008570
842 Ga0395901_0272627
843 Ga0436360_0267943
844 Ga0436360_0333565
845 Ga0436363_1198886
846 Ga0436362_1142193
847 Ga0439465_0123966
848 Ga0451787_131678
849 Ga0451793_1539797
850 Ga0451798_0872761
851 Ga0451807_2260021
852 Ga0451807_2479728
853 Ga0451835_0785108
854 Ga0451839_1243124
855 Ga0439441_133522
856 Ga0439458_0050717
857 Ga0439464_0161143
858 Ga0466972_0083351
859 Ga0466965_0107631
860 Ga0453684_0004597
861 Ga0466968_0687771
862 Ga0466959_0277416
863 Ga0495592_0000202
864 Ga0495590_0023112
865 Ga0495582_0755280
866 Ga0495639_0258884
867 Ga0495594_0461742
868 Ga0495608_0155484
869 Ga0495610_0061449
870 Ga0495610_0206852
871 Ga0495630_0021702
872 Ga0495632_0144715
873 Ga0495648_0068687
874 Ga0495648_0360501
875 Ga0495648_0360984
876 Ga0495648_0409258
877 Ga0495666_0184851
878 Ga0495642_0216517
879 Ga0495586_0529385
880 Ga0495668_0446100
881 Ga0495668_0491549
882 Ga0495668_0515559
883 Ga0495625_0259424
884 Ga0495625_0515232
885 Ga0495661_0135484
886 Ga0495646_0039375
887 Ga0495647_0291560
888 Ga0495658_0544481
889 Ga0495671_0208153
890 Ga0495671_0308441
891 Ga0495649_0000829
892 Ga0495660_0010301
893 Ga0495687_085765
894 Ga0495673_0117195
895 Ga0495593_0014304
896 Ga0495602_0057378
897 Ga0496121_0287472
898 Ga0495682_0215710
899 Ga0495682_0296022
900 Ga0501033_0199718
901 Ga0501034_0031351
902 Ga0501034_0265859
903 Ga0501034_0383640
904 Ga0501034_0687168
905 Ga0501034_1595978
906 Ga0501042_0769245
907 Ga0501046_0194429
908 Ga0501047_0567857
909 Ga0501068_0026564
910 Ga0501072_1129724
911 Ga0501044_0215837
912 nmdc:mga03683_10437_c1
913 nmdc:mga03683_113285_c1
914 nmdc:mga03683_42997_c1
915 nmdc:mga03683_8346_c1
916 nmdc:mga03n38_41437_c1
917 nmdc:mga03n38_59099_c1
918 nmdc:mga00v17_774315_c1
919 nmdc:mga00v17_824690_c1
920 nmdc:mga0yw44_101311_c1
921 nmdc:mga0yw44_509474_c1
922 nmdc:mga0k408_106016_c1
923 nmdc:mga0k408_164485_c1
924 nmdc:mga0k408_34809_c1
925 nmdc:mga0k408_7576_c1
926 nmdc:mga0k408_82881_c1
927 nmdc:mga06z11_22747_c1
928 nmdc:mga06z11_420313_c1
929 nmdc:mga06z11_46056_c1
930 nmdc:mga04h51_18208_c1
931 nmdc:mga04h51_297456_c1
932 nmdc:mga07m45_101952_c1
933 nmdc:mga07m45_11332_c1
934 nmdc:mga07m45_140433_c2
935 nmdc:mga07m45_400324_c1
936 nmdc:mga07m45_514786_c1
937 nmdc:mga07m45_5812_c1
938 nmdc:mga0qj67_1578903_c1
939 nmdc:mga08y16_1235347_c1
940 nmdc:mga08y16_1595655_c1
941 nmdc:mga0n895_740660_c1
942 nmdc:mga0sz30_318118_c1
943 nmdc:mga0sz30_4940_c1
944 nmdc:mga0sz30_56891_c1
945 Ga0500578_0577518
946 Ga0500644_0123899
947 Ga0500644_0332161
948 Ga0500647_0093002
949 Ga0500647_0313369
950 Ga0500583_0060256
951 Ga0500651_0040716
952 Ga0500651_0062691
953 Ga0500566_0283564
954 Ga0500641_0000217
955 Ga0500594_0004803
956 Ga0500607_054518
957 Ga0500614_042387
958 Ga0500658_0012354
959 Ga0500559_0000207
960 Ga0500568_0116792
961 Ga0500619_107596
962 Ga0500620_101394
963 Ga0500622_0004173
964 Ga0500636_0400281
965 Ga0500636_0424805
966 Ga0500587_004498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

11

137

0.97

Map