F452629
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 482 | 311 | 964 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300025972|Ga0207668_10018129|Ga0207668_100181295 |
| Length | 396 |
| Sequence | MTWNQKGAPRISNGGGCSIIAYTARPHHIPQTTTMQPYLELGLDTFGDVTRDANGRPLPQAQVIRHVIDEAVLADELGVDFIGVGEHHRADFAVASPEVVLAAIAGRTHRIRLGSAVTVLSSDDPVRVFQRFASLDAASNGRAEIILGRGSFIESFPLFGYPLDQYEALFEEKLELFAALLEANRTGVPVTWRGTTRASLDGLRVYPPTESGRLTTWIGVGGSPESVVRAARYGMPLMLAIIGGNPLRFAPYIDLYDRALAERGVDSLPIGVHSPGHIADTDARAREELWPSWREMRNRIGAERGWGPTSRAEFDREIEAGSLYVGAPEAVAQKIAATAGALGLSRFDMKYSAGALAHDKLMRSIELYGREVIPRVRALLAAEEPESAGAAAGGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 142 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 164 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 165 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 166 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 167 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 168 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 169 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 170 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 171 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 172 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 173 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 174 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 175 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 176 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 177 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 178 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 179 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 180 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 181 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 182 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 183 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 184 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 185 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 186 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 273 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 274 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 275 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 276 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 278 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 279 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 280 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 281 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 282 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 283 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 284 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 285 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 286 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 287 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 288 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 289 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 290 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 291 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 292 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 293 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 294 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 295 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 296 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 297 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 298 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 299 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 300 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 301 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 302 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 303 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 304 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 305 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 306 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 307 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 308 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 309 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 310 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 311 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.32 |
| Metatranscriptomes | 0.41 |
| Isolates | 7.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.36 |
| Nodule | 0 |
| Rhizoplane | 3.32 |
| Rhizosphere | 88.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207668_10018129 | 3300025972 | Bacteria | 4423 |
| 2 | LJQas_1000534 | 3300000549 | Bacteria | 6248 |
| 3 | Ga0055542_1007539 | 3300003762 | Bacteria | 2200 |
| 4 | Ga0065165_1000879 | 3300005262 | Bacteria | 38853 |
| 5 | Ga0065714_10013025 | 3300005288 | Bacteria | 2406 |
| 6 | Ga0070676_10016152 | 3300005328 | Bacteria | 4124 |
| 7 | Ga0070683_100002646 | 3300005329 | Bacteria | 14315 |
| 8 | Ga0070683_100025439 | 3300005329 | Bacteria | 5316 |
| 9 | Ga0070683_100035639 | 3300005329 | Bacteria | 4548 |
| 10 | Ga0070670_100010118 | 3300005331 | Bacteria | 8047 |
| 11 | Ga0070670_100026039 | 3300005331 | Bacteria | 5034 |
| 12 | Ga0070670_100044748 | 3300005331 | Bacteria | 3805 |
| 13 | Ga0070680_100000417 | 3300005336 | Bacteria | 29035 |
| 14 | Ga0070680_100047085 | 3300005336 | Bacteria | 3510 |
| 15 | Ga0070660_100048512 | 3300005339 | Bacteria | 3262 |
| 16 | Ga0070687_100009638 | 3300005343 | Bacteria | 4145 |
| 17 | Ga0070661_100002688 | 3300005344 | Bacteria | 12173 |
| 18 | Ga0070661_100066424 | 3300005344 | Bacteria | 2650 |
| 19 | Ga0070668_100007638 | 3300005347 | Bacteria | 8025 |
| 20 | Ga0070668_100020012 | 3300005347 | Bacteria | 5046 |
| 21 | Ga0070669_100002967 | 3300005353 | Bacteria | 12228 |
| 22 | Ga0070675_100018309 | 3300005354 | Bacteria | 5575 |
| 23 | Ga0070675_100318683 | 3300005354 | Bacteria | 1373 |
| 24 | Ga0070671_100133771 | 3300005355 | Bacteria | 2090 |
| 25 | Ga0070673_100039405 | 3300005364 | Bacteria | 3615 |
| 26 | Ga0070673_100122960 | 3300005364 | Bacteria | 2168 |
| 27 | Ga0070667_100113617 | 3300005367 | Bacteria | 2350 |
| 28 | Ga0070709_10080038 | 3300005434 | Bacteria | 2129 |
| 29 | Ga0070701_10020050 | 3300005438 | Bacteria | 3168 |
| 30 | Ga0070701_10057808 | 3300005438 | Bacteria | 2034 |
| 31 | Ga0070711_100086122 | 3300005439 | Bacteria | 2252 |
| 32 | Ga0070694_100157972 | 3300005444 | Bacteria | 1661 |
| 33 | Ga0070708_100042212 | 3300005445 | Bacteria | 4002 |
| 34 | Ga0070662_100028007 | 3300005457 | Bacteria | 3918 |
| 35 | Ga0070662_100093993 | 3300005457 | Bacteria | 2257 |
| 36 | Ga0070681_10008844 | 3300005458 | Bacteria | 9892 |
| 37 | Ga0070681_10076202 | 3300005458 | Bacteria | 3313 |
| 38 | Ga0070685_10013350 | 3300005466 | Bacteria | 4330 |
| 39 | Ga0070707_100039515 | 3300005468 | Bacteria | 4510 |
| 40 | Ga0070707_100479442 | 3300005468 | Bacteria | 1205 |
| 41 | Ga0070699_100198328 | 3300005518 | Bacteria | 1784 |
| 42 | Ga0070699_100410249 | 3300005518 | Bacteria | 1225 |
| 43 | Ga0070684_100009021 | 3300005535 | Bacteria | 7835 |
| 44 | Ga0070684_100036343 | 3300005535 | Bacteria | 4220 |
| 45 | Ga0068853_100126709 | 3300005539 | Bacteria | 2281 |
| 46 | Ga0070672_100009308 | 3300005543 | Bacteria | 6767 |
| 47 | Ga0070672_100010998 | 3300005543 | Bacteria | 6297 |
| 48 | Ga0070672_100016090 | 3300005543 | Bacteria | 5349 |
| 49 | Ga0070672_100103862 | 3300005543 | Bacteria | 2308 |
| 50 | Ga0070686_100062171 | 3300005544 | Bacteria | 2415 |
| 51 | Ga0070695_100207052 | 3300005545 | Bacteria | 1405 |
| 52 | Ga0070695_100268662 | 3300005545 | Bacteria | 1248 |
| 53 | Ga0070665_100043810 | 3300005548 | Bacteria | 4496 |
| 54 | Ga0070665_100123444 | 3300005548 | Bacteria | 2592 |
| 55 | Ga0070704_100138617 | 3300005549 | Bacteria | 1896 |
| 56 | Ga0070704_100176532 | 3300005549 | Bacteria | 1704 |
| 57 | Ga0070664_100014332 | 3300005564 | Bacteria | 6463 |
| 58 | Ga0070664_100044780 | 3300005564 | Bacteria | 3736 |
| 59 | Ga0070664_100047397 | 3300005564 | Bacteria | 3630 |
| 60 | Ga0068857_100003492 | 3300005577 | Bacteria | 13119 |
| 61 | Ga0068857_100010297 | 3300005577 | Bacteria | 8124 |
| 62 | Ga0068857_100031686 | 3300005577 | Bacteria | 4673 |
| 63 | Ga0068856_100164886 | 3300005614 | Bacteria | 2227 |
| 64 | Ga0070702_100168652 | 3300005615 | Bacteria | 1422 |
| 65 | Ga0068859_100012802 | 3300005617 | Bacteria | 8426 |
| 66 | Ga0068859_100099874 | 3300005617 | Bacteria | 2957 |
| 67 | Ga0068864_100036063 | 3300005618 | Bacteria | 4214 |
| 68 | Ga0068866_10090987 | 3300005718 | Bacteria | 1662 |
| 69 | Ga0068861_100023507 | 3300005719 | Bacteria | 4446 |
| 70 | Ga0068861_100196970 | 3300005719 | Bacteria | 1688 |
| 71 | Ga0068851_10003869 | 3300005834 | Bacteria | 6703 |
| 72 | Ga0068851_10020371 | 3300005834 | Bacteria | 3212 |
| 73 | Ga0068870_10021341 | 3300005840 | Bacteria | 3166 |
| 74 | Ga0068863_100073511 | 3300005841 | Bacteria | 3234 |
| 75 | Ga0068862_100018635 | 3300005844 | Bacteria | 5782 |
| 76 | Ga0070717_10114807 | 3300006028 | Bacteria | 2301 |
| 77 | Ga0075365_10001955 | 3300006038 | Bacteria | 9730 |
| 78 | Ga0075368_10009902 | 3300006042 | Bacteria | 3437 |
| 79 | Ga0075363_100028584 | 3300006048 | Bacteria | 2870 |
| 80 | Ga0075364_10008718 | 3300006051 | Bacteria | 6066 |
| 81 | Ga0075432_10003827 | 3300006058 | Bacteria | 5131 |
| 82 | Ga0075362_10036169 | 3300006177 | Bacteria | 2159 |
| 83 | Ga0075367_10004292 | 3300006178 | Bacteria | 6927 |
| 84 | Ga0075369_10004310 | 3300006186 | Bacteria | 5243 |
| 85 | Ga0075428_100060723 | 3300006844 | Bacteria | 4140 |
| 86 | Ga0075430_100005360 | 3300006846 | Bacteria | 10833 |
| 87 | Ga0075430_100019818 | 3300006846 | Bacteria | 5721 |
| 88 | Ga0075430_100039636 | 3300006846 | Bacteria | 3988 |
| 89 | Ga0075430_100094761 | 3300006846 | Bacteria | 2495 |
| 90 | Ga0075431_100005540 | 3300006847 | Bacteria | 12462 |
| 91 | Ga0075431_100358924 | 3300006847 | Bacteria | 1464 |
| 92 | Ga0075433_10013611 | 3300006852 | Bacteria | 6622 |
| 93 | Ga0075433_10050814 | 3300006852 | Bacteria | 3610 |
| 94 | Ga0075433_10182036 | 3300006852 | Bacteria | 1870 |
| 95 | Ga0075434_100064066 | 3300006871 | Bacteria | 3659 |
| 96 | Ga0075429_100167201 | 3300006880 | Bacteria | 1926 |
| 97 | Ga0075429_100329015 | 3300006880 | Bacteria | 1337 |
| 98 | Ga0068865_100010513 | 3300006881 | Bacteria | 5763 |
| 99 | Ga0075436_100066943 | 3300006914 | Bacteria | 2483 |
| 100 | Ga0097620_100012802 | 3300006931 | Bacteria | 8426 |
| 101 | Ga0105244_10022100 | 3300009036 | Bacteria | 3506 |
| 102 | Ga0105244_10041676 | 3300009036 | Bacteria | 2378 |
| 103 | Ga0111539_10234543 | 3300009094 | Bacteria | 2136 |
| 104 | Ga0105245_10021458 | 3300009098 | Bacteria | 5666 |
| 105 | Ga0105245_10078923 | 3300009098 | Bacteria | 3004 |
| 106 | Ga0114129_10060130 | 3300009147 | Bacteria | 5312 |
| 107 | Ga0114129_10082331 | 3300009147 | Bacteria | 4472 |
| 108 | Ga0114129_10273720 | 3300009147 | Bacteria | 2258 |
| 109 | Ga0105243_10201942 | 3300009148 | Bacteria | 1744 |
| 110 | Ga0105248_10010867 | 3300009177 | Bacteria | 10050 |
| 111 | Ga0105248_10204011 | 3300009177 | Bacteria | 2228 |
| 112 | Ga0105237_10105212 | 3300009545 | Bacteria | 2813 |
| 113 | Ga0105238_10007670 | 3300009551 | Bacteria | 10793 |
| 114 | Ga0105249_10007686 | 3300009553 | Bacteria | 9394 |
| 115 | Ga0105249_10021036 | 3300009553 | Bacteria | 5839 |
| 116 | Ga0105239_10145477 | 3300010375 | Bacteria | 2643 |
| 117 | Ga0105246_10022407 | 3300011119 | Bacteria | 4075 |
| 118 | Ga0105246_10257089 | 3300011119 | Bacteria | 1389 |
| 119 | Ga0157373_10111198 | 3300013100 | Bacteria | 1926 |
| 120 | Ga0157373_10117807 | 3300013100 | Bacteria | 1867 |
| 121 | Ga0157370_10190460 | 3300013104 | Bacteria | 1904 |
| 122 | Ga0157369_10380573 | 3300013105 | Bacteria | 1465 |
| 123 | Ga0157378_10336198 | 3300013297 | Bacteria | 1471 |
| 124 | Ga0163162_10062954 | 3300013306 | Bacteria | 3751 |
| 125 | Ga0163162_10091423 | 3300013306 | Bacteria | 3126 |
| 126 | Ga0157372_10001096 | 3300013307 | Bacteria | 29445 |
| 127 | Ga0157372_10197067 | 3300013307 | Bacteria | 2333 |
| 128 | Ga0157375_10100053 | 3300013308 | Bacteria | 2979 |
| 129 | Ga0157375_10137410 | 3300013308 | Bacteria | 2569 |
| 130 | Ga0157380_10002565 | 3300014326 | Bacteria | 12277 |
| 131 | Ga0157377_10014064 | 3300014745 | Bacteria | 4066 |
| 132 | Ga0157379_10020322 | 3300014968 | Bacteria | 5871 |
| 133 | Ga0163161_10071777 | 3300017792 | Bacteria | 2534 |
| 134 | Ga0209148_1002418 | 3300025254 | Bacteria | 6469 |
| 135 | Ga0209051_1001059 | 3300025303 | Bacteria | 25694 |
| 136 | Ga0207697_10003206 | 3300025315 | Bacteria | 8140 |
| 137 | Ga0207697_10069740 | 3300025315 | Bacteria | 1472 |
| 138 | Ga0207655_1003273 | 3300025728 | Bacteria | 12152 |
| 139 | Ga0207655_1016369 | 3300025728 | Bacteria | 4060 |
| 140 | Ga0207713_1020629 | 3300025735 | Bacteria | 3186 |
| 141 | Ga0207688_10126378 | 3300025901 | Bacteria | 1495 |
| 142 | Ga0207680_10172591 | 3300025903 | Bacteria | 1457 |
| 143 | Ga0207645_10001551 | 3300025907 | Bacteria | 18790 |
| 144 | Ga0207643_10004998 | 3300025908 | Bacteria | 7100 |
| 145 | Ga0207684_10001115 | 3300025910 | Bacteria | 30012 |
| 146 | Ga0207707_10048550 | 3300025912 | Bacteria | 3697 |
| 147 | Ga0207663_10050603 | 3300025916 | Bacteria | 2583 |
| 148 | Ga0207660_10000304 | 3300025917 | Bacteria | 32299 |
| 149 | Ga0207660_10011832 | 3300025917 | Bacteria | 5689 |
| 150 | Ga0207660_10014370 | 3300025917 | Bacteria | 5205 |
| 151 | Ga0207662_10000895 | 3300025918 | Bacteria | 13798 |
| 152 | Ga0207657_10319102 | 3300025919 | Bacteria | 1229 |
| 153 | Ga0207649_10008260 | 3300025920 | Bacteria | 5672 |
| 154 | Ga0207652_10053792 | 3300025921 | Bacteria | 3458 |
| 155 | Ga0207646_10020147 | 3300025922 | Bacteria | 6184 |
| 156 | Ga0207646_10026837 | 3300025922 | Bacteria | 5252 |
| 157 | Ga0207681_10006154 | 3300025923 | Bacteria | 7363 |
| 158 | Ga0207681_10019971 | 3300025923 | Bacteria | 4243 |
| 159 | Ga0207650_10020174 | 3300025925 | Bacteria | 4697 |
| 160 | Ga0207650_10090997 | 3300025925 | Bacteria | 2330 |
| 161 | Ga0207650_10093287 | 3300025925 | Bacteria | 2304 |
| 162 | Ga0207659_10013444 | 3300025926 | Bacteria | 5243 |
| 163 | Ga0207659_10205680 | 3300025926 | Bacteria | 1575 |
| 164 | Ga0207659_10226396 | 3300025926 | Bacteria | 1506 |
| 165 | Ga0207687_10020976 | 3300025927 | Bacteria | 4338 |
| 166 | Ga0207690_10098392 | 3300025932 | Bacteria | 2084 |
| 167 | Ga0207706_10007871 | 3300025933 | Bacteria | 9837 |
| 168 | Ga0207706_10173369 | 3300025933 | Bacteria | 1895 |
| 169 | Ga0207709_10042513 | 3300025935 | Bacteria | 2734 |
| 170 | Ga0207670_10072768 | 3300025936 | Bacteria | 2381 |
| 171 | Ga0207665_10006830 | 3300025939 | Bacteria | 7558 |
| 172 | Ga0207691_10001197 | 3300025940 | Bacteria | 25809 |
| 173 | Ga0207691_10001754 | 3300025940 | Bacteria | 21343 |
| 174 | Ga0207691_10002104 | 3300025940 | Bacteria | 19455 |
| 175 | Ga0207691_10063064 | 3300025940 | Bacteria | 3362 |
| 176 | Ga0207691_10145536 | 3300025940 | Bacteria | 2086 |
| 177 | Ga0207689_10002145 | 3300025942 | Bacteria | 18560 |
| 178 | Ga0207661_10019112 | 3300025944 | Bacteria | 5101 |
| 179 | Ga0207661_10061125 | 3300025944 | Bacteria | 3042 |
| 180 | Ga0207679_10124036 | 3300025945 | Bacteria | 2061 |
| 181 | Ga0207651_10024793 | 3300025960 | Bacteria | 3717 |
| 182 | Ga0207712_10192015 | 3300025961 | Bacteria | 1613 |
| 183 | Ga0207658_10069279 | 3300025986 | Bacteria | 2665 |
| 184 | Ga0207658_10213358 | 3300025986 | Bacteria | 1619 |
| 185 | Ga0207703_10029778 | 3300026035 | Bacteria | 4310 |
| 186 | Ga0207639_10284475 | 3300026041 | Bacteria | 1455 |
| 187 | Ga0207678_10011372 | 3300026067 | Bacteria | 7812 |
| 188 | Ga0207708_10034965 | 3300026075 | Bacteria | 3823 |
| 189 | Ga0207641_10357452 | 3300026088 | Bacteria | 1393 |
| 190 | Ga0207648_10041715 | 3300026089 | Bacteria | 4030 |
| 191 | Ga0207648_10092988 | 3300026089 | Bacteria | 2637 |
| 192 | Ga0207648_10461982 | 3300026089 | Bacteria | 1157 |
| 193 | Ga0207676_10393995 | 3300026095 | Bacteria | 1292 |
| 194 | Ga0207674_10001522 | 3300026116 | Bacteria | 29897 |
| 195 | Ga0207674_10005831 | 3300026116 | Bacteria | 14611 |
| 196 | Ga0207674_10008554 | 3300026116 | Bacteria | 11804 |
| 197 | Ga0207674_10034101 | 3300026116 | Bacteria | 5323 |
| 198 | Ga0207675_100001248 | 3300026118 | Bacteria | 25348 |
| 199 | Ga0207675_100015190 | 3300026118 | Bacteria | 7182 |
| 200 | Ga0207675_100207967 | 3300026118 | Bacteria | 1881 |
| 201 | Ga0207683_10004789 | 3300026121 | Bacteria | 11653 |
| 202 | Ga0209813_10006882 | 3300027866 | Bacteria | 2820 |
| 203 | Ga0207428_10004464 | 3300027907 | Bacteria | 13277 |
| 204 | Ga0207428_10061589 | 3300027907 | Bacteria | 2970 |
| 205 | Ga0265356_1000729 | 3300028017 | Bacteria | 5604 |
| 206 | Ga0268266_10052579 | 3300028379 | Bacteria | 3498 |
| 207 | Ga0268265_10013903 | 3300028380 | Bacteria | 5478 |
| 208 | Ga0265762_1006010 | 3300030760 | Bacteria | 2175 |
| 209 | Ga0265770_1002881 | 3300030878 | Bacteria | 2336 |
| 210 | Ga0307408_100018456 | 3300031548 | Bacteria | 4683 |
| 211 | Ga0307408_100020790 | 3300031548 | Bacteria | 4434 |
| 212 | Ga0307408_100027372 | 3300031548 | Bacteria | 3928 |
| 213 | Ga0307408_100066848 | 3300031548 | Bacteria | 2641 |
| 214 | Ga0307408_100068862 | 3300031548 | Bacteria | 2607 |
| 215 | Ga0307408_100206828 | 3300031548 | Bacteria | 1592 |
| 216 | Ga0307408_100230171 | 3300031548 | Bacteria | 1517 |
| 217 | Ga0307405_10085589 | 3300031731 | Bacteria | 2073 |
| 218 | Ga0307405_10124980 | 3300031731 | Bacteria | 1767 |
| 219 | Ga0307405_10301086 | 3300031731 | Bacteria | 1216 |
| 220 | Ga0307413_10011048 | 3300031824 | Bacteria | 4417 |
| 221 | Ga0307413_10027133 | 3300031824 | Bacteria | 3168 |
| 222 | Ga0307413_10034125 | 3300031824 | Bacteria | 2905 |
| 223 | Ga0307413_10036773 | 3300031824 | Bacteria | 2822 |
| 224 | Ga0307413_10047162 | 3300031824 | Bacteria | 2567 |
| 225 | Ga0307413_10163980 | 3300031824 | Bacteria | 1564 |
| 226 | Ga0307413_10180901 | 3300031824 | Bacteria | 1503 |
| 227 | Ga0307410_10000891 | 3300031852 | Bacteria | 12759 |
| 228 | Ga0307410_10007769 | 3300031852 | Bacteria | 5896 |
| 229 | Ga0307410_10015110 | 3300031852 | Bacteria | 4569 |
| 230 | Ga0307410_10031328 | 3300031852 | Bacteria | 3411 |
| 231 | Ga0307410_10057796 | 3300031852 | Bacteria | 2642 |
| 232 | Ga0307410_10107933 | 3300031852 | Bacteria | 2009 |
| 233 | Ga0307410_10118971 | 3300031852 | Bacteria | 1923 |
| 234 | Ga0307410_10166648 | 3300031852 | Bacteria | 1656 |
| 235 | Ga0307406_10232419 | 3300031901 | Bacteria | 1378 |
| 236 | Ga0307407_10035796 | 3300031903 | Bacteria | 2730 |
| 237 | Ga0307407_10066364 | 3300031903 | Bacteria | 2128 |
| 238 | Ga0307407_10067257 | 3300031903 | Bacteria | 2117 |
| 239 | Ga0307407_10072387 | 3300031903 | Bacteria | 2055 |
| 240 | Ga0307407_10076473 | 3300031903 | Bacteria | 2010 |
| 241 | Ga0307412_10003144 | 3300031911 | Bacteria | 9170 |
| 242 | Ga0307412_10007304 | 3300031911 | Bacteria | 6265 |
| 243 | Ga0307412_10025276 | 3300031911 | Bacteria | 3677 |
| 244 | Ga0307412_10028450 | 3300031911 | Bacteria | 3496 |
| 245 | Ga0307412_10035454 | 3300031911 | Bacteria | 3188 |
| 246 | Ga0307412_10125226 | 3300031911 | Bacteria | 1857 |
| 247 | Ga0307409_100003245 | 3300031995 | Bacteria | 8768 |
| 248 | Ga0307409_100006409 | 3300031995 | Bacteria | 6914 |
| 249 | Ga0307409_100043508 | 3300031995 | Bacteria | 3373 |
| 250 | Ga0307409_100191137 | 3300031995 | Bacteria | 1822 |
| 251 | Ga0307409_100326895 | 3300031995 | Bacteria | 1437 |
| 252 | Ga0307416_100000951 | 3300032002 | Bacteria | 15337 |
| 253 | Ga0307416_100012801 | 3300032002 | Bacteria | 5672 |
| 254 | Ga0307416_100039375 | 3300032002 | Bacteria | 3658 |
| 255 | Ga0307416_100066039 | 3300032002 | Bacteria | 2976 |
| 256 | Ga0307416_100097442 | 3300032002 | Bacteria | 2547 |
| 257 | Ga0307416_100126359 | 3300032002 | Bacteria | 2291 |
| 258 | Ga0307416_100177560 | 3300032002 | Bacteria | 1992 |
| 259 | Ga0307414_10005890 | 3300032004 | Bacteria | 6784 |
| 260 | Ga0307411_10052364 | 3300032005 | Bacteria | 2668 |
| 261 | Ga0307411_10267194 | 3300032005 | Bacteria | 1354 |
| 262 | Ga0307415_100056131 | 3300032126 | Bacteria | 2698 |
| 263 | Ga0307415_100230390 | 3300032126 | Bacteria | 1491 |
| 264 | Ga0373934_0006929 | 3300035086 | Bacteria | 4207 |
| 265 | Ga0373954_0089323 | 3300035118 | Bacteria | 1479 |
| 266 | Ga0373955_0023953 | 3300035172 | Bacteria | 3115 |
| 267 | Ga0373935_0055735 | 3300035692 | Bacteria | 2519 |
| 268 | Ga0373927_0041181 | 3300035695 | Bacteria | 2996 |
| 269 | Ga0373933_0003538 | 3300035724 | Bacteria | 8687 |
| 270 | Ga0373933_0010287 | 3300035724 | Bacteria | 5125 |
| 271 | Ga0373937_0000108 | 3300036401 | Bacteria | 79022 |
| 272 | Ga0395899_0050211 | 3300037312 | Bacteria | 3098 |
| 273 | Ga0395900_0079661 | 3300037418 | Bacteria | 3366 |
| 274 | Ga0395900_0153629 | 3300037418 | Bacteria | 2351 |
| 275 | Ga0395900_0383833 | 3300037418 | Bacteria | 1372 |
| 276 | Ga0395898_0232453 | 3300037466 | Bacteria | 1758 |
| 277 | Ga0395905_0041526 | 3300037471 | Bacteria | 4316 |
| 278 | Ga0395905_0055628 | 3300037471 | Bacteria | 3703 |
| 279 | Ga0395901_0006835 | 3300038443 | Bacteria | 11523 |
| 280 | Ga0395901_0011818 | 3300038443 | Bacteria | 8852 |
| 281 | Ga0395901_0014073 | 3300038443 | Bacteria | 8145 |
| 282 | Ga0237819_04826 | 3300038705 | Bacteria | 2170 |
| 283 | Ga0439436_0014972 | 3300041404 | Bacteria | 2335 |
| 284 | Ga0439438_006345 | 3300041405 | Bacteria | 4188 |
| 285 | Ga0439439_0004825 | 3300041406 | Bacteria | 3053 |
| 286 | Ga0439447_009447 | 3300041407 | Bacteria | 2955 |
| 287 | Ga0439466_0002272 | 3300041411 | Bacteria | 7532 |
| 288 | Ga0439433_0000043 | 3300041999 | Bacteria | 15638 |
| 289 | Ga0439442_000001 | 3300042002 | Bacteria | 161142 |
| 290 | Ga0439442_000443 | 3300042002 | Bacteria | 9395 |
| 291 | Ga0439442_000690 | 3300042002 | Bacteria | 7134 |
| 292 | Ga0439442_001587 | 3300042002 | Bacteria | 4457 |
| 293 | Ga0439432_026732 | 3300042006 | Bacteria | 1888 |
| 294 | Ga0439449_0001126 | 3300042007 | Bacteria | 10485 |
| 295 | Ga0439457_007610 | 3300042014 | Bacteria | 2594 |
| 296 | Ga0439462_0005436 | 3300042015 | Bacteria | 3141 |
| 297 | Ga0439462_0008949 | 3300042015 | Bacteria | 2532 |
| 298 | Ga0450919_001112 | 3300042121 | Bacteria | 3486 |
| 299 | Ga0450920_002024 | 3300042122 | Bacteria | 3426 |
| 300 | Ga0450920_008613 | 3300042122 | Bacteria | 1867 |
| 301 | Ga0450923_006512 | 3300042125 | Bacteria | 1941 |
| 302 | Ga0450894_005848 | 3300042131 | Bacteria | 1593 |
| 303 | Ga0450896_008164 | 3300042133 | Bacteria | 1451 |
| 304 | Ga0450906_011753 | 3300042145 | Bacteria | 1632 |
| 305 | Ga0450907_009573 | 3300042146 | Bacteria | 1606 |
| 306 | Ga0450908_012914 | 3300042184 | Bacteria | 1510 |
| 307 | Ga0439434_0000694 | 3300042435 | Bacteria | 9709 |
| 308 | Ga0439460_0065782 | 3300042461 | Bacteria | 1114 |
| 309 | Ga0450918_000313 | 3300042531 | Bacteria | 10871 |
| 310 | Ga0450918_001240 | 3300042531 | Bacteria | 5183 |
| 311 | Ga0451577_0000371 | 3300042876 | Bacteria | 83783 |
| 312 | Ga0453684_0001367 | 3300044712 | Bacteria | 70807 |
| 313 | Ga0451576_0194324 | 3300045051 | Bacteria | 2119 |
| 314 | Ga0466967_0064275 | 3300045976 | Bacteria | 3263 |
| 315 | Ga0495592_0001227 | 3300046454 | Bacteria | 17791 |
| 316 | Ga0495629_0011406 | 3300046459 | Bacteria | 6455 |
| 317 | Ga0495638_0070449 | 3300046460 | Bacteria | 2141 |
| 318 | Ga0495651_0000661 | 3300046462 | Bacteria | 26738 |
| 319 | Ga0495653_0001029 | 3300046463 | Bacteria | 21492 |
| 320 | Ga0495653_0009391 | 3300046463 | Bacteria | 8005 |
| 321 | Ga0495580_0004947 | 3300046472 | Bacteria | 11140 |
| 322 | Ga0495580_0020572 | 3300046472 | Bacteria | 4882 |
| 323 | Ga0495580_0020636 | 3300046472 | Bacteria | 4873 |
| 324 | Ga0495582_0031325 | 3300046473 | Bacteria | 2923 |
| 325 | Ga0495582_0036119 | 3300046473 | Bacteria | 2718 |
| 326 | Ga0495582_0162742 | 3300046473 | Bacteria | 1269 |
| 327 | Ga0495639_0001140 | 3300046475 | Bacteria | 12001 |
| 328 | Ga0495639_0002884 | 3300046475 | Bacteria | 7482 |
| 329 | Ga0495662_0004919 | 3300046476 | Bacteria | 6689 |
| 330 | Ga0495664_0077753 | 3300046477 | Bacteria | 1987 |
| 331 | Ga0495608_0002135 | 3300046511 | Bacteria | 14265 |
| 332 | Ga0495618_0016016 | 3300046514 | Bacteria | 4579 |
| 333 | Ga0495618_0021896 | 3300046514 | Bacteria | 3944 |
| 334 | Ga0495630_0034476 | 3300046517 | Bacteria | 3779 |
| 335 | Ga0495630_0055978 | 3300046517 | Bacteria | 2955 |
| 336 | Ga0495643_0000055 | 3300046522 | Bacteria | 198641 |
| 337 | Ga0495643_0114886 | 3300046522 | Bacteria | 1365 |
| 338 | Ga0495652_0001763 | 3300046529 | Bacteria | 23231 |
| 339 | Ga0495665_0001181 | 3300046531 | Bacteria | 13905 |
| 340 | Ga0495640_0006334 | 3300046533 | Bacteria | 9380 |
| 341 | Ga0495586_0000411 | 3300046535 | Bacteria | 26021 |
| 342 | Ga0495586_0012810 | 3300046535 | Bacteria | 4444 |
| 343 | Ga0495587_0000339 | 3300046536 | Bacteria | 33290 |
| 344 | Ga0495587_0001102 | 3300046536 | Bacteria | 17749 |
| 345 | Ga0495645_0002611 | 3300046543 | Bacteria | 12254 |
| 346 | Ga0495645_0017213 | 3300046543 | Bacteria | 5177 |
| 347 | Ga0495667_0015499 | 3300046559 | Bacteria | 5150 |
| 348 | Ga0495668_0096458 | 3300046616 | Bacteria | 1618 |
| 349 | Ga0495634_0006327 | 3300046642 | Bacteria | 9011 |
| 350 | Ga0495635_0082462 | 3300046663 | Bacteria | 2201 |
| 351 | Ga0495588_0006643 | 3300046674 | Bacteria | 5221 |
| 352 | Ga0495588_0015748 | 3300046674 | Bacteria | 3645 |
| 353 | Ga0495588_0018893 | 3300046674 | Bacteria | 3368 |
| 354 | Ga0495657_0003526 | 3300046675 | Bacteria | 12759 |
| 355 | Ga0495657_0017190 | 3300046675 | Bacteria | 5255 |
| 356 | Ga0495599_0039291 | 3300046678 | Bacteria | 2973 |
| 357 | Ga0495646_0007201 | 3300046680 | Bacteria | 7066 |
| 358 | Ga0495658_0100718 | 3300046683 | Bacteria | 1724 |
| 359 | Ga0495600_0000804 | 3300046809 | Bacteria | 16637 |
| 360 | Ga0495600_0003882 | 3300046809 | Bacteria | 8871 |
| 361 | Ga0495581_0026131 | 3300047315 | Bacteria | 3386 |
| 362 | Ga0495604_0001130 | 3300047317 | Bacteria | 22166 |
| 363 | Ga0495604_0173109 | 3300047317 | Bacteria | 1516 |
| 364 | Ga0495636_0041988 | 3300047318 | Bacteria | 1899 |
| 365 | Ga0495674_0002947 | 3300047319 | Bacteria | 16544 |
| 366 | Ga0495674_0020145 | 3300047319 | Bacteria | 6180 |
| 367 | Ga0495680_0003949 | 3300047322 | Bacteria | 14338 |
| 368 | Ga0495680_0006062 | 3300047322 | Bacteria | 11299 |
| 369 | Ga0495675_0087403 | 3300047444 | Bacteria | 1958 |
| 370 | Ga0495677_0025730 | 3300047445 | Bacteria | 2135 |
| 371 | Ga0495684_0009337 | 3300047471 | Bacteria | 7571 |
| 372 | Ga0495684_0090830 | 3300047471 | Bacteria | 2313 |
| 373 | Ga0495684_0102946 | 3300047471 | Bacteria | 2158 |
| 374 | Ga0495593_0085783 | 3300047673 | Bacteria | 1624 |
| 375 | Ga0495602_0076194 | 3300048088 | Bacteria | 2843 |
| 376 | Ga0496100_0006908 | 3300048903 | Bacteria | 6218 |
| 377 | Ga0496101_0017951 | 3300048904 | Bacteria | 4803 |
| 378 | Ga0496102_0041055 | 3300048905 | Bacteria | 4188 |
| 379 | Ga0496103_0004538 | 3300048906 | Bacteria | 8405 |
| 380 | Ga0496103_0005094 | 3300048906 | Bacteria | 7917 |
| 381 | Ga0496104_0227982 | 3300048907 | Bacteria | 1775 |
| 382 | Ga0496106_0010066 | 3300048909 | Bacteria | 6983 |
| 383 | Ga0496107_0116055 | 3300048910 | Bacteria | 1970 |
| 384 | Ga0496107_0154171 | 3300048910 | Bacteria | 1700 |
| 385 | Ga0496110_0254765 | 3300048913 | Bacteria | 1597 |
| 386 | Ga0496111_0015429 | 3300048914 | Bacteria | 5243 |
| 387 | Ga0496111_0029392 | 3300048914 | Bacteria | 3903 |
| 388 | Ga0496112_0016131 | 3300048915 | Bacteria | 6986 |
| 389 | Ga0496112_0029582 | 3300048915 | Bacteria | 5297 |
| 390 | Ga0496113_0128338 | 3300048916 | Bacteria | 1987 |
| 391 | Ga0496114_0096775 | 3300048917 | Bacteria | 2513 |
| 392 | Ga0496117_0004226 | 3300048920 | Bacteria | 16032 |
| 393 | Ga0496119_0083560 | 3300048922 | Bacteria | 1833 |
| 394 | Ga0496124_0108561 | 3300048927 | Bacteria | 2238 |
| 395 | Ga0501032_0000135 | 3300049569 | Bacteria | 60174 |
| 396 | Ga0501032_0017363 | 3300049569 | Bacteria | 5052 |
| 397 | Ga0501032_0201951 | 3300049569 | Bacteria | 1297 |
| 398 | Ga0501034_0000505 | 3300049571 | Bacteria | 62933 |
| 399 | Ga0501034_0001470 | 3300049571 | Bacteria | 31214 |
| 400 | Ga0501034_0258854 | 3300049571 | Bacteria | 1683 |
| 401 | Ga0501034_0277467 | 3300049571 | Bacteria | 1616 |
| 402 | Ga0501037_0003634 | 3300049573 | Bacteria | 11187 |
| 403 | Ga0501037_0003810 | 3300049573 | Bacteria | 10943 |
| 404 | Ga0501037_0104021 | 3300049573 | Bacteria | 2048 |
| 405 | Ga0501039_0029292 | 3300049575 | Bacteria | 4239 |
| 406 | Ga0501039_0182444 | 3300049575 | Bacteria | 1650 |
| 407 | Ga0501043_0013013 | 3300049579 | Bacteria | 6504 |
| 408 | Ga0501043_0078812 | 3300049579 | Bacteria | 2588 |
| 409 | Ga0501046_0006597 | 3300049580 | Bacteria | 10252 |
| 410 | Ga0501070_0125955 | 3300049586 | Bacteria | 2117 |
| 411 | Ga0501073_0008651 | 3300049589 | Bacteria | 7542 |
| 412 | Ga0501073_0093556 | 3300049589 | Bacteria | 2088 |
| 413 | Ga0501074_0033894 | 3300049590 | Bacteria | 3702 |
| 414 | Ga0501076_0106057 | 3300049592 | Bacteria | 2268 |
| 415 | Ga0501221_022271 | 3300049704 | Bacteria | 1255 |
| 416 | Ga0501044_0024288 | 3300049823 | Bacteria | 6438 |
| 417 | nmdc:mga03683_66638_c1 | 3300050489 | Bacteria | 1531 |
| 418 | nmdc:mga04h51_3997_c1 | 3300050495 | Bacteria | 3630 |
| 419 | nmdc:mga05p37_115938_c1 | 3300050507 | Bacteria | 3293 |
| 420 | nmdc:mga05p37_229942_c1 | 3300050507 | Bacteria | 2235 |
| 421 | nmdc:mga05p37_29940_c1 | 3300050507 | Bacteria | 6644 |
| 422 | nmdc:mga09592_111515_c1 | 3300050508 | Bacteria | 2347 |
| 423 | nmdc:mga09592_126468_c1 | 3300050508 | Bacteria | 2197 |
| 424 | nmdc:mga0qj67_14306_c1 | 3300050509 | Bacteria | 5997 |
| 425 | nmdc:mga0qj67_29450_c1 | 3300050509 | Bacteria | 4265 |
| 426 | nmdc:mga0qj67_31026_c1 | 3300050509 | Bacteria | 4162 |
| 427 | nmdc:mga0qj67_46602_c1 | 3300050509 | Bacteria | 3423 |
| 428 | nmdc:mga06r32_310367_c1 | 3300050510 | Bacteria | 1563 |
| 429 | nmdc:mga06r32_388880_c1 | 3300050510 | Bacteria | 1377 |
| 430 | nmdc:mga06r32_66431_c1 | 3300050510 | Bacteria | 3480 |
| 431 | nmdc:mga08y16_220802_c1 | 3300050511 | Bacteria | 1962 |
| 432 | nmdc:mga0n895_731_c1 | 3300050512 | Bacteria | 23143 |
| 433 | nmdc:mga08x19_65740_c1 | 3300050514 | Bacteria | 2356 |
| 434 | nmdc:mga0a205_70314_c1 | 3300050515 | Bacteria | 3379 |
| 435 | nmdc:mga0a205_71339_c1 | 3300050515 | Bacteria | 3355 |
| 436 | nmdc:mga0sz30_4324_c1 | 3300050516 | Bacteria | 5125 |
| 437 | Ga0495601_0007779 | 3300053077 | Bacteria | 6302 |
| 438 | Ga0495612_0001641 | 3300053078 | Bacteria | 9209 |
| 439 | Ga0495595_0001088 | 3300053084 | Bacteria | 10514 |
| 440 | Ga0495619_0003278 | 3300053085 | Bacteria | 10467 |
| 441 | Ga0500556_0000708 | 3300053104 | Bacteria | 20232 |
| 442 | Ga0500628_000763 | 3300053129 | Bacteria | 5745 |
| 443 | Ga0500559_0001070 | 3300053136 | Bacteria | 16616 |
| 444 | Ga0500559_0002433 | 3300053136 | Bacteria | 9636 |
| 445 | Ga0500559_0006478 | 3300053136 | Bacteria | 5285 |
| 446 | Ga0500616_0000076 | 3300053153 | Bacteria | 216836 |
| 447 | Ga0590075_030064 | 3300059424 | Bacteria | 1375 |
| 448 | 2523387789 | 2523231044 | Bacteria | 6434991 |
| 449 | 2643874956 | 2643221572 | Bacteria | 3614809 |
| 450 | 2644382012 | 2643221669 | Bacteria | 3611286 |
| 451 | 2691514630 | 2690315906 | Bacteria | 4517044 |
| 452 | 2775655032 | 2775506735 | Bacteria | 4556596 |
| 453 | 2808827743 | 2808606357 | Bacteria | 4466944 |
| 454 | 2808853097 | 2808606360 | Bacteria | 4404006 |
| 455 | 2808878401 | 2808606366 | Bacteria | 4415912 |
| 456 | 2808891986 | 2808606370 | Bacteria | 4942454 |
| 457 | 2808897080 | 2808606371 | Bacteria | 4251511 |
| 458 | 2812320494 | 2811994871 | Bacteria | 4497550 |
| 459 | 2844855155 | 2844852863 | Bacteria | 3849151 |
| 460 | 2852678509 | 2852677369 | Bacteria | 3768884 |
| 461 | 2895661048 | 2895660088 | Bacteria | 3782833 |
| 462 | 2904499760 | 2904497146 | Bacteria | 4731781 |
| 463 | 2904776683 | 2904776348 | Bacteria | 4658726 |
| 464 | 2910812393 | 2910809715 | Bacteria | 4982797 |
| 465 | 2919036232 | 2919034639 | Bacteria | 4763403 |
| 466 | 2919061655 | 2919059106 | Bacteria | 4991624 |
| 467 | 2919391488 | 2919391150 | Bacteria | 4884741 |
| 468 | 2919542207 | 2919538618 | Bacteria | 4677069 |
| 469 | 2932429277 | 2932426870 | Bacteria | 4547726 |
| 470 | 2933420760 | 2933418574 | Bacteria | 4476724 |
| 471 | 2939648821 | 2939647034 | Bacteria | 4681660 |
| 472 | 2939676026 | 2939674588 | Bacteria | 4844420 |
| 473 | 2945918253 | 2945916053 | Bacteria | 4555517 |
| 474 | 2945921460 | 2945920336 | Bacteria | 4501603 |
| 475 | 2945942355 | 2945941187 | Bacteria | 4682474 |
| 476 | 2945959880 | 2945956166 | Bacteria | 5110334 |
| 477 | 2946038300 | 2946037020 | Bacteria | 4900426 |
| 478 | 2946062104 | 2946059875 | Bacteria | 4386623 |
| 479 | 2953999575 | 2953998280 | Bacteria | 4812144 |
| 480 | 2974306286 | 2974302888 | Bacteria | 4369871 |
| 481 | 8054110995 | 8054107350 | Bacteria | 5022511 |
| 482 | 8057349208 | 8057345674 | Bacteria | 4160394 |
| 483 | Ga0207668_10018129 | |||
| 484 | LJQas_1000534 | |||
| 485 | Ga0055542_1007539 | |||
| 486 | Ga0065165_1000879 | |||
| 487 | Ga0065714_10013025 | |||
| 488 | Ga0070676_10016152 | |||
| 489 | Ga0070683_100002646 | |||
| 490 | Ga0070683_100025439 | |||
| 491 | Ga0070683_100035639 | |||
| 492 | Ga0070670_100010118 | |||
| 493 | Ga0070670_100026039 | |||
| 494 | Ga0070670_100044748 | |||
| 495 | Ga0070680_100000417 | |||
| 496 | Ga0070680_100047085 | |||
| 497 | Ga0070660_100048512 | |||
| 498 | Ga0070687_100009638 | |||
| 499 | Ga0070661_100002688 | |||
| 500 | Ga0070661_100066424 | |||
| 501 | Ga0070668_100007638 | |||
| 502 | Ga0070668_100020012 | |||
| 503 | Ga0070669_100002967 | |||
| 504 | Ga0070675_100018309 | |||
| 505 | Ga0070675_100318683 | |||
| 506 | Ga0070671_100133771 | |||
| 507 | Ga0070673_100039405 | |||
| 508 | Ga0070673_100122960 | |||
| 509 | Ga0070667_100113617 | |||
| 510 | Ga0070709_10080038 | |||
| 511 | Ga0070701_10020050 | |||
| 512 | Ga0070701_10057808 | |||
| 513 | Ga0070711_100086122 | |||
| 514 | Ga0070694_100157972 | |||
| 515 | Ga0070708_100042212 | |||
| 516 | Ga0070662_100028007 | |||
| 517 | Ga0070662_100093993 | |||
| 518 | Ga0070681_10008844 | |||
| 519 | Ga0070681_10076202 | |||
| 520 | Ga0070685_10013350 | |||
| 521 | Ga0070707_100039515 | |||
| 522 | Ga0070707_100479442 | |||
| 523 | Ga0070699_100198328 | |||
| 524 | Ga0070699_100410249 | |||
| 525 | Ga0070684_100009021 | |||
| 526 | Ga0070684_100036343 | |||
| 527 | Ga0068853_100126709 | |||
| 528 | Ga0070672_100009308 | |||
| 529 | Ga0070672_100010998 | |||
| 530 | Ga0070672_100016090 | |||
| 531 | Ga0070672_100103862 | |||
| 532 | Ga0070686_100062171 | |||
| 533 | Ga0070695_100207052 | |||
| 534 | Ga0070695_100268662 | |||
| 535 | Ga0070665_100043810 | |||
| 536 | Ga0070665_100123444 | |||
| 537 | Ga0070704_100138617 | |||
| 538 | Ga0070704_100176532 | |||
| 539 | Ga0070664_100014332 | |||
| 540 | Ga0070664_100044780 | |||
| 541 | Ga0070664_100047397 | |||
| 542 | Ga0068857_100003492 | |||
| 543 | Ga0068857_100010297 | |||
| 544 | Ga0068857_100031686 | |||
| 545 | Ga0068856_100164886 | |||
| 546 | Ga0070702_100168652 | |||
| 547 | Ga0068859_100012802 | |||
| 548 | Ga0068859_100099874 | |||
| 549 | Ga0068864_100036063 | |||
| 550 | Ga0068866_10090987 | |||
| 551 | Ga0068861_100023507 | |||
| 552 | Ga0068861_100196970 | |||
| 553 | Ga0068851_10003869 | |||
| 554 | Ga0068851_10020371 | |||
| 555 | Ga0068870_10021341 | |||
| 556 | Ga0068863_100073511 | |||
| 557 | Ga0068862_100018635 | |||
| 558 | Ga0070717_10114807 | |||
| 559 | Ga0075365_10001955 | |||
| 560 | Ga0075368_10009902 | |||
| 561 | Ga0075363_100028584 | |||
| 562 | Ga0075364_10008718 | |||
| 563 | Ga0075432_10003827 | |||
| 564 | Ga0075362_10036169 | |||
| 565 | Ga0075367_10004292 | |||
| 566 | Ga0075369_10004310 | |||
| 567 | Ga0075428_100060723 | |||
| 568 | Ga0075430_100005360 | |||
| 569 | Ga0075430_100019818 | |||
| 570 | Ga0075430_100039636 | |||
| 571 | Ga0075430_100094761 | |||
| 572 | Ga0075431_100005540 | |||
| 573 | Ga0075431_100358924 | |||
| 574 | Ga0075433_10013611 | |||
| 575 | Ga0075433_10050814 | |||
| 576 | Ga0075433_10182036 | |||
| 577 | Ga0075434_100064066 | |||
| 578 | Ga0075429_100167201 | |||
| 579 | Ga0075429_100329015 | |||
| 580 | Ga0068865_100010513 | |||
| 581 | Ga0075436_100066943 | |||
| 582 | Ga0097620_100012802 | |||
| 583 | Ga0105244_10022100 | |||
| 584 | Ga0105244_10041676 | |||
| 585 | Ga0111539_10234543 | |||
| 586 | Ga0105245_10021458 | |||
| 587 | Ga0105245_10078923 | |||
| 588 | Ga0114129_10060130 | |||
| 589 | Ga0114129_10082331 | |||
| 590 | Ga0114129_10273720 | |||
| 591 | Ga0105243_10201942 | |||
| 592 | Ga0105248_10010867 | |||
| 593 | Ga0105248_10204011 | |||
| 594 | Ga0105237_10105212 | |||
| 595 | Ga0105238_10007670 | |||
| 596 | Ga0105249_10007686 | |||
| 597 | Ga0105249_10021036 | |||
| 598 | Ga0105239_10145477 | |||
| 599 | Ga0105246_10022407 | |||
| 600 | Ga0105246_10257089 | |||
| 601 | Ga0157373_10111198 | |||
| 602 | Ga0157373_10117807 | |||
| 603 | Ga0157370_10190460 | |||
| 604 | Ga0157369_10380573 | |||
| 605 | Ga0157378_10336198 | |||
| 606 | Ga0163162_10062954 | |||
| 607 | Ga0163162_10091423 | |||
| 608 | Ga0157372_10001096 | |||
| 609 | Ga0157372_10197067 | |||
| 610 | Ga0157375_10100053 | |||
| 611 | Ga0157375_10137410 | |||
| 612 | Ga0157380_10002565 | |||
| 613 | Ga0157377_10014064 | |||
| 614 | Ga0157379_10020322 | |||
| 615 | Ga0163161_10071777 | |||
| 616 | Ga0209148_1002418 | |||
| 617 | Ga0209051_1001059 | |||
| 618 | Ga0207697_10003206 | |||
| 619 | Ga0207697_10069740 | |||
| 620 | Ga0207655_1003273 | |||
| 621 | Ga0207655_1016369 | |||
| 622 | Ga0207713_1020629 | |||
| 623 | Ga0207688_10126378 | |||
| 624 | Ga0207680_10172591 | |||
| 625 | Ga0207645_10001551 | |||
| 626 | Ga0207643_10004998 | |||
| 627 | Ga0207684_10001115 | |||
| 628 | Ga0207707_10048550 | |||
| 629 | Ga0207663_10050603 | |||
| 630 | Ga0207660_10000304 | |||
| 631 | Ga0207660_10011832 | |||
| 632 | Ga0207660_10014370 | |||
| 633 | Ga0207662_10000895 | |||
| 634 | Ga0207657_10319102 | |||
| 635 | Ga0207649_10008260 | |||
| 636 | Ga0207652_10053792 | |||
| 637 | Ga0207646_10020147 | |||
| 638 | Ga0207646_10026837 | |||
| 639 | Ga0207681_10006154 | |||
| 640 | Ga0207681_10019971 | |||
| 641 | Ga0207650_10020174 | |||
| 642 | Ga0207650_10090997 | |||
| 643 | Ga0207650_10093287 | |||
| 644 | Ga0207659_10013444 | |||
| 645 | Ga0207659_10205680 | |||
| 646 | Ga0207659_10226396 | |||
| 647 | Ga0207687_10020976 | |||
| 648 | Ga0207690_10098392 | |||
| 649 | Ga0207706_10007871 | |||
| 650 | Ga0207706_10173369 | |||
| 651 | Ga0207709_10042513 | |||
| 652 | Ga0207670_10072768 | |||
| 653 | Ga0207665_10006830 | |||
| 654 | Ga0207691_10001197 | |||
| 655 | Ga0207691_10001754 | |||
| 656 | Ga0207691_10002104 | |||
| 657 | Ga0207691_10063064 | |||
| 658 | Ga0207691_10145536 | |||
| 659 | Ga0207689_10002145 | |||
| 660 | Ga0207661_10019112 | |||
| 661 | Ga0207661_10061125 | |||
| 662 | Ga0207679_10124036 | |||
| 663 | Ga0207651_10024793 | |||
| 664 | Ga0207712_10192015 | |||
| 665 | Ga0207658_10069279 | |||
| 666 | Ga0207658_10213358 | |||
| 667 | Ga0207703_10029778 | |||
| 668 | Ga0207639_10284475 | |||
| 669 | Ga0207678_10011372 | |||
| 670 | Ga0207708_10034965 | |||
| 671 | Ga0207641_10357452 | |||
| 672 | Ga0207648_10041715 | |||
| 673 | Ga0207648_10092988 | |||
| 674 | Ga0207648_10461982 | |||
| 675 | Ga0207676_10393995 | |||
| 676 | Ga0207674_10001522 | |||
| 677 | Ga0207674_10005831 | |||
| 678 | Ga0207674_10008554 | |||
| 679 | Ga0207674_10034101 | |||
| 680 | Ga0207675_100001248 | |||
| 681 | Ga0207675_100015190 | |||
| 682 | Ga0207675_100207967 | |||
| 683 | Ga0207683_10004789 | |||
| 684 | Ga0209813_10006882 | |||
| 685 | Ga0207428_10004464 | |||
| 686 | Ga0207428_10061589 | |||
| 687 | Ga0265356_1000729 | |||
| 688 | Ga0268266_10052579 | |||
| 689 | Ga0268265_10013903 | |||
| 690 | Ga0265762_1006010 | |||
| 691 | Ga0265770_1002881 | |||
| 692 | Ga0307408_100018456 | |||
| 693 | Ga0307408_100020790 | |||
| 694 | Ga0307408_100027372 | |||
| 695 | Ga0307408_100066848 | |||
| 696 | Ga0307408_100068862 | |||
| 697 | Ga0307408_100206828 | |||
| 698 | Ga0307408_100230171 | |||
| 699 | Ga0307405_10085589 | |||
| 700 | Ga0307405_10124980 | |||
| 701 | Ga0307405_10301086 | |||
| 702 | Ga0307413_10011048 | |||
| 703 | Ga0307413_10027133 | |||
| 704 | Ga0307413_10034125 | |||
| 705 | Ga0307413_10036773 | |||
| 706 | Ga0307413_10047162 | |||
| 707 | Ga0307413_10163980 | |||
| 708 | Ga0307413_10180901 | |||
| 709 | Ga0307410_10000891 | |||
| 710 | Ga0307410_10007769 | |||
| 711 | Ga0307410_10015110 | |||
| 712 | Ga0307410_10031328 | |||
| 713 | Ga0307410_10057796 | |||
| 714 | Ga0307410_10107933 | |||
| 715 | Ga0307410_10118971 | |||
| 716 | Ga0307410_10166648 | |||
| 717 | Ga0307406_10232419 | |||
| 718 | Ga0307407_10035796 | |||
| 719 | Ga0307407_10066364 | |||
| 720 | Ga0307407_10067257 | |||
| 721 | Ga0307407_10072387 | |||
| 722 | Ga0307407_10076473 | |||
| 723 | Ga0307412_10003144 | |||
| 724 | Ga0307412_10007304 | |||
| 725 | Ga0307412_10025276 | |||
| 726 | Ga0307412_10028450 | |||
| 727 | Ga0307412_10035454 | |||
| 728 | Ga0307412_10125226 | |||
| 729 | Ga0307409_100003245 | |||
| 730 | Ga0307409_100006409 | |||
| 731 | Ga0307409_100043508 | |||
| 732 | Ga0307409_100191137 | |||
| 733 | Ga0307409_100326895 | |||
| 734 | Ga0307416_100000951 | |||
| 735 | Ga0307416_100012801 | |||
| 736 | Ga0307416_100039375 | |||
| 737 | Ga0307416_100066039 | |||
| 738 | Ga0307416_100097442 | |||
| 739 | Ga0307416_100126359 | |||
| 740 | Ga0307416_100177560 | |||
| 741 | Ga0307414_10005890 | |||
| 742 | Ga0307411_10052364 | |||
| 743 | Ga0307411_10267194 | |||
| 744 | Ga0307415_100056131 | |||
| 745 | Ga0307415_100230390 | |||
| 746 | Ga0373934_0006929 | |||
| 747 | Ga0373954_0089323 | |||
| 748 | Ga0373955_0023953 | |||
| 749 | Ga0373935_0055735 | |||
| 750 | Ga0373927_0041181 | |||
| 751 | Ga0373933_0003538 | |||
| 752 | Ga0373933_0010287 | |||
| 753 | Ga0373937_0000108 | |||
| 754 | Ga0395899_0050211 | |||
| 755 | Ga0395900_0079661 | |||
| 756 | Ga0395900_0153629 | |||
| 757 | Ga0395900_0383833 | |||
| 758 | Ga0395898_0232453 | |||
| 759 | Ga0395905_0041526 | |||
| 760 | Ga0395905_0055628 | |||
| 761 | Ga0395901_0006835 | |||
| 762 | Ga0395901_0011818 | |||
| 763 | Ga0395901_0014073 | |||
| 764 | Ga0237819_04826 | |||
| 765 | Ga0439436_0014972 | |||
| 766 | Ga0439438_006345 | |||
| 767 | Ga0439439_0004825 | |||
| 768 | Ga0439447_009447 | |||
| 769 | Ga0439466_0002272 | |||
| 770 | Ga0439433_0000043 | |||
| 771 | Ga0439442_000001 | |||
| 772 | Ga0439442_000443 | |||
| 773 | Ga0439442_000690 | |||
| 774 | Ga0439442_001587 | |||
| 775 | Ga0439432_026732 | |||
| 776 | Ga0439449_0001126 | |||
| 777 | Ga0439457_007610 | |||
| 778 | Ga0439462_0005436 | |||
| 779 | Ga0439462_0008949 | |||
| 780 | Ga0450919_001112 | |||
| 781 | Ga0450920_002024 | |||
| 782 | Ga0450920_008613 | |||
| 783 | Ga0450923_006512 | |||
| 784 | Ga0450894_005848 | |||
| 785 | Ga0450896_008164 | |||
| 786 | Ga0450906_011753 | |||
| 787 | Ga0450907_009573 | |||
| 788 | Ga0450908_012914 | |||
| 789 | Ga0439434_0000694 | |||
| 790 | Ga0439460_0065782 | |||
| 791 | Ga0450918_000313 | |||
| 792 | Ga0450918_001240 | |||
| 793 | Ga0451577_0000371 | |||
| 794 | Ga0453684_0001367 | |||
| 795 | Ga0451576_0194324 | |||
| 796 | Ga0466967_0064275 | |||
| 797 | Ga0495592_0001227 | |||
| 798 | Ga0495629_0011406 | |||
| 799 | Ga0495638_0070449 | |||
| 800 | Ga0495651_0000661 | |||
| 801 | Ga0495653_0001029 | |||
| 802 | Ga0495653_0009391 | |||
| 803 | Ga0495580_0004947 | |||
| 804 | Ga0495580_0020572 | |||
| 805 | Ga0495580_0020636 | |||
| 806 | Ga0495582_0031325 | |||
| 807 | Ga0495582_0036119 | |||
| 808 | Ga0495582_0162742 | |||
| 809 | Ga0495639_0001140 | |||
| 810 | Ga0495639_0002884 | |||
| 811 | Ga0495662_0004919 | |||
| 812 | Ga0495664_0077753 | |||
| 813 | Ga0495608_0002135 | |||
| 814 | Ga0495618_0016016 | |||
| 815 | Ga0495618_0021896 | |||
| 816 | Ga0495630_0034476 | |||
| 817 | Ga0495630_0055978 | |||
| 818 | Ga0495643_0000055 | |||
| 819 | Ga0495643_0114886 | |||
| 820 | Ga0495652_0001763 | |||
| 821 | Ga0495665_0001181 | |||
| 822 | Ga0495640_0006334 | |||
| 823 | Ga0495586_0000411 | |||
| 824 | Ga0495586_0012810 | |||
| 825 | Ga0495587_0000339 | |||
| 826 | Ga0495587_0001102 | |||
| 827 | Ga0495645_0002611 | |||
| 828 | Ga0495645_0017213 | |||
| 829 | Ga0495667_0015499 | |||
| 830 | Ga0495668_0096458 | |||
| 831 | Ga0495634_0006327 | |||
| 832 | Ga0495635_0082462 | |||
| 833 | Ga0495588_0006643 | |||
| 834 | Ga0495588_0015748 | |||
| 835 | Ga0495588_0018893 | |||
| 836 | Ga0495657_0003526 | |||
| 837 | Ga0495657_0017190 | |||
| 838 | Ga0495599_0039291 | |||
| 839 | Ga0495646_0007201 | |||
| 840 | Ga0495658_0100718 | |||
| 841 | Ga0495600_0000804 | |||
| 842 | Ga0495600_0003882 | |||
| 843 | Ga0495581_0026131 | |||
| 844 | Ga0495604_0001130 | |||
| 845 | Ga0495604_0173109 | |||
| 846 | Ga0495636_0041988 | |||
| 847 | Ga0495674_0002947 | |||
| 848 | Ga0495674_0020145 | |||
| 849 | Ga0495680_0003949 | |||
| 850 | Ga0495680_0006062 | |||
| 851 | Ga0495675_0087403 | |||
| 852 | Ga0495677_0025730 | |||
| 853 | Ga0495684_0009337 | |||
| 854 | Ga0495684_0090830 | |||
| 855 | Ga0495684_0102946 | |||
| 856 | Ga0495593_0085783 | |||
| 857 | Ga0495602_0076194 | |||
| 858 | Ga0496100_0006908 | |||
| 859 | Ga0496101_0017951 | |||
| 860 | Ga0496102_0041055 | |||
| 861 | Ga0496103_0004538 | |||
| 862 | Ga0496103_0005094 | |||
| 863 | Ga0496104_0227982 | |||
| 864 | Ga0496106_0010066 | |||
| 865 | Ga0496107_0116055 | |||
| 866 | Ga0496107_0154171 | |||
| 867 | Ga0496110_0254765 | |||
| 868 | Ga0496111_0015429 | |||
| 869 | Ga0496111_0029392 | |||
| 870 | Ga0496112_0016131 | |||
| 871 | Ga0496112_0029582 | |||
| 872 | Ga0496113_0128338 | |||
| 873 | Ga0496114_0096775 | |||
| 874 | Ga0496117_0004226 | |||
| 875 | Ga0496119_0083560 | |||
| 876 | Ga0496124_0108561 | |||
| 877 | Ga0501032_0000135 | |||
| 878 | Ga0501032_0017363 | |||
| 879 | Ga0501032_0201951 | |||
| 880 | Ga0501034_0000505 | |||
| 881 | Ga0501034_0001470 | |||
| 882 | Ga0501034_0258854 | |||
| 883 | Ga0501034_0277467 | |||
| 884 | Ga0501037_0003634 | |||
| 885 | Ga0501037_0003810 | |||
| 886 | Ga0501037_0104021 | |||
| 887 | Ga0501039_0029292 | |||
| 888 | Ga0501039_0182444 | |||
| 889 | Ga0501043_0013013 | |||
| 890 | Ga0501043_0078812 | |||
| 891 | Ga0501046_0006597 | |||
| 892 | Ga0501070_0125955 | |||
| 893 | Ga0501073_0008651 | |||
| 894 | Ga0501073_0093556 | |||
| 895 | Ga0501074_0033894 | |||
| 896 | Ga0501076_0106057 | |||
| 897 | Ga0501221_022271 | |||
| 898 | Ga0501044_0024288 | |||
| 899 | nmdc:mga03683_66638_c1 | |||
| 900 | nmdc:mga04h51_3997_c1 | |||
| 901 | nmdc:mga05p37_115938_c1 | |||
| 902 | nmdc:mga05p37_229942_c1 | |||
| 903 | nmdc:mga05p37_29940_c1 | |||
| 904 | nmdc:mga09592_111515_c1 | |||
| 905 | nmdc:mga09592_126468_c1 | |||
| 906 | nmdc:mga0qj67_14306_c1 | |||
| 907 | nmdc:mga0qj67_29450_c1 | |||
| 908 | nmdc:mga0qj67_31026_c1 | |||
| 909 | nmdc:mga0qj67_46602_c1 | |||
| 910 | nmdc:mga06r32_310367_c1 | |||
| 911 | nmdc:mga06r32_388880_c1 | |||
| 912 | nmdc:mga06r32_66431_c1 | |||
| 913 | nmdc:mga08y16_220802_c1 | |||
| 914 | nmdc:mga0n895_731_c1 | |||
| 915 | nmdc:mga08x19_65740_c1 | |||
| 916 | nmdc:mga0a205_70314_c1 | |||
| 917 | nmdc:mga0a205_71339_c1 | |||
| 918 | nmdc:mga0sz30_4324_c1 | |||
| 919 | Ga0495601_0007779 | |||
| 920 | Ga0495612_0001641 | |||
| 921 | Ga0495595_0001088 | |||
| 922 | Ga0495619_0003278 | |||
| 923 | Ga0500556_0000708 | |||
| 924 | Ga0500628_000763 | |||
| 925 | Ga0500559_0001070 | |||
| 926 | Ga0500559_0002433 | |||
| 927 | Ga0500559_0006478 | |||
| 928 | Ga0500616_0000076 | |||
| 929 | Ga0590075_030064 | |||
| 930 | 2523387789 | |||
| 931 | 2643874956 | |||
| 932 | 2644382012 | |||
| 933 | 2691514630 | |||
| 934 | 2775655032 | |||
| 935 | 2808827743 | |||
| 936 | 2808853097 | |||
| 937 | 2808878401 | |||
| 938 | 2808891986 | |||
| 939 | 2808897080 | |||
| 940 | 2812320494 | |||
| 941 | 2844855155 | |||
| 942 | 2852678509 | |||
| 943 | 2895661048 | |||
| 944 | 2904499760 | |||
| 945 | 2904776683 | |||
| 946 | 2910812393 | |||
| 947 | 2919036232 | |||
| 948 | 2919061655 | |||
| 949 | 2919391488 | |||
| 950 | 2919542207 | |||
| 951 | 2932429277 | |||
| 952 | 2933420760 | |||
| 953 | 2939648821 | |||
| 954 | 2939676026 | |||
| 955 | 2945918253 | |||
| 956 | 2945921460 | |||
| 957 | 2945942355 | |||
| 958 | 2945959880 | |||
| 959 | 2946038300 | |||
| 960 | 2946062104 | |||
| 961 | 2953999575 | |||
| 962 | 2974306286 | |||
| 963 | 8054110995 | |||
| 964 | 8057349208 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.9564 | 30 | 368 |
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.9402 | 30 | 368 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8704 | 30 | 362 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8605 | 30 | 362 |
| 1luc-assembly1.cif.gz_A | bacterial luciferase | 0.8592 | 30 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9465 | 28 | 370 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9426 | 31 | 368 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9344 | 31 | 368 | 3.20.20.30 |
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.923 | 28 | 370 | 3.20.20.30 |
| af_I6X7W8_4_352_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8432 | 30 | 362 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A558H8F2-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9949 | 19 | 371 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A558H8F2-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9865 | 19 | 371 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A4P6N0C1-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9791 | 29 | 370 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A160PRZ1-F1-model_v4 | Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase | 0.9764 | 93 | 370 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A2W4U291-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9733 | 30 | 323 |
GO:0004497
GO:0005829 GO:0016705 |