F452638

General Info

Members Datasets Scaffolds Average Seq Length
482 299 964 316

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10129542|Ga0307407_101295422
Length 346
Sequence MAGPETPDRDGGLATGPRPGGAGSPSAGDPDRLEIAGAGTAPAAAPRPAGGRLRETSPATPWLFLAPYLLLFGVFVALPIVYGLWISLREYDYTLPGKPFVGLQNYTDLFASDSVTADIFWTSMRATGIFMVFSVPLLLVVPLGVALVMHQRFPGRNLFRAVYFAPYVLGVAVVALLWRFLLDRNIGVVNHYLGVLGLPDQTAWLTSTPAAWVALVGVTLWWTLGFNAVIYLAGLQDIPLELYEAARMDGANGWQRFRHVTLPGLRPVLQFVTMVTIIASANMFGQSYLMTQGQPGTETRTAIYQIAETGLRNFSMGDAAAMSYILTFLLMLLSVGVFALFRERKG

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
255 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
256 2643221679 Angustibacter sp. Root456 Isolate Unclassified
257 2643221711 Terrabacter sp. Root85 Isolate Unclassified
258 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
259 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
260 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
261 2773857759 Microbacterium sp. 1294 Isolate Unclassified
262 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
263 2808606394 Promicromonospora sp. C35 Isolate Unclassified
264 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
265 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
266 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
267 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
268 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
269 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
270 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
271 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
272 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
273 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
274 2858882152 Micromonospora noduli MED15 Isolate Nodule
275 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
276 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
277 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
278 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
279 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
280 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
281 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
282 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
283 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
284 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
285 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
286 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
287 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
288 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
289 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
290 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
291 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
292 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
293 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
294 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
295 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
296 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
297 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
298 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
299 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.42
Metatranscriptomes 0.83
Isolates 9.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0.83
Rhizoplane 5.81
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10129542 3300031903 Bacteria 1612
2 JGI24740J21852_10033291 3300001979 Bacteria 1638
3 JGI24743J22301_10001348 3300001991 Bacteria 3369
4 JGI24738J21930_10010288 3300002075 Bacteria 2084
5 JGI24738J21930_10012919 3300002075 Bacteria 1815
6 JGI24751J29686_10002209 3300002459 Bacteria 3953
7 Ga0055538_1000241 3300003751 Bacteria 29788
8 Ga0070658_10007980 3300005327 Bacteria 8516
9 Ga0070658_10032650 3300005327 Bacteria 4186
10 Ga0070676_10006324 3300005328 Bacteria 6330
11 Ga0070683_100000377 3300005329 Bacteria 30991
12 Ga0070683_100009474 3300005329 Bacteria 8331
13 Ga0070683_100019447 3300005329 Bacteria 6032
14 Ga0070683_100054001 3300005329 Bacteria 3724
15 Ga0070683_100115041 3300005329 Bacteria 2539
16 Ga0070670_100006150 3300005331 Bacteria 10148
17 Ga0068869_100000879 3300005334 Bacteria 17295
18 Ga0068869_100353059 3300005334 Bacteria 1199
19 Ga0070680_100011306 3300005336 Bacteria 6903
20 Ga0070680_100074310 3300005336 Bacteria 2797
21 Ga0070682_100008649 3300005337 Bacteria 5748
22 Ga0070682_100097160 3300005337 Bacteria 1938
23 Ga0068868_100004527 3300005338 Bacteria 9756
24 Ga0068868_100052992 3300005338 Bacteria 3195
25 Ga0070660_100003828 3300005339 Bacteria 10392
26 Ga0070660_100005618 3300005339 Bacteria 8692
27 Ga0070689_100002059 3300005340 Bacteria 13059
28 Ga0070691_10004392 3300005341 Bacteria 6406
29 Ga0070691_10037216 3300005341 Bacteria 2296
30 Ga0070687_100032833 3300005343 Bacteria 2557
31 Ga0070661_100024395 3300005344 Bacteria 4337
32 Ga0070661_100170215 3300005344 Bacteria 1654
33 Ga0070692_10000897 3300005345 Bacteria 10080
34 Ga0070669_100093670 3300005353 Bacteria 2256
35 Ga0070675_100003936 3300005354 Bacteria 11254
36 Ga0070675_100008258 3300005354 Bacteria 8075
37 Ga0070671_100006897 3300005355 Bacteria 9098
38 Ga0070673_100008584 3300005364 Bacteria 6802
39 Ga0070688_100051672 3300005365 Bacteria 2565
40 Ga0070659_100011657 3300005366 Bacteria 6506
41 Ga0070659_100015824 3300005366 Bacteria 5655
42 Ga0070659_100017151 3300005366 Bacteria 5443
43 Ga0070659_100029135 3300005366 Bacteria 4266
44 Ga0070659_100211589 3300005366 Bacteria 1598
45 Ga0070667_100337070 3300005367 Bacteria 1363
46 Ga0070714_100000002 3300005435 Bacteria 386673
47 Ga0070710_10012904 3300005437 Bacteria 4164
48 Ga0070705_100017715 3300005440 Bacteria 3722
49 Ga0070705_100096352 3300005440 Bacteria 1857
50 Ga0070700_100001556 3300005441 Bacteria 11441
51 Ga0070700_100035762 3300005441 Bacteria 3008
52 Ga0070694_100104320 3300005444 Bacteria 2010
53 Ga0070663_100000822 3300005455 Bacteria 16841
54 Ga0070663_100001438 3300005455 Bacteria 13050
55 Ga0070678_100002617 3300005456 Bacteria 9901
56 Ga0070662_100007730 3300005457 Bacteria 6979
57 Ga0070681_10004585 3300005458 Bacteria 13188
58 Ga0070681_10031408 3300005458 Bacteria 5333
59 Ga0070681_10405881 3300005458 Bacteria 1274
60 Ga0068867_100067163 3300005459 Bacteria 2672
61 Ga0070685_10071167 3300005466 Bacteria 2061
62 Ga0070698_100055333 3300005471 Bacteria 4024
63 Ga0070699_100059562 3300005518 Bacteria 3307
64 Ga0070679_100029532 3300005530 Bacteria 5410
65 Ga0070679_100191309 3300005530 Bacteria 2015
66 Ga0070679_100597277 3300005530 Bacteria 1047
67 Ga0070684_100001573 3300005535 Bacteria 16476
68 Ga0070684_100007303 3300005535 Bacteria 8589
69 Ga0070684_100014266 3300005535 Bacteria 6431
70 Ga0070684_100039310 3300005535 Bacteria 4068
71 Ga0070684_100057554 3300005535 Bacteria 3394
72 Ga0068853_100022695 3300005539 Bacteria 5245
73 Ga0068853_100069995 3300005539 Bacteria 3053
74 Ga0068853_100089320 3300005539 Bacteria 2706
75 Ga0070695_100192429 3300005545 Bacteria 1453
76 Ga0070696_100032386 3300005546 Bacteria 3586
77 Ga0070693_100000597 3300005547 Bacteria 16009
78 Ga0070665_100193052 3300005548 Bacteria 2037
79 Ga0068855_100003976 3300005563 Bacteria 18055
80 Ga0068855_100039564 3300005563 Bacteria 5598
81 Ga0070664_100006777 3300005564 Bacteria 9237
82 Ga0070664_100009091 3300005564 Bacteria 8064
83 Ga0068857_100041212 3300005577 Bacteria 4095
84 Ga0068857_100114167 3300005577 Bacteria 2429
85 Ga0068854_100022146 3300005578 Bacteria 4323
86 Ga0068854_100127869 3300005578 Bacteria 1937
87 Ga0068856_100042808 3300005614 Bacteria 4456
88 Ga0070702_100000706 3300005615 Bacteria 12601
89 Ga0070702_100001246 3300005615 Bacteria 10330
90 Ga0068852_100006365 3300005616 Bacteria 8529
91 Ga0068852_100024511 3300005616 Bacteria 4878
92 Ga0068852_100025782 3300005616 Bacteria 4768
93 Ga0068852_100063920 3300005616 Bacteria 3206
94 Ga0068852_100075709 3300005616 Bacteria 2969
95 Ga0068852_100370108 3300005616 Bacteria 1404
96 Ga0068864_100029924 3300005618 Bacteria 4615
97 Ga0068866_10030631 3300005718 Bacteria 2584
98 Ga0068861_100052791 3300005719 Bacteria 3091
99 Ga0068870_10001648 3300005840 Bacteria 9124
100 Ga0068870_10001787 3300005840 Bacteria 8818
101 Ga0068863_100006277 3300005841 Bacteria 11674
102 Ga0068858_100008068 3300005842 Bacteria 10140
103 Ga0068860_100419694 3300005843 Bacteria 1326
104 Ga0068862_100182511 3300005844 Bacteria 1884
105 Ga0068862_100418327 3300005844 Bacteria 1257
106 Ga0081538_10017858 3300005981 Bacteria 5360
107 Ga0081538_10033386 3300005981 Bacteria 3428
108 Ga0081539_10002216 3300005985 Bacteria 28349
109 Ga0081539_10016808 3300005985 Bacteria 5191
110 Ga0081539_10019882 3300005985 Bacteria 4573
111 Ga0081539_10120551 3300005985 Bacteria 1304
112 Ga0075365_10013161 3300006038 Bacteria 4936
113 Ga0075364_10162640 3300006051 Bacteria 1507
114 Ga0075432_10004409 3300006058 Bacteria 4793
115 Ga0097621_100008405 3300006237 Bacteria 7431
116 Ga0075428_100008350 3300006844 Bacteria 11482
117 Ga0075428_100030309 3300006844 Bacteria 5984
118 Ga0075428_100175542 3300006844 Bacteria 2321
119 Ga0075430_100006425 3300006846 Bacteria 9911
120 Ga0075431_100003235 3300006847 Bacteria 15775
121 Ga0075433_10008022 3300006852 Bacteria 8408
122 Ga0075434_100009551 3300006871 Bacteria 9053
123 Ga0068865_100004002 3300006881 Bacteria 8851
124 Ga0075435_100008266 3300007076 Bacteria 7456
125 Ga0105240_10010055 3300009093 Bacteria 13322
126 Ga0105240_10355276 3300009093 Bacteria 1661
127 Ga0111539_10001973 3300009094 Bacteria 27387
128 Ga0111539_10326018 3300009094 Bacteria 1787
129 Ga0105245_10007645 3300009098 Bacteria 9466
130 Ga0105245_10021211 3300009098 Bacteria 5695
131 Ga0105245_10061124 3300009098 Bacteria 3395
132 Ga0105245_10232196 3300009098 Bacteria 1785
133 Ga0105247_10004541 3300009101 Bacteria 8848
134 Ga0114129_10014503 3300009147 Bacteria 11231
135 Ga0114129_10021013 3300009147 Bacteria 9270
136 Ga0105243_10005906 3300009148 Bacteria 9482
137 Ga0105243_10010293 3300009148 Bacteria 7103
138 Ga0105243_10046130 3300009148 Bacteria 3426
139 Ga0105241_10003699 3300009174 Bacteria 11365
140 Ga0105241_10231219 3300009174 Bacteria 1559
141 Ga0105248_10038714 3300009177 Bacteria 5338
142 Ga0105248_10058489 3300009177 Bacteria 4329
143 Ga0105237_10196764 3300009545 Bacteria 2016
144 Ga0105238_10039395 3300009551 Bacteria 4791
145 Ga0105249_10127596 3300009553 Bacteria 2424
146 Ga0105239_10049484 3300010375 Bacteria 4608
147 Ga0105239_10087353 3300010375 Bacteria 3437
148 Ga0105239_10180880 3300010375 Bacteria 2359
149 Ga0105246_10016216 3300011119 Bacteria 4716
150 Ga0157373_10074661 3300013100 Bacteria 2392
151 Ga0157371_10006633 3300013102 Bacteria 9490
152 Ga0157371_10091754 3300013102 Bacteria 2151
153 Ga0157370_10008277 3300013104 Bacteria 11226
154 Ga0157370_10011175 3300013104 Bacteria 9414
155 Ga0157370_10092883 3300013104 Bacteria 2831
156 Ga0157369_10012854 3300013105 Bacteria 9488
157 Ga0157369_10016359 3300013105 Bacteria 8346
158 Ga0157369_10016626 3300013105 Bacteria 8271
159 Ga0157369_10020014 3300013105 Bacteria 7484
160 Ga0157369_10415376 3300013105 Bacteria 1395
161 Ga0157374_10004351 3300013296 Bacteria 11923
162 Ga0157372_10010042 3300013307 Bacteria 10066
163 Ga0157372_10012315 3300013307 Bacteria 9115
164 Ga0157372_10116354 3300013307 Bacteria 3066
165 Ga0157372_10384643 3300013307 Bacteria 1635
166 Ga0157372_10437407 3300013307 Bacteria 1525
167 Ga0163163_10090485 3300014325 Bacteria 3073
168 Ga0163163_10133173 3300014325 Bacteria 2526
169 Ga0163163_10390130 3300014325 Bacteria 1450
170 Ga0157380_10029154 3300014326 Bacteria 4217
171 Ga0157380_10060374 3300014326 Bacteria 3030
172 Ga0157377_10001471 3300014745 Bacteria 10198
173 Ga0157377_10008609 3300014745 Bacteria 4980
174 Ga0206354_10705426 3300020081 Bacteria 3315
175 Ga0206353_10115436 3300020082 Bacteria 9646
176 Ga0206353_11908740 3300020082 Bacteria 5713
177 Ga0209784_100309 3300025224 Bacteria 25675
178 Ga0209784_101070 3300025224 Bacteria 4678
179 Ga0207642_10010085 3300025899 Bacteria 3313
180 Ga0207710_10010995 3300025900 Bacteria 3813
181 Ga0207688_10000331 3300025901 Bacteria 21938
182 Ga0207688_10002968 3300025901 Bacteria 9236
183 Ga0207688_10078434 3300025901 Unclassified 1882
184 Ga0207647_10053929 3300025904 Bacteria 2475
185 Ga0207647_10071351 3300025904 Bacteria 2095
186 Ga0207643_10000104 3300025908 Bacteria 57260
187 Ga0207705_10020948 3300025909 Bacteria 4664
188 Ga0207705_10023287 3300025909 Bacteria 4419
189 Ga0207654_10017484 3300025911 Bacteria 3749
190 Ga0207654_10149847 3300025911 Bacteria 1496
191 Ga0207707_10025262 3300025912 Bacteria 5196
192 Ga0207695_10106567 3300025913 Bacteria 2789
193 Ga0207695_10177261 3300025913 Bacteria 2053
194 Ga0207660_10018717 3300025917 Bacteria 4621
195 Ga0207662_10082143 3300025918 Bacteria 1968
196 Ga0207657_10013865 3300025919 Bacteria 7888
197 Ga0207649_10001153 3300025920 Bacteria 15948
198 Ga0207649_10031118 3300025920 Bacteria 3169
199 Ga0207652_10006731 3300025921 Bacteria 9263
200 Ga0207652_10309412 3300025921 Bacteria 1426
201 Ga0207646_10058387 3300025922 Bacteria 3445
202 Ga0207694_10018034 3300025924 Bacteria 5337
203 Ga0207650_10022683 3300025925 Bacteria 4446
204 Ga0207659_10006011 3300025926 Bacteria 7408
205 Ga0207659_10023977 3300025926 Bacteria 4082
206 Ga0207687_10017931 3300025927 Bacteria 4671
207 Ga0207687_10023021 3300025927 Bacteria 4149
208 Ga0207687_10047951 3300025927 Bacteria 2963
209 Ga0207664_10000019 3300025929 Bacteria 220528
210 Ga0207644_10013651 3300025931 Bacteria 5420
211 Ga0207690_10007771 3300025932 Bacteria 6366
212 Ga0207690_10009769 3300025932 Bacteria 5701
213 Ga0207690_10015633 3300025932 Bacteria 4604
214 Ga0207690_10040434 3300025932 Bacteria 3049
215 Ga0207686_10009248 3300025934 Bacteria 5343
216 Ga0207709_10007116 3300025935 Bacteria 6246
217 Ga0207709_10037868 3300025935 Bacteria 2868
218 Ga0207670_10062704 3300025936 Bacteria 2541
219 Ga0207670_10208625 3300025936 Bacteria 1488
220 Ga0207691_10038339 3300025940 Bacteria 4435
221 Ga0207711_10056487 3300025941 Bacteria 3373
222 Ga0207689_10002741 3300025942 Bacteria 16291
223 Ga0207689_10018098 3300025942 Bacteria 5950
224 Ga0207661_10004177 3300025944 Bacteria 10104
225 Ga0207661_10010273 3300025944 Bacteria 6734
226 Ga0207661_10041720 3300025944 Bacteria 3613
227 Ga0207661_10047317 3300025944 Bacteria 3414
228 Ga0207661_10075295 3300025944 Bacteria 2769
229 Ga0207661_10260457 3300025944 Bacteria 1545
230 Ga0207661_10380512 3300025944 Bacteria 1277
231 Ga0207679_10009212 3300025945 Bacteria 6312
232 Ga0207679_10182514 3300025945 Bacteria 1737
233 Ga0207667_10044381 3300025949 Bacteria 4711
234 Ga0207667_10491356 3300025949 Bacteria 1245
235 Ga0207651_10004982 3300025960 Bacteria 6769
236 Ga0207712_10147509 3300025961 Bacteria 1813
237 Ga0207668_10138564 3300025972 Bacteria 1868
238 Ga0207640_10003338 3300025981 Bacteria 8645
239 Ga0207640_10047909 3300025981 Bacteria 2760
240 Ga0207677_10002041 3300026023 Bacteria 10659
241 Ga0207677_10002288 3300026023 Bacteria 10061
242 Ga0207703_10011820 3300026035 Bacteria 6797
243 Ga0207639_10016415 3300026041 Bacteria 5238
244 Ga0207639_10042077 3300026041 Bacteria 3422
245 Ga0207639_10067729 3300026041 Bacteria 2779
246 Ga0207678_10000105 3300026067 Bacteria 68804
247 Ga0207678_10009925 3300026067 Bacteria 8354
248 Ga0207708_10000421 3300026075 Bacteria 33075
249 Ga0207708_10025982 3300026075 Bacteria 4430
250 Ga0207702_10002074 3300026078 Bacteria 19382
251 Ga0207641_10048624 3300026088 Bacteria 3580
252 Ga0207648_10008869 3300026089 Bacteria 9682
253 Ga0207676_10000838 3300026095 Bacteria 23866
254 Ga0207676_10036761 3300026095 Bacteria 3728
255 Ga0207674_10013617 3300026116 Bacteria 9009
256 Ga0207674_10018086 3300026116 Bacteria 7672
257 Ga0207674_10200593 3300026116 Bacteria 1944
258 Ga0207675_100011028 3300026118 Bacteria 8463
259 Ga0207683_10000092 3300026121 Bacteria 72389
260 Ga0207683_10051387 3300026121 Bacteria 3611
261 Ga0207698_10003295 3300026142 Bacteria 9707
262 Ga0207698_10021352 3300026142 Bacteria 4476
263 Ga0207698_10104544 3300026142 Bacteria 2356
264 Ga0207428_10026739 3300027907 Bacteria 4810
265 Ga0207428_10031302 3300027907 Bacteria 4392
266 Ga0268266_10070514 3300028379 Bacteria 3028
267 Ga0268265_10203835 3300028380 Bacteria 1718
268 Ga0268264_10319900 3300028381 Bacteria 1467
269 Ga0307408_100083936 3300031548 Bacteria 2388
270 Ga0307408_100395830 3300031548 Bacteria 1185
271 Ga0307405_10065444 3300031731 Bacteria 2314
272 Ga0307405_10082288 3300031731 Bacteria 2107
273 Ga0307413_10335597 3300031824 Bacteria 1160
274 Ga0307410_10040922 3300031852 Bacteria 3053
275 Ga0307410_10069722 3300031852 Bacteria 2433
276 Ga0307406_10000964 3300031901 Bacteria 16099
277 Ga0307406_10053390 3300031901 Bacteria 2574
278 Ga0307406_10074579 3300031901 Bacteria 2234
279 Ga0307407_10197493 3300031903 Bacteria 1345
280 Ga0307412_10018444 3300031911 Bacteria 4199
281 Ga0307409_100018952 3300031995 Bacteria 4645
282 Ga0307409_100033682 3300031995 Bacteria 3731
283 Ga0307409_100036610 3300031995 Bacteria 3609
284 Ga0307409_100047003 3300031995 Bacteria 3272
285 Ga0307409_100064586 3300031995 Bacteria 2876
286 Ga0307409_100113606 3300031995 Bacteria 2277
287 Ga0307409_100136727 3300031995 Bacteria 2104
288 Ga0307409_100302052 3300031995 Bacteria 1489
289 Ga0307416_100001684 3300032002 Bacteria 12233
290 Ga0307416_100053010 3300032002 Bacteria 3252
291 Ga0307416_100059574 3300032002 Bacteria 3103
292 Ga0307416_100096154 3300032002 Bacteria 2560
293 Ga0307416_100136316 3300032002 Bacteria 2221
294 Ga0307416_100142163 3300032002 Bacteria 2183
295 Ga0307416_100284555 3300032002 Bacteria 1632
296 Ga0307416_100363342 3300032002 Bacteria 1470
297 Ga0307416_100427442 3300032002 Bacteria 1371
298 Ga0307416_100515046 3300032002 Bacteria 1263
299 Ga0307414_10087586 3300032004 Bacteria 2302
300 Ga0307411_10031474 3300032005 Bacteria 3265
301 Ga0307411_10032290 3300032005 Bacteria 3233
302 Ga0307411_10038776 3300032005 Bacteria 3009
303 Ga0307411_10098331 3300032005 Bacteria 2062
304 Ga0307411_10170610 3300032005 Bacteria 1640
305 Ga0307415_100000240 3300032126 Bacteria 23862
306 Ga0307415_100002253 3300032126 Bacteria 9554
307 Ga0307415_100017986 3300032126 Bacteria 4254
308 Ga0307415_100082705 3300032126 Bacteria 2298
309 Ga0307415_100326280 3300032126 Bacteria 1282
310 Ga0395899_0088984 3300037312 Bacteria 2240
311 Ga0395900_0005134 3300037418 Bacteria 13751
312 Ga0395900_0407982 3300037418 Bacteria 1322
313 Ga0395898_0014239 3300037466 Bacteria 8175
314 Ga0395905_0013460 3300037471 Bacteria 7838
315 Ga0395901_0005345 3300038443 Bacteria 12977
316 Ga0395901_0050326 3300038443 Bacteria 4329
317 Ga0395901_0257203 3300038443 Bacteria 1818
318 Ga0436360_0559711 3300039438 Bacteria 2349
319 Ga0451789_0304269 3300041443 Bacteria 3236
320 Ga0451791_0924565 3300041451 Bacteria 2380
321 Ga0451797_0809663 3300041453 Bacteria 1184
322 Ga0451795_0757857 3300041456 Bacteria 1732
323 Ga0451807_2630884 3300041486 Bacteria 1504
324 Ga0451833_0274299 3300041491 Bacteria 2204
325 Ga0451843_1146130 3300041509 Bacteria 1448
326 Ga0451853_1089843 3300041512 Bacteria 2681
327 Ga0451853_2474168 3300041512 Bacteria 2665
328 Ga0439448_0004664 3300042005 Bacteria 3878
329 Ga0439450_034790 3300042008 Bacteria 1147
330 Ga0466972_0165152 3300044658 Bacteria 1040
331 Ga0466965_0037657 3300044683 Bacteria 2375
332 Ga0466966_0053428 3300044684 Bacteria 2563
333 Ga0466961_0083669 3300044693 Bacteria 2018
334 Ga0466963_0018804 3300044694 Bacteria 4325
335 Ga0466964_0003962 3300044706 Bacteria 5443
336 Ga0466971_0015543 3300044719 Bacteria 3351
337 Ga0466968_0149782 3300044735 Bacteria 1072
338 Ga0466957_0007404 3300044842 Bacteria 6203
339 Ga0466957_0015557 3300044842 Bacteria 4443
340 Ga0466957_0122946 3300044842 Bacteria 1656
341 Ga0466960_0001259 3300044901 Bacteria 9178
342 Ga0466960_0002337 3300044901 Bacteria 7125
343 Ga0466960_0010146 3300044901 Bacteria 3907
344 Ga0466960_0013981 3300044901 Bacteria 3422
345 Ga0466960_0026096 3300044901 Bacteria 2650
346 Ga0466960_0046485 3300044901 Bacteria 2078
347 Ga0466960_0125556 3300044901 Bacteria 1348
348 Ga0466958_0001607 3300045836 Bacteria 10864
349 Ga0466958_0046192 3300045836 Bacteria 2628
350 Ga0466967_0124892 3300045976 Bacteria 2382
351 Ga0466967_0167448 3300045976 Bacteria 2066
352 Ga0495627_025432 3300046453 Bacteria 1920
353 Ga0495653_0005381 3300046463 Bacteria 10419
354 Ga0495660_0145873 3300046810 Bacteria 1173
355 Ga0496101_0045537 3300048904 Bacteria 3143
356 Ga0496102_0042526 3300048905 Bacteria 4117
357 Ga0496103_0049628 3300048906 Bacteria 2595
358 Ga0496104_0004795 3300048907 Bacteria 11781
359 Ga0496104_0015619 3300048907 Bacteria 6883
360 Ga0496104_0266876 3300048907 Bacteria 1624
361 Ga0496105_0002140 3300048908 Bacteria 14306
362 Ga0496105_0003258 3300048908 Bacteria 11962
363 Ga0496106_0025936 3300048909 Bacteria 4360
364 Ga0496107_0020672 3300048910 Bacteria 4651
365 Ga0496107_0185111 3300048910 Bacteria 1547
366 Ga0496108_0015517 3300048911 Bacteria 6212
367 Ga0496109_0010018 3300048912 Bacteria 8092
368 Ga0496109_0034395 3300048912 Bacteria 4563
369 Ga0496110_0003376 3300048913 Bacteria 12191
370 Ga0496111_0016539 3300048914 Bacteria 5084
371 Ga0496112_0027236 3300048915 Bacteria 5511
372 Ga0496113_0007972 3300048916 Bacteria 6862
373 Ga0496113_0082919 3300048916 Bacteria 2460
374 Ga0496114_0009255 3300048917 Bacteria 7812
375 Ga0496114_0052488 3300048917 Bacteria 3397
376 Ga0496114_0063073 3300048917 Bacteria 3102
377 Ga0496114_0110473 3300048917 Bacteria 2355
378 Ga0496116_0013308 3300048919 Bacteria 6645
379 Ga0496117_0009673 3300048920 Bacteria 8919
380 Ga0496119_0000485 3300048922 Bacteria 54416
381 Ga0496120_0000227 3300048923 Bacteria 96506
382 Ga0496120_0057176 3300048923 Bacteria 2197
383 Ga0496124_0002140 3300048927 Bacteria 26551
384 Ga0496126_0002133 3300048929 Bacteria 27589
385 Ga0496126_0003957 3300048929 Bacteria 18120
386 Ga0501298_012110 3300049521 Bacteria 1508
387 Ga0501031_0088649 3300049568 Bacteria 2017
388 Ga0501031_0216827 3300049568 Bacteria 1247
389 Ga0501033_0118894 3300049570 Bacteria 1919
390 Ga0501034_0153979 3300049571 Bacteria 2274
391 Ga0501036_0006991 3300049572 Bacteria 9185
392 Ga0501039_0000573 3300049575 Bacteria 26588
393 Ga0501039_0175490 3300049575 Bacteria 1685
394 Ga0501040_0023690 3300049576 Bacteria 4117
395 Ga0501041_0001281 3300049577 Bacteria 13826
396 Ga0501042_0000435 3300049578 Bacteria 21254
397 Ga0501046_0002695 3300049580 Bacteria 16525
398 Ga0501046_0361705 3300049580 Bacteria 1052
399 Ga0501047_0014451 3300049581 Bacteria 7508
400 Ga0501069_0185863 3300049585 Bacteria 1202
401 Ga0501072_0029338 3300049588 Bacteria 4297
402 Ga0501073_0058564 3300049589 Bacteria 2692
403 Ga0501074_0000128 3300049590 Bacteria 38755
404 Ga0501074_0100208 3300049590 Bacteria 2074
405 Ga0501075_0002138 3300049591 Bacteria 13076
406 Ga0501075_0052006 3300049591 Bacteria 3081
407 Ga0501076_0000126 3300049592 Bacteria 42498
408 Ga0501076_0105119 3300049592 Bacteria 2278
409 Ga0501076_0220894 3300049592 Bacteria 1549
410 Ga0501077_0221554 3300049593 Bacteria 1202
411 Ga0501079_0000140 3300049741 Bacteria 39603
412 Ga0501079_0065420 3300049741 Bacteria 2805
413 Ga0501081_0001951 3300049743 Bacteria 12827
414 Ga0501035_0000093 3300049822 Bacteria 111409
415 Ga0501035_0330944 3300049822 Bacteria 1278
416 Ga0501212_009615 3300049851 Bacteria 1365
417 nmdc:mga00v17_81211_c1 3300050491 Bacteria 2024
418 nmdc:mga0yw44_8093_c1 3300050492 Bacteria 5218
419 nmdc:mga05p37_2776_c2 3300050507 Bacteria 11179
420 nmdc:mga09592_8893_c1 3300050508 Bacteria 8165
421 nmdc:mga0qj67_8399_c1 3300050509 Bacteria 7659
422 nmdc:mga06r32_188751_c1 3300050510 Bacteria 2048
423 nmdc:mga08y16_15158_c1 3300050511 Bacteria 8104
424 nmdc:mga08y16_18575_c1 3300050511 Bacteria 7326
425 nmdc:mga08y16_28793_c1 3300050511 Bacteria 5855
426 nmdc:mga0n895_54800_c1 3300050512 Bacteria 3924
427 nmdc:mga0rr50_2123_c1 3300050513 Bacteria 11086
428 nmdc:mga08x19_14290_c1 3300050514 Bacteria 4815
429 nmdc:mga0a205_5397_c1 3300050515 Bacteria 11529
430 Ga0500568_0015754 3300053139 Bacteria 3377
431 Ga0501084_0094500 3300054114 Bacteria 2510
432 Ga0587072_002955 3300059643 Bacteria 2340
433 Ga0501082_0001759 3300060353 Bacteria 19069
434 Ga0466962_0021301 3300061719 Bacteria 3114
435 Ga0530510_0000848 3300061734 Bacteria 20172
436 2550905280 2548877040 Bacteria 7507281
437 2571531201 2571042143 Bacteria 6986194
438 2644444197 2643221679 Bacteria 3839507
439 2644608155 2643221711 Bacteria 4865335
440 2728530584 2728368933 Bacteria 7044283
441 2739608629 2739367654 Bacteria 6049412
442 2760307186 2758568522 Bacteria 5953541
443 2774383113 2773857759 Bacteria 2963774
444 2799185925 2799112218 Bacteria 4315149
445 2809030381 2808606394 Bacteria 6248540
446 2816422325 2816332119 Bacteria 8120218
447 2816506675 2816332139 Bacteria 9138787
448 2819664586 2818991458 Bacteria 4794049
449 2821268698 2821268502 Bacteria 3750023
450 2821268752 2821268502 Bacteria 3750023
451 2837272270 2837268691 Bacteria 7850704
452 2852632908 2852632344 Bacteria 3463163
453 2855673914 2855670206 Bacteria 7120389
454 2855679512 2855676851 Bacteria 7063653
455 2857295051 2857288857 Bacteria 7189066
456 2858851924 2858848962 Bacteria 6963058
457 2858888187 2858882152 Bacteria 7230291
458 2858895353 2858888857 Bacteria 7060307
459 2858897501 2858895516 Bacteria 7378898
460 2867306168 2867302475 Bacteria 7087181
461 2867323182 2867319477 Bacteria 7069771
462 2869055031 2869048445 Bacteria 6875584
463 2869068640 2869061728 Bacteria 7112407
464 2869071735 2869068681 Bacteria 7205615
465 2883824794 2883821847 Bacteria 5121194
466 2907202262 2907202186 Bacteria 6632024
467 2919445334 2919443155 Bacteria 4072969
468 2929225829 2929219909 Bacteria 6984360
469 2929231180 2929226422 Bacteria 7248583
470 2938649708 2938649242 Bacteria 7118381
471 2939662521 2939660829 Bacteria 3784848
472 2968562133 2968558590 Bacteria 6956864
473 2971405862 2971403814 Bacteria 7370929
474 2988230330 2988225383 Bacteria 7221625
475 2996639133 2996632988 Bacteria 6921523
476 8003836528 8003830390 Bacteria 6541657
477 8003859685 8003856774 Bacteria 7675274
478 8054468114 8054465665 Bacteria 7323556
479 8054704745 8054704163 Bacteria 7247792
480 8055178392 8055172936 Bacteria 9305943
481 8055418117 8055412473 Bacteria 6257500
482 8057733810 8057733483 Bacteria 6578323
483 Ga0307407_10129542
484 JGI24740J21852_10033291
485 JGI24743J22301_10001348
486 JGI24738J21930_10010288
487 JGI24738J21930_10012919
488 JGI24751J29686_10002209
489 Ga0055538_1000241
490 Ga0070658_10007980
491 Ga0070658_10032650
492 Ga0070676_10006324
493 Ga0070683_100000377
494 Ga0070683_100009474
495 Ga0070683_100019447
496 Ga0070683_100054001
497 Ga0070683_100115041
498 Ga0070670_100006150
499 Ga0068869_100000879
500 Ga0068869_100353059
501 Ga0070680_100011306
502 Ga0070680_100074310
503 Ga0070682_100008649
504 Ga0070682_100097160
505 Ga0068868_100004527
506 Ga0068868_100052992
507 Ga0070660_100003828
508 Ga0070660_100005618
509 Ga0070689_100002059
510 Ga0070691_10004392
511 Ga0070691_10037216
512 Ga0070687_100032833
513 Ga0070661_100024395
514 Ga0070661_100170215
515 Ga0070692_10000897
516 Ga0070669_100093670
517 Ga0070675_100003936
518 Ga0070675_100008258
519 Ga0070671_100006897
520 Ga0070673_100008584
521 Ga0070688_100051672
522 Ga0070659_100011657
523 Ga0070659_100015824
524 Ga0070659_100017151
525 Ga0070659_100029135
526 Ga0070659_100211589
527 Ga0070667_100337070
528 Ga0070714_100000002
529 Ga0070710_10012904
530 Ga0070705_100017715
531 Ga0070705_100096352
532 Ga0070700_100001556
533 Ga0070700_100035762
534 Ga0070694_100104320
535 Ga0070663_100000822
536 Ga0070663_100001438
537 Ga0070678_100002617
538 Ga0070662_100007730
539 Ga0070681_10004585
540 Ga0070681_10031408
541 Ga0070681_10405881
542 Ga0068867_100067163
543 Ga0070685_10071167
544 Ga0070698_100055333
545 Ga0070699_100059562
546 Ga0070679_100029532
547 Ga0070679_100191309
548 Ga0070679_100597277
549 Ga0070684_100001573
550 Ga0070684_100007303
551 Ga0070684_100014266
552 Ga0070684_100039310
553 Ga0070684_100057554
554 Ga0068853_100022695
555 Ga0068853_100069995
556 Ga0068853_100089320
557 Ga0070695_100192429
558 Ga0070696_100032386
559 Ga0070693_100000597
560 Ga0070665_100193052
561 Ga0068855_100003976
562 Ga0068855_100039564
563 Ga0070664_100006777
564 Ga0070664_100009091
565 Ga0068857_100041212
566 Ga0068857_100114167
567 Ga0068854_100022146
568 Ga0068854_100127869
569 Ga0068856_100042808
570 Ga0070702_100000706
571 Ga0070702_100001246
572 Ga0068852_100006365
573 Ga0068852_100024511
574 Ga0068852_100025782
575 Ga0068852_100063920
576 Ga0068852_100075709
577 Ga0068852_100370108
578 Ga0068864_100029924
579 Ga0068866_10030631
580 Ga0068861_100052791
581 Ga0068870_10001648
582 Ga0068870_10001787
583 Ga0068863_100006277
584 Ga0068858_100008068
585 Ga0068860_100419694
586 Ga0068862_100182511
587 Ga0068862_100418327
588 Ga0081538_10017858
589 Ga0081538_10033386
590 Ga0081539_10002216
591 Ga0081539_10016808
592 Ga0081539_10019882
593 Ga0081539_10120551
594 Ga0075365_10013161
595 Ga0075364_10162640
596 Ga0075432_10004409
597 Ga0097621_100008405
598 Ga0075428_100008350
599 Ga0075428_100030309
600 Ga0075428_100175542
601 Ga0075430_100006425
602 Ga0075431_100003235
603 Ga0075433_10008022
604 Ga0075434_100009551
605 Ga0068865_100004002
606 Ga0075435_100008266
607 Ga0105240_10010055
608 Ga0105240_10355276
609 Ga0111539_10001973
610 Ga0111539_10326018
611 Ga0105245_10007645
612 Ga0105245_10021211
613 Ga0105245_10061124
614 Ga0105245_10232196
615 Ga0105247_10004541
616 Ga0114129_10014503
617 Ga0114129_10021013
618 Ga0105243_10005906
619 Ga0105243_10010293
620 Ga0105243_10046130
621 Ga0105241_10003699
622 Ga0105241_10231219
623 Ga0105248_10038714
624 Ga0105248_10058489
625 Ga0105237_10196764
626 Ga0105238_10039395
627 Ga0105249_10127596
628 Ga0105239_10049484
629 Ga0105239_10087353
630 Ga0105239_10180880
631 Ga0105246_10016216
632 Ga0157373_10074661
633 Ga0157371_10006633
634 Ga0157371_10091754
635 Ga0157370_10008277
636 Ga0157370_10011175
637 Ga0157370_10092883
638 Ga0157369_10012854
639 Ga0157369_10016359
640 Ga0157369_10016626
641 Ga0157369_10020014
642 Ga0157369_10415376
643 Ga0157374_10004351
644 Ga0157372_10010042
645 Ga0157372_10012315
646 Ga0157372_10116354
647 Ga0157372_10384643
648 Ga0157372_10437407
649 Ga0163163_10090485
650 Ga0163163_10133173
651 Ga0163163_10390130
652 Ga0157380_10029154
653 Ga0157380_10060374
654 Ga0157377_10001471
655 Ga0157377_10008609
656 Ga0206354_10705426
657 Ga0206353_10115436
658 Ga0206353_11908740
659 Ga0209784_100309
660 Ga0209784_101070
661 Ga0207642_10010085
662 Ga0207710_10010995
663 Ga0207688_10000331
664 Ga0207688_10002968
665 Ga0207688_10078434
666 Ga0207647_10053929
667 Ga0207647_10071351
668 Ga0207643_10000104
669 Ga0207705_10020948
670 Ga0207705_10023287
671 Ga0207654_10017484
672 Ga0207654_10149847
673 Ga0207707_10025262
674 Ga0207695_10106567
675 Ga0207695_10177261
676 Ga0207660_10018717
677 Ga0207662_10082143
678 Ga0207657_10013865
679 Ga0207649_10001153
680 Ga0207649_10031118
681 Ga0207652_10006731
682 Ga0207652_10309412
683 Ga0207646_10058387
684 Ga0207694_10018034
685 Ga0207650_10022683
686 Ga0207659_10006011
687 Ga0207659_10023977
688 Ga0207687_10017931
689 Ga0207687_10023021
690 Ga0207687_10047951
691 Ga0207664_10000019
692 Ga0207644_10013651
693 Ga0207690_10007771
694 Ga0207690_10009769
695 Ga0207690_10015633
696 Ga0207690_10040434
697 Ga0207686_10009248
698 Ga0207709_10007116
699 Ga0207709_10037868
700 Ga0207670_10062704
701 Ga0207670_10208625
702 Ga0207691_10038339
703 Ga0207711_10056487
704 Ga0207689_10002741
705 Ga0207689_10018098
706 Ga0207661_10004177
707 Ga0207661_10010273
708 Ga0207661_10041720
709 Ga0207661_10047317
710 Ga0207661_10075295
711 Ga0207661_10260457
712 Ga0207661_10380512
713 Ga0207679_10009212
714 Ga0207679_10182514
715 Ga0207667_10044381
716 Ga0207667_10491356
717 Ga0207651_10004982
718 Ga0207712_10147509
719 Ga0207668_10138564
720 Ga0207640_10003338
721 Ga0207640_10047909
722 Ga0207677_10002041
723 Ga0207677_10002288
724 Ga0207703_10011820
725 Ga0207639_10016415
726 Ga0207639_10042077
727 Ga0207639_10067729
728 Ga0207678_10000105
729 Ga0207678_10009925
730 Ga0207708_10000421
731 Ga0207708_10025982
732 Ga0207702_10002074
733 Ga0207641_10048624
734 Ga0207648_10008869
735 Ga0207676_10000838
736 Ga0207676_10036761
737 Ga0207674_10013617
738 Ga0207674_10018086
739 Ga0207674_10200593
740 Ga0207675_100011028
741 Ga0207683_10000092
742 Ga0207683_10051387
743 Ga0207698_10003295
744 Ga0207698_10021352
745 Ga0207698_10104544
746 Ga0207428_10026739
747 Ga0207428_10031302
748 Ga0268266_10070514
749 Ga0268265_10203835
750 Ga0268264_10319900
751 Ga0307408_100083936
752 Ga0307408_100395830
753 Ga0307405_10065444
754 Ga0307405_10082288
755 Ga0307413_10335597
756 Ga0307410_10040922
757 Ga0307410_10069722
758 Ga0307406_10000964
759 Ga0307406_10053390
760 Ga0307406_10074579
761 Ga0307407_10197493
762 Ga0307412_10018444
763 Ga0307409_100018952
764 Ga0307409_100033682
765 Ga0307409_100036610
766 Ga0307409_100047003
767 Ga0307409_100064586
768 Ga0307409_100113606
769 Ga0307409_100136727
770 Ga0307409_100302052
771 Ga0307416_100001684
772 Ga0307416_100053010
773 Ga0307416_100059574
774 Ga0307416_100096154
775 Ga0307416_100136316
776 Ga0307416_100142163
777 Ga0307416_100284555
778 Ga0307416_100363342
779 Ga0307416_100427442
780 Ga0307416_100515046
781 Ga0307414_10087586
782 Ga0307411_10031474
783 Ga0307411_10032290
784 Ga0307411_10038776
785 Ga0307411_10098331
786 Ga0307411_10170610
787 Ga0307415_100000240
788 Ga0307415_100002253
789 Ga0307415_100017986
790 Ga0307415_100082705
791 Ga0307415_100326280
792 Ga0395899_0088984
793 Ga0395900_0005134
794 Ga0395900_0407982
795 Ga0395898_0014239
796 Ga0395905_0013460
797 Ga0395901_0005345
798 Ga0395901_0050326
799 Ga0395901_0257203
800 Ga0436360_0559711
801 Ga0451789_0304269
802 Ga0451791_0924565
803 Ga0451797_0809663
804 Ga0451795_0757857
805 Ga0451807_2630884
806 Ga0451833_0274299
807 Ga0451843_1146130
808 Ga0451853_1089843
809 Ga0451853_2474168
810 Ga0439448_0004664
811 Ga0439450_034790
812 Ga0466972_0165152
813 Ga0466965_0037657
814 Ga0466966_0053428
815 Ga0466961_0083669
816 Ga0466963_0018804
817 Ga0466964_0003962
818 Ga0466971_0015543
819 Ga0466968_0149782
820 Ga0466957_0007404
821 Ga0466957_0015557
822 Ga0466957_0122946
823 Ga0466960_0001259
824 Ga0466960_0002337
825 Ga0466960_0010146
826 Ga0466960_0013981
827 Ga0466960_0026096
828 Ga0466960_0046485
829 Ga0466960_0125556
830 Ga0466958_0001607
831 Ga0466958_0046192
832 Ga0466967_0124892
833 Ga0466967_0167448
834 Ga0495627_025432
835 Ga0495653_0005381
836 Ga0495660_0145873
837 Ga0496101_0045537
838 Ga0496102_0042526
839 Ga0496103_0049628
840 Ga0496104_0004795
841 Ga0496104_0015619
842 Ga0496104_0266876
843 Ga0496105_0002140
844 Ga0496105_0003258
845 Ga0496106_0025936
846 Ga0496107_0020672
847 Ga0496107_0185111
848 Ga0496108_0015517
849 Ga0496109_0010018
850 Ga0496109_0034395
851 Ga0496110_0003376
852 Ga0496111_0016539
853 Ga0496112_0027236
854 Ga0496113_0007972
855 Ga0496113_0082919
856 Ga0496114_0009255
857 Ga0496114_0052488
858 Ga0496114_0063073
859 Ga0496114_0110473
860 Ga0496116_0013308
861 Ga0496117_0009673
862 Ga0496119_0000485
863 Ga0496120_0000227
864 Ga0496120_0057176
865 Ga0496124_0002140
866 Ga0496126_0002133
867 Ga0496126_0003957
868 Ga0501298_012110
869 Ga0501031_0088649
870 Ga0501031_0216827
871 Ga0501033_0118894
872 Ga0501034_0153979
873 Ga0501036_0006991
874 Ga0501039_0000573
875 Ga0501039_0175490
876 Ga0501040_0023690
877 Ga0501041_0001281
878 Ga0501042_0000435
879 Ga0501046_0002695
880 Ga0501046_0361705
881 Ga0501047_0014451
882 Ga0501069_0185863
883 Ga0501072_0029338
884 Ga0501073_0058564
885 Ga0501074_0000128
886 Ga0501074_0100208
887 Ga0501075_0002138
888 Ga0501075_0052006
889 Ga0501076_0000126
890 Ga0501076_0105119
891 Ga0501076_0220894
892 Ga0501077_0221554
893 Ga0501079_0000140
894 Ga0501079_0065420
895 Ga0501081_0001951
896 Ga0501035_0000093
897 Ga0501035_0330944
898 Ga0501212_009615
899 nmdc:mga00v17_81211_c1
900 nmdc:mga0yw44_8093_c1
901 nmdc:mga05p37_2776_c2
902 nmdc:mga09592_8893_c1
903 nmdc:mga0qj67_8399_c1
904 nmdc:mga06r32_188751_c1
905 nmdc:mga08y16_15158_c1
906 nmdc:mga08y16_18575_c1
907 nmdc:mga08y16_28793_c1
908 nmdc:mga0n895_54800_c1
909 nmdc:mga0rr50_2123_c1
910 nmdc:mga08x19_14290_c1
911 nmdc:mga0a205_5397_c1
912 Ga0500568_0015754
913 Ga0501084_0094500
914 Ga0587072_002955
915 Ga0501082_0001759
916 Ga0466962_0021301
917 Ga0530510_0000848
918 2550905280
919 2571531201
920 2644444197
921 2644608155
922 2728530584
923 2739608629
924 2760307186
925 2774383113
926 2799185925
927 2809030381
928 2816422325
929 2816506675
930 2819664586
931 2821268698
932 2821268752
933 2837272270
934 2852632908
935 2855673914
936 2855679512
937 2857295051
938 2858851924
939 2858888187
940 2858895353
941 2858897501
942 2867306168
943 2867323182
944 2869055031
945 2869068640
946 2869071735
947 2883824794
948 2907202262
949 2919445334
950 2929225829
951 2929231180
952 2938649708
953 2939662521
954 2968562133
955 2971405862
956 2988230330
957 2996639133
958 8003836528
959 8003859685
960 8054468114
961 8054704745
962 8055178392
963 8055418117
964 8057733810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

139

343

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9322 33 313
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.9111 33 316
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9073 74 309
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9065 33 313
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9063 33 324
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9558 75 319 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9447 78 320 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9402 75 319 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9263 77 315 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9186 78 320 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1M6GQG6-F1-model_v4 Multiple sugar transport system permease protein 0.9757 33 316 GO:0005886
GO:0055085
AF-A0A7V2NG27-F1-model_v4 Sugar ABC transporter permease 0.9733 33 316 GO:0005886
GO:0055085
AF-A0A4A1NYM0-F1-model_v4 deleted 0.9675 33 263
AF-A0A399ZWF8-F1-model_v4 ABC transporter permease 0.9667 33 281 GO:0005886
GO:0055085
AF-A0A7X0VYA0-F1-model_v4 Sugar ABC transporter permease 0.9652 33 313 GO:0005886
GO:0055085

Map