F452629

General Info

Members Datasets Scaffolds Average Seq Length
482 311 964 360

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10018129|Ga0207668_100181295
Length 396
Sequence MTWNQKGAPRISNGGGCSIIAYTARPHHIPQTTTMQPYLELGLDTFGDVTRDANGRPLPQAQVIRHVIDEAVLADELGVDFIGVGEHHRADFAVASPEVVLAAIAGRTHRIRLGSAVTVLSSDDPVRVFQRFASLDAASNGRAEIILGRGSFIESFPLFGYPLDQYEALFEEKLELFAALLEANRTGVPVTWRGTTRASLDGLRVYPPTESGRLTTWIGVGGSPESVVRAARYGMPLMLAIIGGNPLRFAPYIDLYDRALAERGVDSLPIGVHSPGHIADTDARAREELWPSWREMRNRIGAERGWGPTSRAEFDREIEAGSLYVGAPEAVAQKIAATAGALGLSRFDMKYSAGALAHDKLMRSIELYGREVIPRVRALLAAEEPESAGAAAGGER

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
176 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
177 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
178 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
179 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
180 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
181 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
182 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
273 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
278 2643221572 Leifsonia sp. Root60 Isolate Unclassified
279 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
280 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
281 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
282 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
283 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
284 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
285 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
286 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
287 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
288 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
289 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
290 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
291 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
292 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
293 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
294 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
295 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
296 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
297 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
298 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
299 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
300 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
301 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
302 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
303 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
304 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
305 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
306 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
307 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
308 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
309 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
310 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
311 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.32
Metatranscriptomes 0.41
Isolates 7.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0
Rhizoplane 3.32
Rhizosphere 88.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_10018129 3300025972 Bacteria 4423
2 LJQas_1000534 3300000549 Bacteria 6248
3 Ga0055542_1007539 3300003762 Bacteria 2200
4 Ga0065165_1000879 3300005262 Bacteria 38853
5 Ga0065714_10013025 3300005288 Bacteria 2406
6 Ga0070676_10016152 3300005328 Bacteria 4124
7 Ga0070683_100002646 3300005329 Bacteria 14315
8 Ga0070683_100025439 3300005329 Bacteria 5316
9 Ga0070683_100035639 3300005329 Bacteria 4548
10 Ga0070670_100010118 3300005331 Bacteria 8047
11 Ga0070670_100026039 3300005331 Bacteria 5034
12 Ga0070670_100044748 3300005331 Bacteria 3805
13 Ga0070680_100000417 3300005336 Bacteria 29035
14 Ga0070680_100047085 3300005336 Bacteria 3510
15 Ga0070660_100048512 3300005339 Bacteria 3262
16 Ga0070687_100009638 3300005343 Bacteria 4145
17 Ga0070661_100002688 3300005344 Bacteria 12173
18 Ga0070661_100066424 3300005344 Bacteria 2650
19 Ga0070668_100007638 3300005347 Bacteria 8025
20 Ga0070668_100020012 3300005347 Bacteria 5046
21 Ga0070669_100002967 3300005353 Bacteria 12228
22 Ga0070675_100018309 3300005354 Bacteria 5575
23 Ga0070675_100318683 3300005354 Bacteria 1373
24 Ga0070671_100133771 3300005355 Bacteria 2090
25 Ga0070673_100039405 3300005364 Bacteria 3615
26 Ga0070673_100122960 3300005364 Bacteria 2168
27 Ga0070667_100113617 3300005367 Bacteria 2350
28 Ga0070709_10080038 3300005434 Bacteria 2129
29 Ga0070701_10020050 3300005438 Bacteria 3168
30 Ga0070701_10057808 3300005438 Bacteria 2034
31 Ga0070711_100086122 3300005439 Bacteria 2252
32 Ga0070694_100157972 3300005444 Bacteria 1661
33 Ga0070708_100042212 3300005445 Bacteria 4002
34 Ga0070662_100028007 3300005457 Bacteria 3918
35 Ga0070662_100093993 3300005457 Bacteria 2257
36 Ga0070681_10008844 3300005458 Bacteria 9892
37 Ga0070681_10076202 3300005458 Bacteria 3313
38 Ga0070685_10013350 3300005466 Bacteria 4330
39 Ga0070707_100039515 3300005468 Bacteria 4510
40 Ga0070707_100479442 3300005468 Bacteria 1205
41 Ga0070699_100198328 3300005518 Bacteria 1784
42 Ga0070699_100410249 3300005518 Bacteria 1225
43 Ga0070684_100009021 3300005535 Bacteria 7835
44 Ga0070684_100036343 3300005535 Bacteria 4220
45 Ga0068853_100126709 3300005539 Bacteria 2281
46 Ga0070672_100009308 3300005543 Bacteria 6767
47 Ga0070672_100010998 3300005543 Bacteria 6297
48 Ga0070672_100016090 3300005543 Bacteria 5349
49 Ga0070672_100103862 3300005543 Bacteria 2308
50 Ga0070686_100062171 3300005544 Bacteria 2415
51 Ga0070695_100207052 3300005545 Bacteria 1405
52 Ga0070695_100268662 3300005545 Bacteria 1248
53 Ga0070665_100043810 3300005548 Bacteria 4496
54 Ga0070665_100123444 3300005548 Bacteria 2592
55 Ga0070704_100138617 3300005549 Bacteria 1896
56 Ga0070704_100176532 3300005549 Bacteria 1704
57 Ga0070664_100014332 3300005564 Bacteria 6463
58 Ga0070664_100044780 3300005564 Bacteria 3736
59 Ga0070664_100047397 3300005564 Bacteria 3630
60 Ga0068857_100003492 3300005577 Bacteria 13119
61 Ga0068857_100010297 3300005577 Bacteria 8124
62 Ga0068857_100031686 3300005577 Bacteria 4673
63 Ga0068856_100164886 3300005614 Bacteria 2227
64 Ga0070702_100168652 3300005615 Bacteria 1422
65 Ga0068859_100012802 3300005617 Bacteria 8426
66 Ga0068859_100099874 3300005617 Bacteria 2957
67 Ga0068864_100036063 3300005618 Bacteria 4214
68 Ga0068866_10090987 3300005718 Bacteria 1662
69 Ga0068861_100023507 3300005719 Bacteria 4446
70 Ga0068861_100196970 3300005719 Bacteria 1688
71 Ga0068851_10003869 3300005834 Bacteria 6703
72 Ga0068851_10020371 3300005834 Bacteria 3212
73 Ga0068870_10021341 3300005840 Bacteria 3166
74 Ga0068863_100073511 3300005841 Bacteria 3234
75 Ga0068862_100018635 3300005844 Bacteria 5782
76 Ga0070717_10114807 3300006028 Bacteria 2301
77 Ga0075365_10001955 3300006038 Bacteria 9730
78 Ga0075368_10009902 3300006042 Bacteria 3437
79 Ga0075363_100028584 3300006048 Bacteria 2870
80 Ga0075364_10008718 3300006051 Bacteria 6066
81 Ga0075432_10003827 3300006058 Bacteria 5131
82 Ga0075362_10036169 3300006177 Bacteria 2159
83 Ga0075367_10004292 3300006178 Bacteria 6927
84 Ga0075369_10004310 3300006186 Bacteria 5243
85 Ga0075428_100060723 3300006844 Bacteria 4140
86 Ga0075430_100005360 3300006846 Bacteria 10833
87 Ga0075430_100019818 3300006846 Bacteria 5721
88 Ga0075430_100039636 3300006846 Bacteria 3988
89 Ga0075430_100094761 3300006846 Bacteria 2495
90 Ga0075431_100005540 3300006847 Bacteria 12462
91 Ga0075431_100358924 3300006847 Bacteria 1464
92 Ga0075433_10013611 3300006852 Bacteria 6622
93 Ga0075433_10050814 3300006852 Bacteria 3610
94 Ga0075433_10182036 3300006852 Bacteria 1870
95 Ga0075434_100064066 3300006871 Bacteria 3659
96 Ga0075429_100167201 3300006880 Bacteria 1926
97 Ga0075429_100329015 3300006880 Bacteria 1337
98 Ga0068865_100010513 3300006881 Bacteria 5763
99 Ga0075436_100066943 3300006914 Bacteria 2483
100 Ga0097620_100012802 3300006931 Bacteria 8426
101 Ga0105244_10022100 3300009036 Bacteria 3506
102 Ga0105244_10041676 3300009036 Bacteria 2378
103 Ga0111539_10234543 3300009094 Bacteria 2136
104 Ga0105245_10021458 3300009098 Bacteria 5666
105 Ga0105245_10078923 3300009098 Bacteria 3004
106 Ga0114129_10060130 3300009147 Bacteria 5312
107 Ga0114129_10082331 3300009147 Bacteria 4472
108 Ga0114129_10273720 3300009147 Bacteria 2258
109 Ga0105243_10201942 3300009148 Bacteria 1744
110 Ga0105248_10010867 3300009177 Bacteria 10050
111 Ga0105248_10204011 3300009177 Bacteria 2228
112 Ga0105237_10105212 3300009545 Bacteria 2813
113 Ga0105238_10007670 3300009551 Bacteria 10793
114 Ga0105249_10007686 3300009553 Bacteria 9394
115 Ga0105249_10021036 3300009553 Bacteria 5839
116 Ga0105239_10145477 3300010375 Bacteria 2643
117 Ga0105246_10022407 3300011119 Bacteria 4075
118 Ga0105246_10257089 3300011119 Bacteria 1389
119 Ga0157373_10111198 3300013100 Bacteria 1926
120 Ga0157373_10117807 3300013100 Bacteria 1867
121 Ga0157370_10190460 3300013104 Bacteria 1904
122 Ga0157369_10380573 3300013105 Bacteria 1465
123 Ga0157378_10336198 3300013297 Bacteria 1471
124 Ga0163162_10062954 3300013306 Bacteria 3751
125 Ga0163162_10091423 3300013306 Bacteria 3126
126 Ga0157372_10001096 3300013307 Bacteria 29445
127 Ga0157372_10197067 3300013307 Bacteria 2333
128 Ga0157375_10100053 3300013308 Bacteria 2979
129 Ga0157375_10137410 3300013308 Bacteria 2569
130 Ga0157380_10002565 3300014326 Bacteria 12277
131 Ga0157377_10014064 3300014745 Bacteria 4066
132 Ga0157379_10020322 3300014968 Bacteria 5871
133 Ga0163161_10071777 3300017792 Bacteria 2534
134 Ga0209148_1002418 3300025254 Bacteria 6469
135 Ga0209051_1001059 3300025303 Bacteria 25694
136 Ga0207697_10003206 3300025315 Bacteria 8140
137 Ga0207697_10069740 3300025315 Bacteria 1472
138 Ga0207655_1003273 3300025728 Bacteria 12152
139 Ga0207655_1016369 3300025728 Bacteria 4060
140 Ga0207713_1020629 3300025735 Bacteria 3186
141 Ga0207688_10126378 3300025901 Bacteria 1495
142 Ga0207680_10172591 3300025903 Bacteria 1457
143 Ga0207645_10001551 3300025907 Bacteria 18790
144 Ga0207643_10004998 3300025908 Bacteria 7100
145 Ga0207684_10001115 3300025910 Bacteria 30012
146 Ga0207707_10048550 3300025912 Bacteria 3697
147 Ga0207663_10050603 3300025916 Bacteria 2583
148 Ga0207660_10000304 3300025917 Bacteria 32299
149 Ga0207660_10011832 3300025917 Bacteria 5689
150 Ga0207660_10014370 3300025917 Bacteria 5205
151 Ga0207662_10000895 3300025918 Bacteria 13798
152 Ga0207657_10319102 3300025919 Bacteria 1229
153 Ga0207649_10008260 3300025920 Bacteria 5672
154 Ga0207652_10053792 3300025921 Bacteria 3458
155 Ga0207646_10020147 3300025922 Bacteria 6184
156 Ga0207646_10026837 3300025922 Bacteria 5252
157 Ga0207681_10006154 3300025923 Bacteria 7363
158 Ga0207681_10019971 3300025923 Bacteria 4243
159 Ga0207650_10020174 3300025925 Bacteria 4697
160 Ga0207650_10090997 3300025925 Bacteria 2330
161 Ga0207650_10093287 3300025925 Bacteria 2304
162 Ga0207659_10013444 3300025926 Bacteria 5243
163 Ga0207659_10205680 3300025926 Bacteria 1575
164 Ga0207659_10226396 3300025926 Bacteria 1506
165 Ga0207687_10020976 3300025927 Bacteria 4338
166 Ga0207690_10098392 3300025932 Bacteria 2084
167 Ga0207706_10007871 3300025933 Bacteria 9837
168 Ga0207706_10173369 3300025933 Bacteria 1895
169 Ga0207709_10042513 3300025935 Bacteria 2734
170 Ga0207670_10072768 3300025936 Bacteria 2381
171 Ga0207665_10006830 3300025939 Bacteria 7558
172 Ga0207691_10001197 3300025940 Bacteria 25809
173 Ga0207691_10001754 3300025940 Bacteria 21343
174 Ga0207691_10002104 3300025940 Bacteria 19455
175 Ga0207691_10063064 3300025940 Bacteria 3362
176 Ga0207691_10145536 3300025940 Bacteria 2086
177 Ga0207689_10002145 3300025942 Bacteria 18560
178 Ga0207661_10019112 3300025944 Bacteria 5101
179 Ga0207661_10061125 3300025944 Bacteria 3042
180 Ga0207679_10124036 3300025945 Bacteria 2061
181 Ga0207651_10024793 3300025960 Bacteria 3717
182 Ga0207712_10192015 3300025961 Bacteria 1613
183 Ga0207658_10069279 3300025986 Bacteria 2665
184 Ga0207658_10213358 3300025986 Bacteria 1619
185 Ga0207703_10029778 3300026035 Bacteria 4310
186 Ga0207639_10284475 3300026041 Bacteria 1455
187 Ga0207678_10011372 3300026067 Bacteria 7812
188 Ga0207708_10034965 3300026075 Bacteria 3823
189 Ga0207641_10357452 3300026088 Bacteria 1393
190 Ga0207648_10041715 3300026089 Bacteria 4030
191 Ga0207648_10092988 3300026089 Bacteria 2637
192 Ga0207648_10461982 3300026089 Bacteria 1157
193 Ga0207676_10393995 3300026095 Bacteria 1292
194 Ga0207674_10001522 3300026116 Bacteria 29897
195 Ga0207674_10005831 3300026116 Bacteria 14611
196 Ga0207674_10008554 3300026116 Bacteria 11804
197 Ga0207674_10034101 3300026116 Bacteria 5323
198 Ga0207675_100001248 3300026118 Bacteria 25348
199 Ga0207675_100015190 3300026118 Bacteria 7182
200 Ga0207675_100207967 3300026118 Bacteria 1881
201 Ga0207683_10004789 3300026121 Bacteria 11653
202 Ga0209813_10006882 3300027866 Bacteria 2820
203 Ga0207428_10004464 3300027907 Bacteria 13277
204 Ga0207428_10061589 3300027907 Bacteria 2970
205 Ga0265356_1000729 3300028017 Bacteria 5604
206 Ga0268266_10052579 3300028379 Bacteria 3498
207 Ga0268265_10013903 3300028380 Bacteria 5478
208 Ga0265762_1006010 3300030760 Bacteria 2175
209 Ga0265770_1002881 3300030878 Bacteria 2336
210 Ga0307408_100018456 3300031548 Bacteria 4683
211 Ga0307408_100020790 3300031548 Bacteria 4434
212 Ga0307408_100027372 3300031548 Bacteria 3928
213 Ga0307408_100066848 3300031548 Bacteria 2641
214 Ga0307408_100068862 3300031548 Bacteria 2607
215 Ga0307408_100206828 3300031548 Bacteria 1592
216 Ga0307408_100230171 3300031548 Bacteria 1517
217 Ga0307405_10085589 3300031731 Bacteria 2073
218 Ga0307405_10124980 3300031731 Bacteria 1767
219 Ga0307405_10301086 3300031731 Bacteria 1216
220 Ga0307413_10011048 3300031824 Bacteria 4417
221 Ga0307413_10027133 3300031824 Bacteria 3168
222 Ga0307413_10034125 3300031824 Bacteria 2905
223 Ga0307413_10036773 3300031824 Bacteria 2822
224 Ga0307413_10047162 3300031824 Bacteria 2567
225 Ga0307413_10163980 3300031824 Bacteria 1564
226 Ga0307413_10180901 3300031824 Bacteria 1503
227 Ga0307410_10000891 3300031852 Bacteria 12759
228 Ga0307410_10007769 3300031852 Bacteria 5896
229 Ga0307410_10015110 3300031852 Bacteria 4569
230 Ga0307410_10031328 3300031852 Bacteria 3411
231 Ga0307410_10057796 3300031852 Bacteria 2642
232 Ga0307410_10107933 3300031852 Bacteria 2009
233 Ga0307410_10118971 3300031852 Bacteria 1923
234 Ga0307410_10166648 3300031852 Bacteria 1656
235 Ga0307406_10232419 3300031901 Bacteria 1378
236 Ga0307407_10035796 3300031903 Bacteria 2730
237 Ga0307407_10066364 3300031903 Bacteria 2128
238 Ga0307407_10067257 3300031903 Bacteria 2117
239 Ga0307407_10072387 3300031903 Bacteria 2055
240 Ga0307407_10076473 3300031903 Bacteria 2010
241 Ga0307412_10003144 3300031911 Bacteria 9170
242 Ga0307412_10007304 3300031911 Bacteria 6265
243 Ga0307412_10025276 3300031911 Bacteria 3677
244 Ga0307412_10028450 3300031911 Bacteria 3496
245 Ga0307412_10035454 3300031911 Bacteria 3188
246 Ga0307412_10125226 3300031911 Bacteria 1857
247 Ga0307409_100003245 3300031995 Bacteria 8768
248 Ga0307409_100006409 3300031995 Bacteria 6914
249 Ga0307409_100043508 3300031995 Bacteria 3373
250 Ga0307409_100191137 3300031995 Bacteria 1822
251 Ga0307409_100326895 3300031995 Bacteria 1437
252 Ga0307416_100000951 3300032002 Bacteria 15337
253 Ga0307416_100012801 3300032002 Bacteria 5672
254 Ga0307416_100039375 3300032002 Bacteria 3658
255 Ga0307416_100066039 3300032002 Bacteria 2976
256 Ga0307416_100097442 3300032002 Bacteria 2547
257 Ga0307416_100126359 3300032002 Bacteria 2291
258 Ga0307416_100177560 3300032002 Bacteria 1992
259 Ga0307414_10005890 3300032004 Bacteria 6784
260 Ga0307411_10052364 3300032005 Bacteria 2668
261 Ga0307411_10267194 3300032005 Bacteria 1354
262 Ga0307415_100056131 3300032126 Bacteria 2698
263 Ga0307415_100230390 3300032126 Bacteria 1491
264 Ga0373934_0006929 3300035086 Bacteria 4207
265 Ga0373954_0089323 3300035118 Bacteria 1479
266 Ga0373955_0023953 3300035172 Bacteria 3115
267 Ga0373935_0055735 3300035692 Bacteria 2519
268 Ga0373927_0041181 3300035695 Bacteria 2996
269 Ga0373933_0003538 3300035724 Bacteria 8687
270 Ga0373933_0010287 3300035724 Bacteria 5125
271 Ga0373937_0000108 3300036401 Bacteria 79022
272 Ga0395899_0050211 3300037312 Bacteria 3098
273 Ga0395900_0079661 3300037418 Bacteria 3366
274 Ga0395900_0153629 3300037418 Bacteria 2351
275 Ga0395900_0383833 3300037418 Bacteria 1372
276 Ga0395898_0232453 3300037466 Bacteria 1758
277 Ga0395905_0041526 3300037471 Bacteria 4316
278 Ga0395905_0055628 3300037471 Bacteria 3703
279 Ga0395901_0006835 3300038443 Bacteria 11523
280 Ga0395901_0011818 3300038443 Bacteria 8852
281 Ga0395901_0014073 3300038443 Bacteria 8145
282 Ga0237819_04826 3300038705 Bacteria 2170
283 Ga0439436_0014972 3300041404 Bacteria 2335
284 Ga0439438_006345 3300041405 Bacteria 4188
285 Ga0439439_0004825 3300041406 Bacteria 3053
286 Ga0439447_009447 3300041407 Bacteria 2955
287 Ga0439466_0002272 3300041411 Bacteria 7532
288 Ga0439433_0000043 3300041999 Bacteria 15638
289 Ga0439442_000001 3300042002 Bacteria 161142
290 Ga0439442_000443 3300042002 Bacteria 9395
291 Ga0439442_000690 3300042002 Bacteria 7134
292 Ga0439442_001587 3300042002 Bacteria 4457
293 Ga0439432_026732 3300042006 Bacteria 1888
294 Ga0439449_0001126 3300042007 Bacteria 10485
295 Ga0439457_007610 3300042014 Bacteria 2594
296 Ga0439462_0005436 3300042015 Bacteria 3141
297 Ga0439462_0008949 3300042015 Bacteria 2532
298 Ga0450919_001112 3300042121 Bacteria 3486
299 Ga0450920_002024 3300042122 Bacteria 3426
300 Ga0450920_008613 3300042122 Bacteria 1867
301 Ga0450923_006512 3300042125 Bacteria 1941
302 Ga0450894_005848 3300042131 Bacteria 1593
303 Ga0450896_008164 3300042133 Bacteria 1451
304 Ga0450906_011753 3300042145 Bacteria 1632
305 Ga0450907_009573 3300042146 Bacteria 1606
306 Ga0450908_012914 3300042184 Bacteria 1510
307 Ga0439434_0000694 3300042435 Bacteria 9709
308 Ga0439460_0065782 3300042461 Bacteria 1114
309 Ga0450918_000313 3300042531 Bacteria 10871
310 Ga0450918_001240 3300042531 Bacteria 5183
311 Ga0451577_0000371 3300042876 Bacteria 83783
312 Ga0453684_0001367 3300044712 Bacteria 70807
313 Ga0451576_0194324 3300045051 Bacteria 2119
314 Ga0466967_0064275 3300045976 Bacteria 3263
315 Ga0495592_0001227 3300046454 Bacteria 17791
316 Ga0495629_0011406 3300046459 Bacteria 6455
317 Ga0495638_0070449 3300046460 Bacteria 2141
318 Ga0495651_0000661 3300046462 Bacteria 26738
319 Ga0495653_0001029 3300046463 Bacteria 21492
320 Ga0495653_0009391 3300046463 Bacteria 8005
321 Ga0495580_0004947 3300046472 Bacteria 11140
322 Ga0495580_0020572 3300046472 Bacteria 4882
323 Ga0495580_0020636 3300046472 Bacteria 4873
324 Ga0495582_0031325 3300046473 Bacteria 2923
325 Ga0495582_0036119 3300046473 Bacteria 2718
326 Ga0495582_0162742 3300046473 Bacteria 1269
327 Ga0495639_0001140 3300046475 Bacteria 12001
328 Ga0495639_0002884 3300046475 Bacteria 7482
329 Ga0495662_0004919 3300046476 Bacteria 6689
330 Ga0495664_0077753 3300046477 Bacteria 1987
331 Ga0495608_0002135 3300046511 Bacteria 14265
332 Ga0495618_0016016 3300046514 Bacteria 4579
333 Ga0495618_0021896 3300046514 Bacteria 3944
334 Ga0495630_0034476 3300046517 Bacteria 3779
335 Ga0495630_0055978 3300046517 Bacteria 2955
336 Ga0495643_0000055 3300046522 Bacteria 198641
337 Ga0495643_0114886 3300046522 Bacteria 1365
338 Ga0495652_0001763 3300046529 Bacteria 23231
339 Ga0495665_0001181 3300046531 Bacteria 13905
340 Ga0495640_0006334 3300046533 Bacteria 9380
341 Ga0495586_0000411 3300046535 Bacteria 26021
342 Ga0495586_0012810 3300046535 Bacteria 4444
343 Ga0495587_0000339 3300046536 Bacteria 33290
344 Ga0495587_0001102 3300046536 Bacteria 17749
345 Ga0495645_0002611 3300046543 Bacteria 12254
346 Ga0495645_0017213 3300046543 Bacteria 5177
347 Ga0495667_0015499 3300046559 Bacteria 5150
348 Ga0495668_0096458 3300046616 Bacteria 1618
349 Ga0495634_0006327 3300046642 Bacteria 9011
350 Ga0495635_0082462 3300046663 Bacteria 2201
351 Ga0495588_0006643 3300046674 Bacteria 5221
352 Ga0495588_0015748 3300046674 Bacteria 3645
353 Ga0495588_0018893 3300046674 Bacteria 3368
354 Ga0495657_0003526 3300046675 Bacteria 12759
355 Ga0495657_0017190 3300046675 Bacteria 5255
356 Ga0495599_0039291 3300046678 Bacteria 2973
357 Ga0495646_0007201 3300046680 Bacteria 7066
358 Ga0495658_0100718 3300046683 Bacteria 1724
359 Ga0495600_0000804 3300046809 Bacteria 16637
360 Ga0495600_0003882 3300046809 Bacteria 8871
361 Ga0495581_0026131 3300047315 Bacteria 3386
362 Ga0495604_0001130 3300047317 Bacteria 22166
363 Ga0495604_0173109 3300047317 Bacteria 1516
364 Ga0495636_0041988 3300047318 Bacteria 1899
365 Ga0495674_0002947 3300047319 Bacteria 16544
366 Ga0495674_0020145 3300047319 Bacteria 6180
367 Ga0495680_0003949 3300047322 Bacteria 14338
368 Ga0495680_0006062 3300047322 Bacteria 11299
369 Ga0495675_0087403 3300047444 Bacteria 1958
370 Ga0495677_0025730 3300047445 Bacteria 2135
371 Ga0495684_0009337 3300047471 Bacteria 7571
372 Ga0495684_0090830 3300047471 Bacteria 2313
373 Ga0495684_0102946 3300047471 Bacteria 2158
374 Ga0495593_0085783 3300047673 Bacteria 1624
375 Ga0495602_0076194 3300048088 Bacteria 2843
376 Ga0496100_0006908 3300048903 Bacteria 6218
377 Ga0496101_0017951 3300048904 Bacteria 4803
378 Ga0496102_0041055 3300048905 Bacteria 4188
379 Ga0496103_0004538 3300048906 Bacteria 8405
380 Ga0496103_0005094 3300048906 Bacteria 7917
381 Ga0496104_0227982 3300048907 Bacteria 1775
382 Ga0496106_0010066 3300048909 Bacteria 6983
383 Ga0496107_0116055 3300048910 Bacteria 1970
384 Ga0496107_0154171 3300048910 Bacteria 1700
385 Ga0496110_0254765 3300048913 Bacteria 1597
386 Ga0496111_0015429 3300048914 Bacteria 5243
387 Ga0496111_0029392 3300048914 Bacteria 3903
388 Ga0496112_0016131 3300048915 Bacteria 6986
389 Ga0496112_0029582 3300048915 Bacteria 5297
390 Ga0496113_0128338 3300048916 Bacteria 1987
391 Ga0496114_0096775 3300048917 Bacteria 2513
392 Ga0496117_0004226 3300048920 Bacteria 16032
393 Ga0496119_0083560 3300048922 Bacteria 1833
394 Ga0496124_0108561 3300048927 Bacteria 2238
395 Ga0501032_0000135 3300049569 Bacteria 60174
396 Ga0501032_0017363 3300049569 Bacteria 5052
397 Ga0501032_0201951 3300049569 Bacteria 1297
398 Ga0501034_0000505 3300049571 Bacteria 62933
399 Ga0501034_0001470 3300049571 Bacteria 31214
400 Ga0501034_0258854 3300049571 Bacteria 1683
401 Ga0501034_0277467 3300049571 Bacteria 1616
402 Ga0501037_0003634 3300049573 Bacteria 11187
403 Ga0501037_0003810 3300049573 Bacteria 10943
404 Ga0501037_0104021 3300049573 Bacteria 2048
405 Ga0501039_0029292 3300049575 Bacteria 4239
406 Ga0501039_0182444 3300049575 Bacteria 1650
407 Ga0501043_0013013 3300049579 Bacteria 6504
408 Ga0501043_0078812 3300049579 Bacteria 2588
409 Ga0501046_0006597 3300049580 Bacteria 10252
410 Ga0501070_0125955 3300049586 Bacteria 2117
411 Ga0501073_0008651 3300049589 Bacteria 7542
412 Ga0501073_0093556 3300049589 Bacteria 2088
413 Ga0501074_0033894 3300049590 Bacteria 3702
414 Ga0501076_0106057 3300049592 Bacteria 2268
415 Ga0501221_022271 3300049704 Bacteria 1255
416 Ga0501044_0024288 3300049823 Bacteria 6438
417 nmdc:mga03683_66638_c1 3300050489 Bacteria 1531
418 nmdc:mga04h51_3997_c1 3300050495 Bacteria 3630
419 nmdc:mga05p37_115938_c1 3300050507 Bacteria 3293
420 nmdc:mga05p37_229942_c1 3300050507 Bacteria 2235
421 nmdc:mga05p37_29940_c1 3300050507 Bacteria 6644
422 nmdc:mga09592_111515_c1 3300050508 Bacteria 2347
423 nmdc:mga09592_126468_c1 3300050508 Bacteria 2197
424 nmdc:mga0qj67_14306_c1 3300050509 Bacteria 5997
425 nmdc:mga0qj67_29450_c1 3300050509 Bacteria 4265
426 nmdc:mga0qj67_31026_c1 3300050509 Bacteria 4162
427 nmdc:mga0qj67_46602_c1 3300050509 Bacteria 3423
428 nmdc:mga06r32_310367_c1 3300050510 Bacteria 1563
429 nmdc:mga06r32_388880_c1 3300050510 Bacteria 1377
430 nmdc:mga06r32_66431_c1 3300050510 Bacteria 3480
431 nmdc:mga08y16_220802_c1 3300050511 Bacteria 1962
432 nmdc:mga0n895_731_c1 3300050512 Bacteria 23143
433 nmdc:mga08x19_65740_c1 3300050514 Bacteria 2356
434 nmdc:mga0a205_70314_c1 3300050515 Bacteria 3379
435 nmdc:mga0a205_71339_c1 3300050515 Bacteria 3355
436 nmdc:mga0sz30_4324_c1 3300050516 Bacteria 5125
437 Ga0495601_0007779 3300053077 Bacteria 6302
438 Ga0495612_0001641 3300053078 Bacteria 9209
439 Ga0495595_0001088 3300053084 Bacteria 10514
440 Ga0495619_0003278 3300053085 Bacteria 10467
441 Ga0500556_0000708 3300053104 Bacteria 20232
442 Ga0500628_000763 3300053129 Bacteria 5745
443 Ga0500559_0001070 3300053136 Bacteria 16616
444 Ga0500559_0002433 3300053136 Bacteria 9636
445 Ga0500559_0006478 3300053136 Bacteria 5285
446 Ga0500616_0000076 3300053153 Bacteria 216836
447 Ga0590075_030064 3300059424 Bacteria 1375
448 2523387789 2523231044 Bacteria 6434991
449 2643874956 2643221572 Bacteria 3614809
450 2644382012 2643221669 Bacteria 3611286
451 2691514630 2690315906 Bacteria 4517044
452 2775655032 2775506735 Bacteria 4556596
453 2808827743 2808606357 Bacteria 4466944
454 2808853097 2808606360 Bacteria 4404006
455 2808878401 2808606366 Bacteria 4415912
456 2808891986 2808606370 Bacteria 4942454
457 2808897080 2808606371 Bacteria 4251511
458 2812320494 2811994871 Bacteria 4497550
459 2844855155 2844852863 Bacteria 3849151
460 2852678509 2852677369 Bacteria 3768884
461 2895661048 2895660088 Bacteria 3782833
462 2904499760 2904497146 Bacteria 4731781
463 2904776683 2904776348 Bacteria 4658726
464 2910812393 2910809715 Bacteria 4982797
465 2919036232 2919034639 Bacteria 4763403
466 2919061655 2919059106 Bacteria 4991624
467 2919391488 2919391150 Bacteria 4884741
468 2919542207 2919538618 Bacteria 4677069
469 2932429277 2932426870 Bacteria 4547726
470 2933420760 2933418574 Bacteria 4476724
471 2939648821 2939647034 Bacteria 4681660
472 2939676026 2939674588 Bacteria 4844420
473 2945918253 2945916053 Bacteria 4555517
474 2945921460 2945920336 Bacteria 4501603
475 2945942355 2945941187 Bacteria 4682474
476 2945959880 2945956166 Bacteria 5110334
477 2946038300 2946037020 Bacteria 4900426
478 2946062104 2946059875 Bacteria 4386623
479 2953999575 2953998280 Bacteria 4812144
480 2974306286 2974302888 Bacteria 4369871
481 8054110995 8054107350 Bacteria 5022511
482 8057349208 8057345674 Bacteria 4160394
483 Ga0207668_10018129
484 LJQas_1000534
485 Ga0055542_1007539
486 Ga0065165_1000879
487 Ga0065714_10013025
488 Ga0070676_10016152
489 Ga0070683_100002646
490 Ga0070683_100025439
491 Ga0070683_100035639
492 Ga0070670_100010118
493 Ga0070670_100026039
494 Ga0070670_100044748
495 Ga0070680_100000417
496 Ga0070680_100047085
497 Ga0070660_100048512
498 Ga0070687_100009638
499 Ga0070661_100002688
500 Ga0070661_100066424
501 Ga0070668_100007638
502 Ga0070668_100020012
503 Ga0070669_100002967
504 Ga0070675_100018309
505 Ga0070675_100318683
506 Ga0070671_100133771
507 Ga0070673_100039405
508 Ga0070673_100122960
509 Ga0070667_100113617
510 Ga0070709_10080038
511 Ga0070701_10020050
512 Ga0070701_10057808
513 Ga0070711_100086122
514 Ga0070694_100157972
515 Ga0070708_100042212
516 Ga0070662_100028007
517 Ga0070662_100093993
518 Ga0070681_10008844
519 Ga0070681_10076202
520 Ga0070685_10013350
521 Ga0070707_100039515
522 Ga0070707_100479442
523 Ga0070699_100198328
524 Ga0070699_100410249
525 Ga0070684_100009021
526 Ga0070684_100036343
527 Ga0068853_100126709
528 Ga0070672_100009308
529 Ga0070672_100010998
530 Ga0070672_100016090
531 Ga0070672_100103862
532 Ga0070686_100062171
533 Ga0070695_100207052
534 Ga0070695_100268662
535 Ga0070665_100043810
536 Ga0070665_100123444
537 Ga0070704_100138617
538 Ga0070704_100176532
539 Ga0070664_100014332
540 Ga0070664_100044780
541 Ga0070664_100047397
542 Ga0068857_100003492
543 Ga0068857_100010297
544 Ga0068857_100031686
545 Ga0068856_100164886
546 Ga0070702_100168652
547 Ga0068859_100012802
548 Ga0068859_100099874
549 Ga0068864_100036063
550 Ga0068866_10090987
551 Ga0068861_100023507
552 Ga0068861_100196970
553 Ga0068851_10003869
554 Ga0068851_10020371
555 Ga0068870_10021341
556 Ga0068863_100073511
557 Ga0068862_100018635
558 Ga0070717_10114807
559 Ga0075365_10001955
560 Ga0075368_10009902
561 Ga0075363_100028584
562 Ga0075364_10008718
563 Ga0075432_10003827
564 Ga0075362_10036169
565 Ga0075367_10004292
566 Ga0075369_10004310
567 Ga0075428_100060723
568 Ga0075430_100005360
569 Ga0075430_100019818
570 Ga0075430_100039636
571 Ga0075430_100094761
572 Ga0075431_100005540
573 Ga0075431_100358924
574 Ga0075433_10013611
575 Ga0075433_10050814
576 Ga0075433_10182036
577 Ga0075434_100064066
578 Ga0075429_100167201
579 Ga0075429_100329015
580 Ga0068865_100010513
581 Ga0075436_100066943
582 Ga0097620_100012802
583 Ga0105244_10022100
584 Ga0105244_10041676
585 Ga0111539_10234543
586 Ga0105245_10021458
587 Ga0105245_10078923
588 Ga0114129_10060130
589 Ga0114129_10082331
590 Ga0114129_10273720
591 Ga0105243_10201942
592 Ga0105248_10010867
593 Ga0105248_10204011
594 Ga0105237_10105212
595 Ga0105238_10007670
596 Ga0105249_10007686
597 Ga0105249_10021036
598 Ga0105239_10145477
599 Ga0105246_10022407
600 Ga0105246_10257089
601 Ga0157373_10111198
602 Ga0157373_10117807
603 Ga0157370_10190460
604 Ga0157369_10380573
605 Ga0157378_10336198
606 Ga0163162_10062954
607 Ga0163162_10091423
608 Ga0157372_10001096
609 Ga0157372_10197067
610 Ga0157375_10100053
611 Ga0157375_10137410
612 Ga0157380_10002565
613 Ga0157377_10014064
614 Ga0157379_10020322
615 Ga0163161_10071777
616 Ga0209148_1002418
617 Ga0209051_1001059
618 Ga0207697_10003206
619 Ga0207697_10069740
620 Ga0207655_1003273
621 Ga0207655_1016369
622 Ga0207713_1020629
623 Ga0207688_10126378
624 Ga0207680_10172591
625 Ga0207645_10001551
626 Ga0207643_10004998
627 Ga0207684_10001115
628 Ga0207707_10048550
629 Ga0207663_10050603
630 Ga0207660_10000304
631 Ga0207660_10011832
632 Ga0207660_10014370
633 Ga0207662_10000895
634 Ga0207657_10319102
635 Ga0207649_10008260
636 Ga0207652_10053792
637 Ga0207646_10020147
638 Ga0207646_10026837
639 Ga0207681_10006154
640 Ga0207681_10019971
641 Ga0207650_10020174
642 Ga0207650_10090997
643 Ga0207650_10093287
644 Ga0207659_10013444
645 Ga0207659_10205680
646 Ga0207659_10226396
647 Ga0207687_10020976
648 Ga0207690_10098392
649 Ga0207706_10007871
650 Ga0207706_10173369
651 Ga0207709_10042513
652 Ga0207670_10072768
653 Ga0207665_10006830
654 Ga0207691_10001197
655 Ga0207691_10001754
656 Ga0207691_10002104
657 Ga0207691_10063064
658 Ga0207691_10145536
659 Ga0207689_10002145
660 Ga0207661_10019112
661 Ga0207661_10061125
662 Ga0207679_10124036
663 Ga0207651_10024793
664 Ga0207712_10192015
665 Ga0207658_10069279
666 Ga0207658_10213358
667 Ga0207703_10029778
668 Ga0207639_10284475
669 Ga0207678_10011372
670 Ga0207708_10034965
671 Ga0207641_10357452
672 Ga0207648_10041715
673 Ga0207648_10092988
674 Ga0207648_10461982
675 Ga0207676_10393995
676 Ga0207674_10001522
677 Ga0207674_10005831
678 Ga0207674_10008554
679 Ga0207674_10034101
680 Ga0207675_100001248
681 Ga0207675_100015190
682 Ga0207675_100207967
683 Ga0207683_10004789
684 Ga0209813_10006882
685 Ga0207428_10004464
686 Ga0207428_10061589
687 Ga0265356_1000729
688 Ga0268266_10052579
689 Ga0268265_10013903
690 Ga0265762_1006010
691 Ga0265770_1002881
692 Ga0307408_100018456
693 Ga0307408_100020790
694 Ga0307408_100027372
695 Ga0307408_100066848
696 Ga0307408_100068862
697 Ga0307408_100206828
698 Ga0307408_100230171
699 Ga0307405_10085589
700 Ga0307405_10124980
701 Ga0307405_10301086
702 Ga0307413_10011048
703 Ga0307413_10027133
704 Ga0307413_10034125
705 Ga0307413_10036773
706 Ga0307413_10047162
707 Ga0307413_10163980
708 Ga0307413_10180901
709 Ga0307410_10000891
710 Ga0307410_10007769
711 Ga0307410_10015110
712 Ga0307410_10031328
713 Ga0307410_10057796
714 Ga0307410_10107933
715 Ga0307410_10118971
716 Ga0307410_10166648
717 Ga0307406_10232419
718 Ga0307407_10035796
719 Ga0307407_10066364
720 Ga0307407_10067257
721 Ga0307407_10072387
722 Ga0307407_10076473
723 Ga0307412_10003144
724 Ga0307412_10007304
725 Ga0307412_10025276
726 Ga0307412_10028450
727 Ga0307412_10035454
728 Ga0307412_10125226
729 Ga0307409_100003245
730 Ga0307409_100006409
731 Ga0307409_100043508
732 Ga0307409_100191137
733 Ga0307409_100326895
734 Ga0307416_100000951
735 Ga0307416_100012801
736 Ga0307416_100039375
737 Ga0307416_100066039
738 Ga0307416_100097442
739 Ga0307416_100126359
740 Ga0307416_100177560
741 Ga0307414_10005890
742 Ga0307411_10052364
743 Ga0307411_10267194
744 Ga0307415_100056131
745 Ga0307415_100230390
746 Ga0373934_0006929
747 Ga0373954_0089323
748 Ga0373955_0023953
749 Ga0373935_0055735
750 Ga0373927_0041181
751 Ga0373933_0003538
752 Ga0373933_0010287
753 Ga0373937_0000108
754 Ga0395899_0050211
755 Ga0395900_0079661
756 Ga0395900_0153629
757 Ga0395900_0383833
758 Ga0395898_0232453
759 Ga0395905_0041526
760 Ga0395905_0055628
761 Ga0395901_0006835
762 Ga0395901_0011818
763 Ga0395901_0014073
764 Ga0237819_04826
765 Ga0439436_0014972
766 Ga0439438_006345
767 Ga0439439_0004825
768 Ga0439447_009447
769 Ga0439466_0002272
770 Ga0439433_0000043
771 Ga0439442_000001
772 Ga0439442_000443
773 Ga0439442_000690
774 Ga0439442_001587
775 Ga0439432_026732
776 Ga0439449_0001126
777 Ga0439457_007610
778 Ga0439462_0005436
779 Ga0439462_0008949
780 Ga0450919_001112
781 Ga0450920_002024
782 Ga0450920_008613
783 Ga0450923_006512
784 Ga0450894_005848
785 Ga0450896_008164
786 Ga0450906_011753
787 Ga0450907_009573
788 Ga0450908_012914
789 Ga0439434_0000694
790 Ga0439460_0065782
791 Ga0450918_000313
792 Ga0450918_001240
793 Ga0451577_0000371
794 Ga0453684_0001367
795 Ga0451576_0194324
796 Ga0466967_0064275
797 Ga0495592_0001227
798 Ga0495629_0011406
799 Ga0495638_0070449
800 Ga0495651_0000661
801 Ga0495653_0001029
802 Ga0495653_0009391
803 Ga0495580_0004947
804 Ga0495580_0020572
805 Ga0495580_0020636
806 Ga0495582_0031325
807 Ga0495582_0036119
808 Ga0495582_0162742
809 Ga0495639_0001140
810 Ga0495639_0002884
811 Ga0495662_0004919
812 Ga0495664_0077753
813 Ga0495608_0002135
814 Ga0495618_0016016
815 Ga0495618_0021896
816 Ga0495630_0034476
817 Ga0495630_0055978
818 Ga0495643_0000055
819 Ga0495643_0114886
820 Ga0495652_0001763
821 Ga0495665_0001181
822 Ga0495640_0006334
823 Ga0495586_0000411
824 Ga0495586_0012810
825 Ga0495587_0000339
826 Ga0495587_0001102
827 Ga0495645_0002611
828 Ga0495645_0017213
829 Ga0495667_0015499
830 Ga0495668_0096458
831 Ga0495634_0006327
832 Ga0495635_0082462
833 Ga0495588_0006643
834 Ga0495588_0015748
835 Ga0495588_0018893
836 Ga0495657_0003526
837 Ga0495657_0017190
838 Ga0495599_0039291
839 Ga0495646_0007201
840 Ga0495658_0100718
841 Ga0495600_0000804
842 Ga0495600_0003882
843 Ga0495581_0026131
844 Ga0495604_0001130
845 Ga0495604_0173109
846 Ga0495636_0041988
847 Ga0495674_0002947
848 Ga0495674_0020145
849 Ga0495680_0003949
850 Ga0495680_0006062
851 Ga0495675_0087403
852 Ga0495677_0025730
853 Ga0495684_0009337
854 Ga0495684_0090830
855 Ga0495684_0102946
856 Ga0495593_0085783
857 Ga0495602_0076194
858 Ga0496100_0006908
859 Ga0496101_0017951
860 Ga0496102_0041055
861 Ga0496103_0004538
862 Ga0496103_0005094
863 Ga0496104_0227982
864 Ga0496106_0010066
865 Ga0496107_0116055
866 Ga0496107_0154171
867 Ga0496110_0254765
868 Ga0496111_0015429
869 Ga0496111_0029392
870 Ga0496112_0016131
871 Ga0496112_0029582
872 Ga0496113_0128338
873 Ga0496114_0096775
874 Ga0496117_0004226
875 Ga0496119_0083560
876 Ga0496124_0108561
877 Ga0501032_0000135
878 Ga0501032_0017363
879 Ga0501032_0201951
880 Ga0501034_0000505
881 Ga0501034_0001470
882 Ga0501034_0258854
883 Ga0501034_0277467
884 Ga0501037_0003634
885 Ga0501037_0003810
886 Ga0501037_0104021
887 Ga0501039_0029292
888 Ga0501039_0182444
889 Ga0501043_0013013
890 Ga0501043_0078812
891 Ga0501046_0006597
892 Ga0501070_0125955
893 Ga0501073_0008651
894 Ga0501073_0093556
895 Ga0501074_0033894
896 Ga0501076_0106057
897 Ga0501221_022271
898 Ga0501044_0024288
899 nmdc:mga03683_66638_c1
900 nmdc:mga04h51_3997_c1
901 nmdc:mga05p37_115938_c1
902 nmdc:mga05p37_229942_c1
903 nmdc:mga05p37_29940_c1
904 nmdc:mga09592_111515_c1
905 nmdc:mga09592_126468_c1
906 nmdc:mga0qj67_14306_c1
907 nmdc:mga0qj67_29450_c1
908 nmdc:mga0qj67_31026_c1
909 nmdc:mga0qj67_46602_c1
910 nmdc:mga06r32_310367_c1
911 nmdc:mga06r32_388880_c1
912 nmdc:mga06r32_66431_c1
913 nmdc:mga08y16_220802_c1
914 nmdc:mga0n895_731_c1
915 nmdc:mga08x19_65740_c1
916 nmdc:mga0a205_70314_c1
917 nmdc:mga0a205_71339_c1
918 nmdc:mga0sz30_4324_c1
919 Ga0495601_0007779
920 Ga0495612_0001641
921 Ga0495595_0001088
922 Ga0495619_0003278
923 Ga0500556_0000708
924 Ga0500628_000763
925 Ga0500559_0001070
926 Ga0500559_0002433
927 Ga0500559_0006478
928 Ga0500616_0000076
929 Ga0590075_030064
930 2523387789
931 2643874956
932 2644382012
933 2691514630
934 2775655032
935 2808827743
936 2808853097
937 2808878401
938 2808891986
939 2808897080
940 2812320494
941 2844855155
942 2852678509
943 2895661048
944 2904499760
945 2904776683
946 2910812393
947 2919036232
948 2919061655
949 2919391488
950 2919542207
951 2932429277
952 2933420760
953 2939648821
954 2939676026
955 2945918253
956 2945921460
957 2945942355
958 2945959880
959 2946038300
960 2946062104
961 2953999575
962 2974306286
963 8054110995
964 8057349208

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

45

346

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9564 30 368
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9402 30 368
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8704 30 362
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8605 30 362
1luc-assembly1.cif.gz_A bacterial luciferase 0.8592 30 362
ID Description Score Start End Superfamily
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9465 28 370 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9426 31 368 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9344 31 368 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.923 28 370 3.20.20.30
af_I6X7W8_4_352_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8432 30 362 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A558H8F2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9949 19 371 GO:0004497
GO:0005829
GO:0016705
AF-A0A558H8F2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9865 19 371 GO:0004497
GO:0005829
GO:0016705
AF-A0A4P6N0C1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9791 29 370 GO:0004497
GO:0005829
GO:0016705
AF-A0A160PRZ1-F1-model_v4 Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase 0.9764 93 370 GO:0004497
GO:0005829
GO:0016705
AF-A0A2W4U291-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9733 30 323 GO:0004497
GO:0005829
GO:0016705

Map