F452687

General Info

Members Datasets Scaffolds Average Seq Length
482 253 964 150

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_013560|Ga0590071_013560_838_1341
Length 167
Sequence MTPTAEARGPEPVYFVSLSEALRTALIAFAALAAGFTWQAVKTARIPVSSPERLVAELRLAQIAALLLALVGGAYIGFAAGHEQQPGVGADIAIGIGFFLVAATTLIRDPRQALTILALAFAAHAVVDVAHRPGLLPEAVAPRWYSIGCAVFDVYIGALCYLPILRR

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
167 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
170 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 0
Rhizoplane 4.77
Rhizosphere 88.8
Stem 0
Stem Tuber 0
Unclassified 19.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_013560 3300059421 Bacteria 1908
2 MBSR1b_contig_8378379 2162886012 Unclassified 827
3 Ga0065712_10106765 3300005290 Bacteria 1910
4 Ga0065715_10005698 3300005293 Bacteria 5097
5 Ga0065715_10121730 3300005293 Bacteria 2222
6 Ga0065715_10129858 3300005293 Bacteria 2037
7 Ga0065715_10609039 3300005293 Bacteria 699
8 Ga0065707_10084770 3300005295 Bacteria 6799
9 Ga0070683_100000670 3300005329 Bacteria 24794
10 Ga0070683_100022975 3300005329 Bacteria 5576
11 Ga0070690_100015638 3300005330 Bacteria 4533
12 Ga0070670_100002296 3300005331 Bacteria 15758
13 Ga0070670_100003090 3300005331 Bacteria 13772
14 Ga0070670_100027852 3300005331 Bacteria 4862
15 Ga0070670_100439381 3300005331 Unclassified 1155
16 Ga0070677_10146770 3300005333 Bacteria 1094
17 Ga0070677_10204267 3300005333 Unclassified 955
18 Ga0070682_100581238 3300005337 Unclassified 881
19 Ga0070682_101067758 3300005337 Bacteria 674
20 Ga0068868_101117259 3300005338 Unclassified 726
21 Ga0070660_100242288 3300005339 Unclassified 1469
22 Ga0070660_100360504 3300005339 Unclassified 1198
23 Ga0070689_100048975 3300005340 Bacteria 3260
24 Ga0070691_10020156 3300005341 Bacteria 3080
25 Ga0070687_100003525 3300005343 Bacteria 6093
26 Ga0070661_100010930 3300005344 Bacteria 6325
27 Ga0070661_100037827 3300005344 Bacteria 3511
28 Ga0070661_100646657 3300005344 Bacteria 858
29 Ga0070661_100700691 3300005344 Unclassified 825
30 Ga0070661_101599722 3300005344 Bacteria 551
31 Ga0070692_10228344 3300005345 Bacteria 1104
32 Ga0070668_101690152 3300005347 Bacteria 581
33 Ga0070669_100000449 3300005353 Bacteria 31407
34 Ga0070669_100121720 3300005353 Bacteria 1991
35 Ga0070669_100139183 3300005353 Bacteria 1870
36 Ga0070669_101331951 3300005353 Unclassified 622
37 Ga0070675_100276339 3300005354 Unclassified 1475
38 Ga0070675_100295925 3300005354 Bacteria 1425
39 Ga0070675_100342332 3300005354 Bacteria 1325
40 Ga0070675_100412153 3300005354 Bacteria 1207
41 Ga0070675_100798185 3300005354 Bacteria 863
42 Ga0070671_100243412 3300005355 Bacteria 1527
43 Ga0070671_100360949 3300005355 Bacteria 1240
44 Ga0070674_100150707 3300005356 Unclassified 1755
45 Ga0070674_100460722 3300005356 Unclassified 1051
46 Ga0070674_100677512 3300005356 Bacteria 879
47 Ga0070673_100004791 3300005364 Bacteria 8597
48 Ga0070673_100178591 3300005364 Bacteria 1816
49 Ga0070673_101373934 3300005364 Unclassified 664
50 Ga0070688_100186625 3300005365 Bacteria 1442
51 Ga0070659_100078878 3300005366 Bacteria 2628
52 Ga0070659_100119075 3300005366 Bacteria 2137
53 Ga0070659_100252023 3300005366 Bacteria 1463
54 Ga0070659_100391377 3300005366 Bacteria 1172
55 Ga0070667_100101900 3300005367 Bacteria 2480
56 Ga0070667_101056495 3300005367 Unclassified 758
57 Ga0070713_100129477 3300005436 Bacteria 2224
58 Ga0070701_10051206 3300005438 Bacteria 2142
59 Ga0070705_100007123 3300005440 Bacteria 5502
60 Ga0070700_100047050 3300005441 Bacteria 2668
61 Ga0070663_100032276 3300005455 Bacteria 3608
62 Ga0070678_100336085 3300005456 Bacteria 1294
63 Ga0070662_100045453 3300005457 Bacteria 3151
64 Ga0070662_100115639 3300005457 Bacteria 2049
65 Ga0070681_10272788 3300005458 Bacteria 1603
66 Ga0070681_10388256 3300005458 Bacteria 1307
67 Ga0068867_100109730 3300005459 Bacteria 2119
68 Ga0068867_101107714 3300005459 Bacteria 723
69 Ga0070706_100150982 3300005467 Bacteria 2169
70 Ga0070698_100443069 3300005471 Bacteria 1234
71 Ga0070699_100195880 3300005518 Unclassified 1796
72 Ga0070684_100017883 3300005535 Bacteria 5826
73 Ga0070684_100062824 3300005535 Bacteria 3254
74 Ga0070697_101384469 3300005536 Bacteria 628
75 Ga0068853_100903890 3300005539 Bacteria 848
76 Ga0068853_101855046 3300005539 Bacteria 584
77 Ga0070672_100001666 3300005543 Bacteria 13841
78 Ga0070672_100148607 3300005543 Bacteria 1937
79 Ga0070672_100319284 3300005543 Bacteria 1320
80 Ga0070686_100006526 3300005544 Bacteria 6490
81 Ga0070686_100270876 3300005544 Bacteria 1248
82 Ga0070695_100101040 3300005545 Bacteria 1942
83 Ga0070695_100728472 3300005545 Unclassified 789
84 Ga0070696_100329649 3300005546 Bacteria 1177
85 Ga0070693_100055687 3300005547 Bacteria 2279
86 Ga0070693_100793049 3300005547 Unclassified 701
87 Ga0070665_100464349 3300005548 Bacteria 1276
88 Ga0068855_100289315 3300005563 Bacteria 1817
89 Ga0068855_100321927 3300005563 Unclassified 1709
90 Ga0070664_100000081 3300005564 Bacteria 60323
91 Ga0070664_100018020 3300005564 Bacteria 5797
92 Ga0070664_100306225 3300005564 Bacteria 1437
93 Ga0070664_100579601 3300005564 Bacteria 1039
94 Ga0070664_100838128 3300005564 Bacteria 861
95 Ga0068857_100017813 3300005577 Bacteria 6228
96 Ga0068857_100196903 3300005577 Bacteria 1836
97 Ga0070702_100018649 3300005615 Bacteria 3603
98 Ga0068852_100914304 3300005616 Bacteria 895
99 Ga0068859_100253995 3300005617 Bacteria 1848
100 Ga0068864_100012843 3300005618 Bacteria 6928
101 Ga0068864_100389104 3300005618 Bacteria 1323
102 Ga0068864_100774942 3300005618 Bacteria 941
103 Ga0068866_10542410 3300005718 Unclassified 776
104 Ga0068870_10200738 3300005840 Unclassified 1209
105 Ga0068858_100290381 3300005842 Bacteria 1558
106 Ga0068860_100069871 3300005843 Bacteria 3338
107 Ga0068862_100126275 3300005844 Bacteria 2259
108 Ga0068862_100162697 3300005844 Bacteria 1993
109 Ga0068862_101064749 3300005844 Bacteria 802
110 Ga0070717_10260259 3300006028 Bacteria 1535
111 Ga0075365_10017414 3300006038 Bacteria 4396
112 Ga0075365_10264353 3300006038 Bacteria 1210
113 Ga0075368_10024383 3300006042 Bacteria 2317
114 Ga0075364_10003255 3300006051 Bacteria 9194
115 Ga0075364_10015454 3300006051 Bacteria 4735
116 Ga0075364_10061212 3300006051 Bacteria 2469
117 Ga0075364_10062444 3300006051 Bacteria 2444
118 Ga0075364_10160417 3300006051 Bacteria 1518
119 Ga0070712_100512201 3300006175 Bacteria 1007
120 Ga0075362_10001258 3300006177 Bacteria 8000
121 Ga0075367_10021574 3300006178 Bacteria 3601
122 Ga0075367_10062491 3300006178 Bacteria 2224
123 Ga0075367_10093897 3300006178 Unclassified 1828
124 Ga0075366_10026044 3300006195 Bacteria 3423
125 Ga0075366_10156823 3300006195 Bacteria 1379
126 Ga0097621_101474243 3300006237 Bacteria 645
127 Ga0075428_100003841 3300006844 Bacteria 16495
128 Ga0075428_100005849 3300006844 Bacteria 13664
129 Ga0075428_100033172 3300006844 Bacteria 5702
130 Ga0075430_100029871 3300006846 Bacteria 4627
131 Ga0075430_100076847 3300006846 Unclassified 2799
132 Ga0075430_100099518 3300006846 Unclassified 2428
133 Ga0075430_100419686 3300006846 Bacteria 1104
134 Ga0075430_100635469 3300006846 Bacteria 880
135 Ga0075431_100017139 3300006847 Bacteria 7364
136 Ga0075431_100031824 3300006847 Bacteria 5434
137 Ga0075431_100176891 3300006847 Unclassified 2191
138 Ga0075433_10050690 3300006852 Bacteria 3614
139 Ga0075433_10314326 3300006852 Bacteria 1386
140 Ga0075433_10440186 3300006852 Bacteria 1149
141 Ga0075433_10525919 3300006852 Unclassified 1040
142 Ga0075434_100001297 3300006871 Bacteria 20847
143 Ga0075434_100213846 3300006871 Bacteria 1948
144 Ga0075434_100268663 3300006871 Unclassified 1725
145 Ga0075434_101280226 3300006871 Bacteria 744
146 Ga0075429_100020225 3300006880 Bacteria 5772
147 Ga0075429_100209466 3300006880 Unclassified 1708
148 Ga0068865_100248810 3300006881 Bacteria 1402
149 Ga0097620_100254004 3300006931 Bacteria 1848
150 Ga0075435_100002342 3300007076 Bacteria 12556
151 Ga0075435_100152561 3300007076 Bacteria 1943
152 Ga0075435_100267368 3300007076 Bacteria 1458
153 Ga0075435_101094279 3300007076 Unclassified 697
154 Ga0105240_10125845 3300009093 Bacteria 3080
155 Ga0105240_10524556 3300009093 Bacteria 1314
156 Ga0111539_10004654 3300009094 Bacteria 17933
157 Ga0111539_10195764 3300009094 Bacteria 2357
158 Ga0111539_10438608 3300009094 Unclassified 1521
159 Ga0111539_11185557 3300009094 Bacteria 887
160 Ga0111539_12812758 3300009094 Unclassified 564
161 Ga0105245_10067589 3300009098 Bacteria 3237
162 Ga0105247_10475496 3300009101 Bacteria 906
163 Ga0114129_10000472 3300009147 Bacteria 48405
164 Ga0114129_10008144 3300009147 Bacteria 14940
165 Ga0114129_10021366 3300009147 Bacteria 9187
166 Ga0114129_10037400 3300009147 Bacteria 6853
167 Ga0114129_10199928 3300009147 Bacteria 2708
168 Ga0114129_11845428 3300009147 Bacteria 734
169 Ga0105241_10051790 3300009174 Bacteria 3132
170 Ga0105242_10072813 3300009176 Bacteria 2855
171 Ga0105242_12054050 3300009176 Unclassified 615
172 Ga0105248_10051198 3300009177 Bacteria 4634
173 Ga0105248_11195696 3300009177 Bacteria 859
174 Ga0105238_10571843 3300009551 Bacteria 1136
175 Ga0105238_11774048 3300009551 Bacteria 649
176 Ga0105249_10002636 3300009553 Bacteria 15518
177 Ga0105249_10021557 3300009553 Bacteria 5768
178 Ga0105249_10261730 3300009553 Bacteria 1719
179 Ga0157370_10261037 3300013104 Unclassified 1601
180 Ga0157369_10103107 3300013105 Bacteria 3039
181 Ga0157374_10152556 3300013296 Bacteria 2247
182 Ga0157378_10077659 3300013297 Bacteria 2994
183 Ga0163162_10154223 3300013306 Bacteria 2416
184 Ga0157375_11933432 3300013308 Bacteria 701
185 Ga0163163_10024082 3300014325 Bacteria 5792
186 Ga0163163_12018207 3300014325 Bacteria 636
187 Ga0157380_10087911 3300014326 Unclassified 2556
188 Ga0157380_10365664 3300014326 Unclassified 1355
189 Ga0157377_10733805 3300014745 Unclassified 721
190 Ga0207666_1004407 3300025271 Bacteria 1767
191 Ga0207642_10743086 3300025899 Bacteria 621
192 Ga0207688_10078191 3300025901 Bacteria 1886
193 Ga0207680_10110551 3300025903 Bacteria 1781
194 Ga0207647_10395226 3300025904 Bacteria 779
195 Ga0207699_10071008 3300025906 Bacteria 2128
196 Ga0207645_10004219 3300025907 Bacteria 10671
197 Ga0207645_10691871 3300025907 Unclassified 693
198 Ga0207707_10303263 3300025912 Bacteria 1381
199 Ga0207707_10590680 3300025912 Bacteria 940
200 Ga0207695_10407668 3300025913 Bacteria 1243
201 Ga0207695_10733867 3300025913 Bacteria 868
202 Ga0207693_11015200 3300025915 Bacteria 633
203 Ga0207662_10011642 3300025918 Bacteria 4886
204 Ga0207649_10004641 3300025920 Bacteria 7441
205 Ga0207649_10104354 3300025920 Unclassified 1882
206 Ga0207649_10530358 3300025920 Bacteria 899
207 Ga0207649_11314945 3300025920 Bacteria 572
208 Ga0207681_10001836 3300025923 Bacteria 13605
209 Ga0207681_10145774 3300025923 Bacteria 1769
210 Ga0207681_11241450 3300025923 Unclassified 626
211 Ga0207694_10290042 3300025924 Bacteria 1346
212 Ga0207650_10010676 3300025925 Bacteria 6308
213 Ga0207650_10011988 3300025925 Bacteria 5977
214 Ga0207650_10017706 3300025925 Bacteria 4992
215 Ga0207650_10401022 3300025925 Unclassified 1135
216 Ga0207659_10197191 3300025926 Unclassified 1605
217 Ga0207659_10286566 3300025926 Bacteria 1348
218 Ga0207687_10192666 3300025927 Bacteria 1588
219 Ga0207700_10119430 3300025928 Unclassified 2135
220 Ga0207644_10295776 3300025931 Bacteria 1303
221 Ga0207644_10388855 3300025931 Bacteria 1138
222 Ga0207690_10087554 3300025932 Bacteria 2192
223 Ga0207690_10308781 3300025932 Bacteria 1240
224 Ga0207690_10338817 3300025932 Unclassified 1186
225 Ga0207706_10133175 3300025933 Bacteria 2186
226 Ga0207706_10166222 3300025933 Bacteria 1939
227 Ga0207706_10412653 3300025933 Bacteria 1170
228 Ga0207706_10419852 3300025933 Bacteria 1159
229 Ga0207670_10003383 3300025936 Bacteria 8467
230 Ga0207669_10195237 3300025937 Bacteria 1464
231 Ga0207691_10005665 3300025940 Bacteria 12076
232 Ga0207691_10376147 3300025940 Bacteria 1213
233 Ga0207711_10008305 3300025941 Bacteria 8692
234 Ga0207689_10430959 3300025942 Bacteria 1101
235 Ga0207661_10001721 3300025944 Bacteria 14978
236 Ga0207661_10024728 3300025944 Bacteria 4555
237 Ga0207679_10015809 3300025945 Bacteria 4999
238 Ga0207679_10019088 3300025945 Bacteria 4601
239 Ga0207679_10152098 3300025945 Bacteria 1885
240 Ga0207679_10266903 3300025945 Bacteria 1462
241 Ga0207679_10523308 3300025945 Bacteria 1061
242 Ga0207679_10992016 3300025945 Bacteria 770
243 Ga0207651_10002035 3300025960 Bacteria 9508
244 Ga0207651_10151209 3300025960 Bacteria 1807
245 Ga0207712_10253098 3300025961 Bacteria 1425
246 Ga0207668_10692292 3300025972 Bacteria 895
247 Ga0207640_11659073 3300025981 Bacteria 577
248 Ga0207658_10254744 3300025986 Bacteria 1493
249 Ga0207658_10941327 3300025986 Unclassified 787
250 Ga0207678_10072405 3300026067 Bacteria 2953
251 Ga0207678_10447244 3300026067 Bacteria 1123
252 Ga0207708_10025751 3300026075 Bacteria 4452
253 Ga0207708_10899272 3300026075 Unclassified 766
254 Ga0207702_10303913 3300026078 Unclassified 1515
255 Ga0207648_10007877 3300026089 Bacteria 10394
256 Ga0207648_10307490 3300026089 Archaea 1423
257 Ga0207648_10371203 3300026089 Bacteria 1292
258 Ga0207648_11043070 3300026089 Unclassified 766
259 Ga0207676_10048249 3300026095 Bacteria 3305
260 Ga0207676_10259566 3300026095 Bacteria 1568
261 Ga0207676_11485336 3300026095 Bacteria 674
262 Ga0207674_10015370 3300026116 Bacteria 8410
263 Ga0207675_100070287 3300026118 Bacteria 3272
264 Ga0207675_101517029 3300026118 Bacteria 691
265 Ga0207683_10034341 3300026121 Bacteria 4407
266 Ga0207683_10286572 3300026121 Archaea 1506
267 Ga0207683_11203349 3300026121 Unclassified 702
268 Ga0209813_10252873 3300027866 Bacteria 670
269 Ga0207428_10008978 3300027907 Bacteria 9005
270 Ga0207428_10198631 3300027907 Unclassified 1509
271 Ga0207428_10531456 3300027907 Bacteria 852
272 Ga0268266_10485504 3300028379 Unclassified 1178
273 Ga0268265_10133892 3300028380 Bacteria 2064
274 Ga0268265_10398641 3300028380 Unclassified 1271
275 Ga0268264_10126483 3300028381 Bacteria 2259
276 Ga0307408_100141807 3300031548 Unclassified 1887
277 Ga0307408_100255417 3300031548 Bacteria 1448
278 Ga0307408_100512298 3300031548 Bacteria 1052
279 Ga0307408_100632913 3300031548 Unclassified 954
280 Ga0307413_10965838 3300031824 Unclassified 728
281 Ga0307413_11809779 3300031824 Bacteria 547
282 Ga0307410_10355331 3300031852 Unclassified 1172
283 Ga0307410_10543885 3300031852 Unclassified 962
284 Ga0307406_10041643 3300031901 Bacteria 2863
285 Ga0307406_10235859 3300031901 Bacteria 1369
286 Ga0307407_10057255 3300031903 Bacteria 2260
287 Ga0307407_10345463 3300031903 Bacteria 1052
288 Ga0307412_10129298 3300031911 Bacteria 1832
289 Ga0307412_11293164 3300031911 Bacteria 656
290 Ga0307409_100061918 3300031995 Unclassified 2927
291 Ga0307409_100466474 3300031995 Unclassified 1222
292 Ga0307409_101054744 3300031995 Unclassified 833
293 Ga0307416_100240653 3300032002 Bacteria 1753
294 Ga0307416_100277296 3300032002 Bacteria 1651
295 Ga0307416_100556524 3300032002 Bacteria 1221
296 Ga0307416_100788792 3300032002 Unclassified 1045
297 Ga0307416_101115924 3300032002 Bacteria 893
298 Ga0307416_102626583 3300032002 Bacteria 601
299 Ga0307411_10015366 3300032005 Bacteria 4297
300 Ga0307411_10700230 3300032005 Bacteria 882
301 Ga0373934_0039908 3300035086 Unclassified 1851
302 Ga0373949_0125897 3300035090 Bacteria 723
303 Ga0373943_0084486 3300035170 Bacteria 1633
304 Ga0373946_0229875 3300035171 Bacteria 898
305 Ga0373955_0108329 3300035172 Bacteria 1604
306 Ga0373931_0058155 3300035691 Bacteria 2076
307 Ga0373931_0354547 3300035691 Bacteria 919
308 Ga0373935_0056512 3300035692 Unclassified 2502
309 Ga0373935_0152077 3300035692 Bacteria 1571
310 Ga0373947_0224179 3300035725 Bacteria 1236
311 Ga0373947_0246781 3300035725 Unclassified 1179
312 Ga0373937_0031242 3300036401 Bacteria 4824
313 Ga0373925_0002601 3300037068 Bacteria 14344
314 Ga0439439_0094532 3300041406 Bacteria 819
315 Ga0439453_0172931 3300041408 Unclassified 523
316 Ga0451853_2886318 3300041512 Bacteria 839
317 Ga0439431_0012307 3300041997 Bacteria 1964
318 Ga0439433_0014442 3300041999 Bacteria 1739
319 Ga0439441_064574 3300042001 Bacteria 776
320 Ga0439449_0029815 3300042007 Bacteria 2033
321 Ga0439449_0210554 3300042007 Bacteria 728
322 Ga0450911_028725 3300042115 Unclassified 721
323 Ga0450917_007040 3300042120 Bacteria 855
324 Ga0439446_0025501 3300042156 Bacteria 1689
325 Ga0439435_0227221 3300042436 Unclassified 622
326 Ga0439464_0055561 3300042439 Bacteria 1152
327 Ga0439460_0278363 3300042461 Unclassified 582
328 Ga0450916_044996 3300042530 Unclassified 681
329 Ga0451577_0407218 3300042876 Bacteria 1234
330 Ga0453684_0096905 3300044712 Bacteria 3622
331 Ga0495629_0483120 3300046459 Bacteria 837
332 Ga0495582_0271748 3300046473 Bacteria 973
333 Ga0495586_0254425 3300046535 Bacteria 1002
334 Ga0495598_0397105 3300046537 Bacteria 538
335 Ga0495656_0200845 3300046615 Unclassified 989
336 Ga0495658_0491189 3300046683 Unclassified 785
337 Ga0495613_0049734 3300046689 Bacteria 3093
338 Ga0495589_0185432 3300046794 Bacteria 986
339 Ga0496102_1074971 3300048905 Unclassified 724
340 Ga0496103_0308890 3300048906 Unclassified 1017
341 Ga0496103_0454810 3300048906 Bacteria 821
342 Ga0496104_0000390 3300048907 Bacteria 38304
343 Ga0496104_0345375 3300048907 Bacteria 1401
344 Ga0496105_0016866 3300048908 Bacteria 5842
345 Ga0496105_0176170 3300048908 Bacteria 1752
346 Ga0496106_0032863 3300048909 Bacteria 3869
347 Ga0496106_0245663 3300048909 Bacteria 1430
348 Ga0496106_0310440 3300048909 Bacteria 1265
349 Ga0496107_0295334 3300048910 Bacteria 1206
350 Ga0496108_0000991 3300048911 Bacteria 22120
351 Ga0496108_0127227 3300048911 Bacteria 2188
352 Ga0496109_0001039 3300048912 Bacteria 22972
353 Ga0496110_0000315 3300048913 Bacteria 31988
354 Ga0496111_0029037 3300048914 Bacteria 3924
355 Ga0496111_0193547 3300048914 Bacteria 1512
356 Ga0496112_0000363 3300048915 Bacteria 29575
357 Ga0496112_0154652 3300048915 Bacteria 2261
358 Ga0496112_0208720 3300048915 Bacteria 1911
359 Ga0496113_0056287 3300048916 Bacteria 2952
360 Ga0496113_0116109 3300048916 Bacteria 2088
361 Ga0496113_0811182 3300048916 Bacteria 743
362 Ga0501031_0182516 3300049568 Bacteria 1371
363 Ga0501033_0686936 3300049570 Bacteria 697
364 Ga0501034_0125662 3300049571 Bacteria 2550
365 Ga0501034_0563262 3300049571 Unclassified 1048
366 Ga0501036_0033507 3300049572 Bacteria 4344
367 Ga0501036_0305527 3300049572 Bacteria 1330
368 Ga0501037_0130810 3300049573 Bacteria 1800
369 Ga0501038_0221688 3300049574 Bacteria 1508
370 Ga0501038_0854582 3300049574 Bacteria 674
371 Ga0501039_0109158 3300049575 Bacteria 2163
372 Ga0501039_1195078 3300049575 Bacteria 588
373 Ga0501040_0085684 3300049576 Bacteria 2187
374 Ga0501040_0660763 3300049576 Bacteria 755
375 Ga0501040_0917705 3300049576 Unclassified 634
376 Ga0501041_0096637 3300049577 Bacteria 1826
377 Ga0501041_0117826 3300049577 Bacteria 1649
378 Ga0501042_0021771 3300049578 Bacteria 4471
379 Ga0501042_0753585 3300049578 Unclassified 708
380 Ga0501042_1309773 3300049578 Archaea 528
381 Ga0501043_0249247 3300049579 Bacteria 1368
382 Ga0501046_0210848 3300049580 Bacteria 1442
383 Ga0501046_0640183 3300049580 Bacteria 752
384 Ga0501047_0005757 3300049581 Bacteria 11670
385 Ga0501047_0786720 3300049581 Bacteria 766
386 Ga0501048_0028955 3300049582 Bacteria 4020
387 Ga0501048_0115792 3300049582 Bacteria 1894
388 Ga0501067_0573363 3300049583 Bacteria 632
389 Ga0501068_0679164 3300049584 Bacteria 673
390 Ga0501069_0268521 3300049585 Bacteria 997
391 Ga0501070_0420273 3300049586 Bacteria 1080
392 Ga0501071_0008132 3300049587 Bacteria 6918
393 Ga0501071_0107786 3300049587 Bacteria 2057
394 Ga0501071_0152401 3300049587 Bacteria 1725
395 Ga0501071_1251543 3300049587 Bacteria 573
396 Ga0501072_0045735 3300049588 Bacteria 3443
397 Ga0501072_0532582 3300049588 Bacteria 928
398 Ga0501072_0909294 3300049588 Bacteria 687
399 Ga0501073_0720491 3300049589 Bacteria 688
400 Ga0501073_0815919 3300049589 Bacteria 643
401 Ga0501074_0292314 3300049590 Bacteria 1158
402 Ga0501074_0331435 3300049590 Bacteria 1080
403 Ga0501075_0031090 3300049591 Bacteria 3961
404 Ga0501075_0056721 3300049591 Bacteria 2949
405 Ga0501075_0202353 3300049591 Bacteria 1514
406 Ga0501075_0302140 3300049591 Bacteria 1219
407 Ga0501075_0661759 3300049591 Bacteria 796
408 Ga0501076_0026697 3300049592 Bacteria 4476
409 Ga0501076_0748274 3300049592 Bacteria 807
410 Ga0501076_0812644 3300049592 Unclassified 771
411 Ga0501077_0007284 3300049593 Bacteria 6825
412 Ga0501217_239054 3300049661 Bacteria 581
413 Ga0501079_0142115 3300049741 Unclassified 1870
414 Ga0501079_1028603 3300049741 Unclassified 649
415 Ga0501080_0078230 3300049742 Bacteria 3076
416 Ga0501080_1548800 3300049742 Bacteria 562
417 Ga0501081_0631959 3300049743 Bacteria 802
418 Ga0501083_0280919 3300049744 Bacteria 1083
419 Ga0501268_011182 3300049765 Bacteria 1412
420 Ga0501035_0222113 3300049822 Bacteria 1613
421 Ga0501035_0503917 3300049822 Bacteria 996
422 Ga0501045_0008835 3300049824 Bacteria 7037
423 Ga0501045_0019557 3300049824 Bacteria 4830
424 Ga0501045_0045503 3300049824 Bacteria 3195
425 Ga0501045_1325464 3300049824 Unclassified 523
426 nmdc:mga00v17_11231_c1 3300050491 Bacteria 4919
427 nmdc:mga00v17_208295_c1 3300050491 Bacteria 1265
428 nmdc:mga00v17_30396_c1 3300050491 Bacteria 3178
429 nmdc:mga00v17_353742_c1 3300050491 Bacteria 955
430 nmdc:mga00v17_5548_c1 3300050491 Bacteria 6651
431 nmdc:mga0yw44_698507_c1 3300050492 Bacteria 689
432 nmdc:mga0k408_231739_c1 3300050493 Unclassified 1102
433 nmdc:mga0k408_2515_c1 3300050493 Bacteria 9750
434 nmdc:mga0k408_7099_c1 3300050493 Bacteria 5984
435 nmdc:mga06z11_177039_c1 3300050494 Bacteria 1228
436 nmdc:mga06z11_70386_c1 3300050494 Unclassified 1849
437 nmdc:mga04h51_285565_c1 3300050495 Bacteria 669
438 nmdc:mga04h51_9975_c1 3300050495 Bacteria 2594
439 nmdc:mga07m45_2386_c1 3300050496 Bacteria 8801
440 nmdc:mga05p37_135125_c1 3300050507 Unclassified 3025
441 nmdc:mga05p37_135363_c1 3300050507 Bacteria 3022
442 nmdc:mga05p37_1382385_c1 3300050507 Bacteria 711
443 nmdc:mga05p37_25836_c1 3300050507 Bacteria 7140
444 nmdc:mga05p37_299_c2 3300050507 Bacteria 40446
445 nmdc:mga09592_306327_c1 3300050508 Unclassified 1377
446 nmdc:mga09592_39573_c1 3300050508 Unclassified 3960
447 nmdc:mga09592_76599_c1 3300050508 Unclassified 2844
448 nmdc:mga0qj67_10454_c1 3300050509 Bacteria 6933
449 nmdc:mga0qj67_339875_c1 3300050509 Bacteria 1214
450 nmdc:mga0qj67_9309_c1 3300050509 Bacteria 7305
451 nmdc:mga06r32_160772_c1 3300050510 Bacteria 2229
452 nmdc:mga06r32_267986_c1 3300050510 Unclassified 1695
453 nmdc:mga06r32_543699_c1 3300050510 Viruses 1136
454 nmdc:mga06r32_67328_c1 3300050510 Unclassified 3457
455 nmdc:mga08y16_348821_c1 3300050511 Unclassified 1521
456 nmdc:mga08y16_475789_c1 3300050511 Unclassified 1271
457 nmdc:mga08y16_6477_c1 3300050511 Bacteria 12286
458 nmdc:mga08y16_794004_c1 3300050511 Bacteria 940
459 nmdc:mga0n895_1261852_c1 3300050512 Bacteria 711
460 nmdc:mga0n895_1652876_c1 3300050512 Bacteria 604
461 nmdc:mga0n895_195826_c1 3300050512 Bacteria 2052
462 nmdc:mga0n895_2005_c1 3300050512 Bacteria 15635
463 nmdc:mga0n895_232220_c1 3300050512 Unclassified 1872
464 nmdc:mga0n895_267213_c1 3300050512 Unclassified 1735
465 nmdc:mga0rr50_138349_c1 3300050513 Bacteria 1956
466 nmdc:mga0rr50_3512_c1 3300050513 Bacteria 9040
467 nmdc:mga08x19_137994_c1 3300050514 Bacteria 1645
468 nmdc:mga0a205_369482_c1 3300050515 Unclassified 1300
469 nmdc:mga0a205_691839_c1 3300050515 Bacteria 870
470 nmdc:mga0a205_88965_c1 3300050515 Bacteria 1602
471 Ga0495595_0214145 3300053084 Bacteria 961
472 Ga0500628_010434 3300053129 Bacteria 1664
473 Ga0501084_0029633 3300054114 Bacteria 4578
474 Ga0501084_0265645 3300054114 Bacteria 1449
475 Ga0590071_012557 3300059421 Bacteria 1984
476 Ga0590074_000929 3300059423 Bacteria 4585
477 Ga0590075_000384 3300059424 Bacteria 12137
478 Ga0590075_028894 3300059424 Bacteria 1401
479 Ga0590077_000040 3300059426 Bacteria 29723
480 Ga0501082_0233113 3300060353 Bacteria 1602
481 Ga0501082_0263381 3300060353 Unclassified 1500
482 Ga0530510_0127570 3300061734 Unclassified 1871
483 Ga0590071_013560
484 MBSR1b_contig_8378379
485 Ga0065712_10106765
486 Ga0065715_10005698
487 Ga0065715_10121730
488 Ga0065715_10129858
489 Ga0065715_10609039
490 Ga0065707_10084770
491 Ga0070683_100000670
492 Ga0070683_100022975
493 Ga0070690_100015638
494 Ga0070670_100002296
495 Ga0070670_100003090
496 Ga0070670_100027852
497 Ga0070670_100439381
498 Ga0070677_10146770
499 Ga0070677_10204267
500 Ga0070682_100581238
501 Ga0070682_101067758
502 Ga0068868_101117259
503 Ga0070660_100242288
504 Ga0070660_100360504
505 Ga0070689_100048975
506 Ga0070691_10020156
507 Ga0070687_100003525
508 Ga0070661_100010930
509 Ga0070661_100037827
510 Ga0070661_100646657
511 Ga0070661_100700691
512 Ga0070661_101599722
513 Ga0070692_10228344
514 Ga0070668_101690152
515 Ga0070669_100000449
516 Ga0070669_100121720
517 Ga0070669_100139183
518 Ga0070669_101331951
519 Ga0070675_100276339
520 Ga0070675_100295925
521 Ga0070675_100342332
522 Ga0070675_100412153
523 Ga0070675_100798185
524 Ga0070671_100243412
525 Ga0070671_100360949
526 Ga0070674_100150707
527 Ga0070674_100460722
528 Ga0070674_100677512
529 Ga0070673_100004791
530 Ga0070673_100178591
531 Ga0070673_101373934
532 Ga0070688_100186625
533 Ga0070659_100078878
534 Ga0070659_100119075
535 Ga0070659_100252023
536 Ga0070659_100391377
537 Ga0070667_100101900
538 Ga0070667_101056495
539 Ga0070713_100129477
540 Ga0070701_10051206
541 Ga0070705_100007123
542 Ga0070700_100047050
543 Ga0070663_100032276
544 Ga0070678_100336085
545 Ga0070662_100045453
546 Ga0070662_100115639
547 Ga0070681_10272788
548 Ga0070681_10388256
549 Ga0068867_100109730
550 Ga0068867_101107714
551 Ga0070706_100150982
552 Ga0070698_100443069
553 Ga0070699_100195880
554 Ga0070684_100017883
555 Ga0070684_100062824
556 Ga0070697_101384469
557 Ga0068853_100903890
558 Ga0068853_101855046
559 Ga0070672_100001666
560 Ga0070672_100148607
561 Ga0070672_100319284
562 Ga0070686_100006526
563 Ga0070686_100270876
564 Ga0070695_100101040
565 Ga0070695_100728472
566 Ga0070696_100329649
567 Ga0070693_100055687
568 Ga0070693_100793049
569 Ga0070665_100464349
570 Ga0068855_100289315
571 Ga0068855_100321927
572 Ga0070664_100000081
573 Ga0070664_100018020
574 Ga0070664_100306225
575 Ga0070664_100579601
576 Ga0070664_100838128
577 Ga0068857_100017813
578 Ga0068857_100196903
579 Ga0070702_100018649
580 Ga0068852_100914304
581 Ga0068859_100253995
582 Ga0068864_100012843
583 Ga0068864_100389104
584 Ga0068864_100774942
585 Ga0068866_10542410
586 Ga0068870_10200738
587 Ga0068858_100290381
588 Ga0068860_100069871
589 Ga0068862_100126275
590 Ga0068862_100162697
591 Ga0068862_101064749
592 Ga0070717_10260259
593 Ga0075365_10017414
594 Ga0075365_10264353
595 Ga0075368_10024383
596 Ga0075364_10003255
597 Ga0075364_10015454
598 Ga0075364_10061212
599 Ga0075364_10062444
600 Ga0075364_10160417
601 Ga0070712_100512201
602 Ga0075362_10001258
603 Ga0075367_10021574
604 Ga0075367_10062491
605 Ga0075367_10093897
606 Ga0075366_10026044
607 Ga0075366_10156823
608 Ga0097621_101474243
609 Ga0075428_100003841
610 Ga0075428_100005849
611 Ga0075428_100033172
612 Ga0075430_100029871
613 Ga0075430_100076847
614 Ga0075430_100099518
615 Ga0075430_100419686
616 Ga0075430_100635469
617 Ga0075431_100017139
618 Ga0075431_100031824
619 Ga0075431_100176891
620 Ga0075433_10050690
621 Ga0075433_10314326
622 Ga0075433_10440186
623 Ga0075433_10525919
624 Ga0075434_100001297
625 Ga0075434_100213846
626 Ga0075434_100268663
627 Ga0075434_101280226
628 Ga0075429_100020225
629 Ga0075429_100209466
630 Ga0068865_100248810
631 Ga0097620_100254004
632 Ga0075435_100002342
633 Ga0075435_100152561
634 Ga0075435_100267368
635 Ga0075435_101094279
636 Ga0105240_10125845
637 Ga0105240_10524556
638 Ga0111539_10004654
639 Ga0111539_10195764
640 Ga0111539_10438608
641 Ga0111539_11185557
642 Ga0111539_12812758
643 Ga0105245_10067589
644 Ga0105247_10475496
645 Ga0114129_10000472
646 Ga0114129_10008144
647 Ga0114129_10021366
648 Ga0114129_10037400
649 Ga0114129_10199928
650 Ga0114129_11845428
651 Ga0105241_10051790
652 Ga0105242_10072813
653 Ga0105242_12054050
654 Ga0105248_10051198
655 Ga0105248_11195696
656 Ga0105238_10571843
657 Ga0105238_11774048
658 Ga0105249_10002636
659 Ga0105249_10021557
660 Ga0105249_10261730
661 Ga0157370_10261037
662 Ga0157369_10103107
663 Ga0157374_10152556
664 Ga0157378_10077659
665 Ga0163162_10154223
666 Ga0157375_11933432
667 Ga0163163_10024082
668 Ga0163163_12018207
669 Ga0157380_10087911
670 Ga0157380_10365664
671 Ga0157377_10733805
672 Ga0207666_1004407
673 Ga0207642_10743086
674 Ga0207688_10078191
675 Ga0207680_10110551
676 Ga0207647_10395226
677 Ga0207699_10071008
678 Ga0207645_10004219
679 Ga0207645_10691871
680 Ga0207707_10303263
681 Ga0207707_10590680
682 Ga0207695_10407668
683 Ga0207695_10733867
684 Ga0207693_11015200
685 Ga0207662_10011642
686 Ga0207649_10004641
687 Ga0207649_10104354
688 Ga0207649_10530358
689 Ga0207649_11314945
690 Ga0207681_10001836
691 Ga0207681_10145774
692 Ga0207681_11241450
693 Ga0207694_10290042
694 Ga0207650_10010676
695 Ga0207650_10011988
696 Ga0207650_10017706
697 Ga0207650_10401022
698 Ga0207659_10197191
699 Ga0207659_10286566
700 Ga0207687_10192666
701 Ga0207700_10119430
702 Ga0207644_10295776
703 Ga0207644_10388855
704 Ga0207690_10087554
705 Ga0207690_10308781
706 Ga0207690_10338817
707 Ga0207706_10133175
708 Ga0207706_10166222
709 Ga0207706_10412653
710 Ga0207706_10419852
711 Ga0207670_10003383
712 Ga0207669_10195237
713 Ga0207691_10005665
714 Ga0207691_10376147
715 Ga0207711_10008305
716 Ga0207689_10430959
717 Ga0207661_10001721
718 Ga0207661_10024728
719 Ga0207679_10015809
720 Ga0207679_10019088
721 Ga0207679_10152098
722 Ga0207679_10266903
723 Ga0207679_10523308
724 Ga0207679_10992016
725 Ga0207651_10002035
726 Ga0207651_10151209
727 Ga0207712_10253098
728 Ga0207668_10692292
729 Ga0207640_11659073
730 Ga0207658_10254744
731 Ga0207658_10941327
732 Ga0207678_10072405
733 Ga0207678_10447244
734 Ga0207708_10025751
735 Ga0207708_10899272
736 Ga0207702_10303913
737 Ga0207648_10007877
738 Ga0207648_10307490
739 Ga0207648_10371203
740 Ga0207648_11043070
741 Ga0207676_10048249
742 Ga0207676_10259566
743 Ga0207676_11485336
744 Ga0207674_10015370
745 Ga0207675_100070287
746 Ga0207675_101517029
747 Ga0207683_10034341
748 Ga0207683_10286572
749 Ga0207683_11203349
750 Ga0209813_10252873
751 Ga0207428_10008978
752 Ga0207428_10198631
753 Ga0207428_10531456
754 Ga0268266_10485504
755 Ga0268265_10133892
756 Ga0268265_10398641
757 Ga0268264_10126483
758 Ga0307408_100141807
759 Ga0307408_100255417
760 Ga0307408_100512298
761 Ga0307408_100632913
762 Ga0307413_10965838
763 Ga0307413_11809779
764 Ga0307410_10355331
765 Ga0307410_10543885
766 Ga0307406_10041643
767 Ga0307406_10235859
768 Ga0307407_10057255
769 Ga0307407_10345463
770 Ga0307412_10129298
771 Ga0307412_11293164
772 Ga0307409_100061918
773 Ga0307409_100466474
774 Ga0307409_101054744
775 Ga0307416_100240653
776 Ga0307416_100277296
777 Ga0307416_100556524
778 Ga0307416_100788792
779 Ga0307416_101115924
780 Ga0307416_102626583
781 Ga0307411_10015366
782 Ga0307411_10700230
783 Ga0373934_0039908
784 Ga0373949_0125897
785 Ga0373943_0084486
786 Ga0373946_0229875
787 Ga0373955_0108329
788 Ga0373931_0058155
789 Ga0373931_0354547
790 Ga0373935_0056512
791 Ga0373935_0152077
792 Ga0373947_0224179
793 Ga0373947_0246781
794 Ga0373937_0031242
795 Ga0373925_0002601
796 Ga0439439_0094532
797 Ga0439453_0172931
798 Ga0451853_2886318
799 Ga0439431_0012307
800 Ga0439433_0014442
801 Ga0439441_064574
802 Ga0439449_0029815
803 Ga0439449_0210554
804 Ga0450911_028725
805 Ga0450917_007040
806 Ga0439446_0025501
807 Ga0439435_0227221
808 Ga0439464_0055561
809 Ga0439460_0278363
810 Ga0450916_044996
811 Ga0451577_0407218
812 Ga0453684_0096905
813 Ga0495629_0483120
814 Ga0495582_0271748
815 Ga0495586_0254425
816 Ga0495598_0397105
817 Ga0495656_0200845
818 Ga0495658_0491189
819 Ga0495613_0049734
820 Ga0495589_0185432
821 Ga0496102_1074971
822 Ga0496103_0308890
823 Ga0496103_0454810
824 Ga0496104_0000390
825 Ga0496104_0345375
826 Ga0496105_0016866
827 Ga0496105_0176170
828 Ga0496106_0032863
829 Ga0496106_0245663
830 Ga0496106_0310440
831 Ga0496107_0295334
832 Ga0496108_0000991
833 Ga0496108_0127227
834 Ga0496109_0001039
835 Ga0496110_0000315
836 Ga0496111_0029037
837 Ga0496111_0193547
838 Ga0496112_0000363
839 Ga0496112_0154652
840 Ga0496112_0208720
841 Ga0496113_0056287
842 Ga0496113_0116109
843 Ga0496113_0811182
844 Ga0501031_0182516
845 Ga0501033_0686936
846 Ga0501034_0125662
847 Ga0501034_0563262
848 Ga0501036_0033507
849 Ga0501036_0305527
850 Ga0501037_0130810
851 Ga0501038_0221688
852 Ga0501038_0854582
853 Ga0501039_0109158
854 Ga0501039_1195078
855 Ga0501040_0085684
856 Ga0501040_0660763
857 Ga0501040_0917705
858 Ga0501041_0096637
859 Ga0501041_0117826
860 Ga0501042_0021771
861 Ga0501042_0753585
862 Ga0501042_1309773
863 Ga0501043_0249247
864 Ga0501046_0210848
865 Ga0501046_0640183
866 Ga0501047_0005757
867 Ga0501047_0786720
868 Ga0501048_0028955
869 Ga0501048_0115792
870 Ga0501067_0573363
871 Ga0501068_0679164
872 Ga0501069_0268521
873 Ga0501070_0420273
874 Ga0501071_0008132
875 Ga0501071_0107786
876 Ga0501071_0152401
877 Ga0501071_1251543
878 Ga0501072_0045735
879 Ga0501072_0532582
880 Ga0501072_0909294
881 Ga0501073_0720491
882 Ga0501073_0815919
883 Ga0501074_0292314
884 Ga0501074_0331435
885 Ga0501075_0031090
886 Ga0501075_0056721
887 Ga0501075_0202353
888 Ga0501075_0302140
889 Ga0501075_0661759
890 Ga0501076_0026697
891 Ga0501076_0748274
892 Ga0501076_0812644
893 Ga0501077_0007284
894 Ga0501217_239054
895 Ga0501079_0142115
896 Ga0501079_1028603
897 Ga0501080_0078230
898 Ga0501080_1548800
899 Ga0501081_0631959
900 Ga0501083_0280919
901 Ga0501268_011182
902 Ga0501035_0222113
903 Ga0501035_0503917
904 Ga0501045_0008835
905 Ga0501045_0019557
906 Ga0501045_0045503
907 Ga0501045_1325464
908 nmdc:mga00v17_11231_c1
909 nmdc:mga00v17_208295_c1
910 nmdc:mga00v17_30396_c1
911 nmdc:mga00v17_353742_c1
912 nmdc:mga00v17_5548_c1
913 nmdc:mga0yw44_698507_c1
914 nmdc:mga0k408_231739_c1
915 nmdc:mga0k408_2515_c1
916 nmdc:mga0k408_7099_c1
917 nmdc:mga06z11_177039_c1
918 nmdc:mga06z11_70386_c1
919 nmdc:mga04h51_285565_c1
920 nmdc:mga04h51_9975_c1
921 nmdc:mga07m45_2386_c1
922 nmdc:mga05p37_135125_c1
923 nmdc:mga05p37_135363_c1
924 nmdc:mga05p37_1382385_c1
925 nmdc:mga05p37_25836_c1
926 nmdc:mga05p37_299_c2
927 nmdc:mga09592_306327_c1
928 nmdc:mga09592_39573_c1
929 nmdc:mga09592_76599_c1
930 nmdc:mga0qj67_10454_c1
931 nmdc:mga0qj67_339875_c1
932 nmdc:mga0qj67_9309_c1
933 nmdc:mga06r32_160772_c1
934 nmdc:mga06r32_267986_c1
935 nmdc:mga06r32_543699_c1
936 nmdc:mga06r32_67328_c1
937 nmdc:mga08y16_348821_c1
938 nmdc:mga08y16_475789_c1
939 nmdc:mga08y16_6477_c1
940 nmdc:mga08y16_794004_c1
941 nmdc:mga0n895_1261852_c1
942 nmdc:mga0n895_1652876_c1
943 nmdc:mga0n895_195826_c1
944 nmdc:mga0n895_2005_c1
945 nmdc:mga0n895_232220_c1
946 nmdc:mga0n895_267213_c1
947 nmdc:mga0rr50_138349_c1
948 nmdc:mga0rr50_3512_c1
949 nmdc:mga08x19_137994_c1
950 nmdc:mga0a205_369482_c1
951 nmdc:mga0a205_691839_c1
952 nmdc:mga0a205_88965_c1
953 Ga0495595_0214145
954 Ga0500628_010434
955 Ga0501084_0029633
956 Ga0501084_0265645
957 Ga0590071_012557
958 Ga0590074_000929
959 Ga0590075_000384
960 Ga0590075_028894
961 Ga0590077_000040
962 Ga0501082_0233113
963 Ga0501082_0263381
964 Ga0530510_0127570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nqn-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.5648 44 146
1xg2-assembly1.cif.gz_B crystal structure of the complex between pectin methylesterase and its inhibitor protein 0.5277 32 143
2cj5-assembly1.cif.gz_A crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0) 0.5277 40 141
6q6b-assembly1.cif.gz_A structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents 0.5227 19 151
6q6b-assembly1.cif.gz_A structure of the copper storage protein, ccsp, from streptomyces lividans loaded with 10 copper equivalents 0.517 19 151
ID Description Score Start End Superfamily
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.6862 40 149 1.20.1440.60
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.6623 40 149 1.20.1440.60
af_Q3KQJ0_93_231_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6497 1 144 1.10.10.1740
af_Q3KQJ0_93_231_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6387 1 144 1.10.10.1740
2rldB00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.6186 41 146 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A1F2TSZ0-F1-model_v4 Uncharacterized protein 0.9985 1 151 GO:0016020
AF-A0A1F2TSZ0-F1-model_v4 Uncharacterized protein 0.9919 1 151 GO:0016020
AF-A0A7X4I3A3-F1-model_v4 Uncharacterized protein 0.9787 1 151 GO:0016020
AF-A0A2E6ZW29-F1-model_v4 Uncharacterized protein 0.9768 1 151 GO:0016020
AF-A0A7X4I3A3-F1-model_v4 Uncharacterized protein 0.9723 1 151 GO:0016020

Map