F452623

General Info

Members Datasets Scaffolds Average Seq Length
482 211 964 267

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10048069|Ga0207684_100480692
Length 285
Sequence MPYVPFYWRYNLIDELMRELLLCPPDHYGIEYEINPWMSRARGAEAALAQQQWKGLHMTLSNLDCKIHLVPPQPKLPDMVFTANAGLAVGKKFVPSNFRHKERAGEAPHFARWMEENGYRISWLPEDLYFEGEGDALFGGDALFCGYKFRSDIKSHRAVADMLGCLVISVELVDPRFYHLDTCFCPLPDGAAIWFPDAFDEYGQRAIREHVRELIDVSPGEAVHFSCNAIVLERDIVLPEGAPRLVATLQDRGCHCHQLPMSEFLKAGGACKCLTLFLPQREKVA

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.75
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 15.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10048069 3300025910 Unclassified 3618
2 SwRhRL2b_contig_1374981 2162886007 Bacteria 1494
3 CNXas_1000023 3300000545 Bacteria 31795
4 JGI24035J26624_1004041 3300002126 Unclassified 1390
5 JGI25406J46586_10000371 3300003203 Bacteria 20499
6 JGI25404J52841_10003467 3300003659 Bacteria 3121
7 JGI25405J52794_10000408 3300003911 Bacteria 6048
8 Ga0065703_1019064 3300005272 Bacteria 4149
9 Ga0065714_10134065 3300005288 Bacteria 1225
10 Ga0065704_10007320 3300005289 Bacteria 3828
11 Ga0065704_10079203 3300005289 Bacteria 4223
12 Ga0065704_10104785 3300005289 Bacteria 2130
13 Ga0065704_10173097 3300005289 Bacteria 1280
14 Ga0065712_10015669 3300005290 Bacteria 1491
15 Ga0065712_10088177 3300005290 Bacteria 2534
16 Ga0065712_10117985 3300005290 Unclassified 1713
17 Ga0065712_10137238 3300005290 Unclassified 1476
18 Ga0065712_10157715 3300005290 Bacteria 1323
19 Ga0065712_10160655 3300005290 Unclassified 1246
20 Ga0065715_10001383 3300005293 Bacteria 7556
21 Ga0065715_10089626 3300005293 Bacteria 9178
22 Ga0065715_10093533 3300005293 Bacteria 4650
23 Ga0065715_10124782 3300005293 Bacteria 2144
24 Ga0065715_10190036 3300005293 Bacteria 1421
25 Ga0065715_10198274 3300005293 Unclassified 1372
26 Ga0065707_10007161 3300005295 Bacteria 2407
27 Ga0065707_10107881 3300005295 Bacteria 2534
28 Ga0070683_100009625 3300005329 Bacteria 8272
29 Ga0070690_100027829 3300005330 Bacteria 3497
30 Ga0070670_100375049 3300005331 Bacteria 1253
31 Ga0070677_10009669 3300005333 Unclassified 3276
32 Ga0070666_10089306 3300005335 Bacteria 2115
33 Ga0068868_100099500 3300005338 Bacteria 2352
34 Ga0070660_100221696 3300005339 Bacteria 1537
35 Ga0070660_100526513 3300005339 Bacteria 985
36 Ga0070689_100001220 3300005340 Bacteria 16315
37 Ga0070689_100049404 3300005340 Bacteria 3247
38 Ga0070689_100254877 3300005340 Bacteria 1449
39 Ga0070687_100021833 3300005343 Unclassified 3017
40 Ga0070687_100054660 3300005343 Bacteria 2081
41 Ga0070661_100108850 3300005344 Bacteria 2068
42 Ga0070668_100084061 3300005347 Bacteria 2499
43 Ga0070668_100321434 3300005347 Bacteria 1303
44 Ga0070669_100064508 3300005353 Bacteria 2697
45 Ga0070669_100277343 3300005353 Bacteria 1342
46 Ga0070675_100006645 3300005354 Bacteria 8891
47 Ga0070675_100010634 3300005354 Bacteria 7193
48 Ga0070675_100239516 3300005354 Bacteria 1585
49 Ga0070671_100033023 3300005355 Bacteria 4278
50 Ga0070674_100015471 3300005356 Bacteria 4762
51 Ga0070674_100356082 3300005356 Bacteria 1184
52 Ga0070673_100060093 3300005364 Bacteria 3010
53 Ga0070673_100529680 3300005364 Bacteria 1068
54 Ga0070688_100002236 3300005365 Bacteria 9770
55 Ga0070688_100082744 3300005365 Bacteria 2081
56 Ga0070688_100223685 3300005365 Bacteria 1328
57 Ga0070659_100003425 3300005366 Bacteria 11304
58 Ga0070659_100014007 3300005366 Bacteria 5984
59 Ga0070659_100271634 3300005366 Bacteria 1409
60 Ga0070667_100352443 3300005367 Bacteria 1333
61 Ga0070667_100699826 3300005367 Bacteria 938
62 Ga0070709_10047202 3300005434 Bacteria 2681
63 Ga0070709_10052614 3300005434 Bacteria 2560
64 Ga0070709_10169481 3300005434 Unclassified 1525
65 Ga0070714_100053230 3300005435 Bacteria 3454
66 Ga0070714_100083522 3300005435 Bacteria 2785
67 Ga0070714_100340567 3300005435 Bacteria 1406
68 Ga0070714_100401416 3300005435 Bacteria 1296
69 Ga0070714_100518017 3300005435 Unclassified 1139
70 Ga0070713_100139108 3300005436 Bacteria 2148
71 Ga0070710_10099815 3300005437 Bacteria 1727
72 Ga0070710_10278851 3300005437 Bacteria 1084
73 Ga0070710_10298105 3300005437 Bacteria 1051
74 Ga0070711_100005359 3300005439 Bacteria 7666
75 Ga0070711_100023886 3300005439 Bacteria 3982
76 Ga0070711_100081565 3300005439 Bacteria 2306
77 Ga0070711_100091449 3300005439 Bacteria 2193
78 Ga0070700_100030574 3300005441 Unclassified 3220
79 Ga0070694_100027627 3300005444 Unclassified 3687
80 Ga0070708_100064688 3300005445 Unclassified 3277
81 Ga0070708_100074027 3300005445 Unclassified 3071
82 Ga0070708_100112379 3300005445 Bacteria 2505
83 Ga0070708_100157077 3300005445 Unclassified 2118
84 Ga0070708_100238031 3300005445 Bacteria 1709
85 Ga0070708_100421725 3300005445 Bacteria 1258
86 Ga0070708_100718550 3300005445 Bacteria 940
87 Ga0070663_100063848 3300005455 Unclassified 2660
88 Ga0070663_100219496 3300005455 Bacteria 1492
89 Ga0070678_100046701 3300005456 Bacteria 3107
90 Ga0070662_100117938 3300005457 Bacteria 2031
91 Ga0070681_10088164 3300005458 Bacteria 3055
92 Ga0070685_10010586 3300005466 Bacteria 4797
93 Ga0070706_100000060 3300005467 Bacteria 131097
94 Ga0070706_100009440 3300005467 Bacteria 9079
95 Ga0070706_100025684 3300005467 Bacteria 5421
96 Ga0070706_100026004 3300005467 Bacteria 5386
97 Ga0070706_100040068 3300005467 Bacteria 4324
98 Ga0070706_100086095 3300005467 Unclassified 2912
99 Ga0070706_100109728 3300005467 Unclassified 2567
100 Ga0070706_100138436 3300005467 Bacteria 2272
101 Ga0070706_100250847 3300005467 Bacteria 1652
102 Ga0070706_100275996 3300005467 Unclassified 1569
103 Ga0070706_100316889 3300005467 Unclassified 1455
104 Ga0070707_100000404 3300005468 Bacteria 42569
105 Ga0070707_100015230 3300005468 Bacteria 7217
106 Ga0070707_100019622 3300005468 Bacteria 6371
107 Ga0070707_100025187 3300005468 Bacteria 5642
108 Ga0070707_100025836 3300005468 Bacteria 5575
109 Ga0070707_100048861 3300005468 Unclassified 4054
110 Ga0070707_100077177 3300005468 Bacteria 3214
111 Ga0070707_100081234 3300005468 Bacteria 3129
112 Ga0070707_100090325 3300005468 Unclassified 2965
113 Ga0070707_100124464 3300005468 Bacteria 2504
114 Ga0070707_100133950 3300005468 Unclassified 2410
115 Ga0070707_100161194 3300005468 Bacteria 2186
116 Ga0070707_100188440 3300005468 Bacteria 2011
117 Ga0070698_100001013 3300005471 Bacteria 30877
118 Ga0070698_100003428 3300005471 Bacteria 17426
119 Ga0070698_100045788 3300005471 Bacteria 4476
120 Ga0070698_100058610 3300005471 Bacteria 3892
121 Ga0070698_100218490 3300005471 Unclassified 1840
122 Ga0070699_100039281 3300005518 Bacteria 4098
123 Ga0070699_100191128 3300005518 Bacteria 1819
124 Ga0070699_100262202 3300005518 Unclassified 1546
125 Ga0070684_100010891 3300005535 Bacteria 7225
126 Ga0070684_100099829 3300005535 Unclassified 2591
127 Ga0070697_100001547 3300005536 Bacteria 17512
128 Ga0070697_100006107 3300005536 Bacteria 9316
129 Ga0070697_100017683 3300005536 Bacteria 5616
130 Ga0070697_100021707 3300005536 Bacteria 5089
131 Ga0070697_100038667 3300005536 Bacteria 3856
132 Ga0070697_100133751 3300005536 Bacteria 2081
133 Ga0070697_100174484 3300005536 Bacteria 1820
134 Ga0070697_100204339 3300005536 Archaea 1679
135 Ga0070697_100384781 3300005536 Bacteria 1215
136 Ga0070672_100047765 3300005543 Bacteria 3323
137 Ga0070696_100021215 3300005546 Bacteria 4404
138 Ga0070665_100057290 3300005548 Bacteria 3907
139 Ga0070665_100336678 3300005548 Unclassified 1513
140 Ga0070665_100599604 3300005548 Bacteria 1114
141 Ga0070704_100000817 3300005549 Bacteria 15457
142 Ga0068854_100422943 3300005578 Bacteria 1107
143 Ga0068856_100066023 3300005614 Bacteria 3575
144 Ga0068859_100005082 3300005617 Bacteria 13365
145 Ga0068864_100052934 3300005618 Unclassified 3500
146 Ga0068863_100003588 3300005841 Bacteria 15309
147 Ga0068858_100004288 3300005842 Bacteria 14030
148 Ga0081455_10000581 3300005937 Bacteria 47692
149 Ga0081455_10000604 3300005937 Bacteria 46425
150 Ga0081455_10005692 3300005937 Bacteria 13598
151 Ga0081455_10011482 3300005937 Bacteria 8898
152 Ga0081455_10014846 3300005937 Bacteria 7597
153 Ga0081455_10029399 3300005937 Bacteria 5010
154 Ga0081455_10038931 3300005937 Bacteria 4207
155 Ga0081455_10063368 3300005937 Bacteria 3102
156 Ga0081540_1000603 3300005983 Bacteria 34283
157 Ga0081540_1023247 3300005983 Bacteria 3631
158 Ga0081539_10000153 3300005985 Bacteria 159919
159 Ga0081539_10003387 3300005985 Bacteria 19732
160 Ga0081539_10009102 3300005985 Bacteria 8403
161 Ga0081539_10025684 3300005985 Bacteria 3783
162 Ga0070717_10002894 3300006028 Bacteria 12190
163 Ga0070717_10003242 3300006028 Bacteria 11629
164 Ga0070717_10006880 3300006028 Bacteria 8395
165 Ga0070717_10014664 3300006028 Bacteria 6031
166 Ga0070717_10087914 3300006028 Bacteria 2618
167 Ga0070717_10184004 3300006028 Bacteria 1822
168 Ga0070715_10020370 3300006163 Bacteria 2558
169 Ga0070716_100067002 3300006173 Unclassified 2096
170 Ga0070716_100077344 3300006173 Bacteria 1975
171 Ga0070712_100005358 3300006175 Bacteria 7941
172 Ga0070712_100010093 3300006175 Bacteria 5951
173 Ga0070712_100010200 3300006175 Bacteria 5921
174 Ga0070712_100018841 3300006175 Bacteria 4491
175 Ga0070712_100028297 3300006175 Unclassified 3748
176 Ga0070712_100085864 3300006175 Bacteria 2292
177 Ga0070712_100228503 3300006175 Bacteria 1477
178 Ga0068871_100035755 3300006358 Bacteria 3950
179 Ga0075428_100669798 3300006844 Bacteria 1106
180 Ga0075434_100186834 3300006871 Bacteria 2093
181 Ga0075434_100610905 3300006871 Bacteria 1109
182 Ga0068865_100376862 3300006881 Bacteria 1156
183 Ga0068865_100388907 3300006881 Unclassified 1139
184 Ga0075436_100020204 3300006914 Bacteria 4572
185 Ga0097620_100005082 3300006931 Bacteria 13365
186 Ga0099794_10069704 3300007265 Bacteria 1721
187 Ga0099795_10033801 3300007788 Bacteria 1778
188 Ga0105250_10142227 3300009092 Bacteria 995
189 Ga0111539_10270823 3300009094 Bacteria 1976
190 Ga0111539_10562532 3300009094 Bacteria 1328
191 Ga0105245_10402518 3300009098 Bacteria 1368
192 Ga0105247_10307575 3300009101 Bacteria 1102
193 Ga0114129_10002181 3300009147 Bacteria 26942
194 Ga0114129_10238394 3300009147 Bacteria 2446
195 Ga0105243_10197474 3300009148 Bacteria 1762
196 Ga0105241_10422275 3300009174 Bacteria 1174
197 Ga0105242_10015528 3300009176 Bacteria 5916
198 Ga0105242_10478490 3300009176 Unclassified 1180
199 Ga0105248_10207149 3300009177 Bacteria 2210
200 Ga0105249_10013320 3300009553 Bacteria 7261
201 Ga0105249_10251180 3300009553 Unclassified 1753
202 Ga0105249_10261904 3300009553 Bacteria 1719
203 Ga0099796_10031430 3300010159 Bacteria 1731
204 Ga0105239_10018313 3300010375 Bacteria 7742
205 Ga0105239_10023962 3300010375 Bacteria 6722
206 Ga0105246_10313323 3300011119 Unclassified 1272
207 Ga0157371_10172576 3300013102 Bacteria 1546
208 Ga0157369_10120167 3300013105 Bacteria 2788
209 Ga0157374_10051657 3300013296 Bacteria 3826
210 Ga0157374_10077342 3300013296 Bacteria 3149
211 Ga0157374_10179837 3300013296 Bacteria 2065
212 Ga0157374_10208298 3300013296 Bacteria 1917
213 Ga0157374_10341989 3300013296 Unclassified 1485
214 Ga0157378_10059935 3300013297 Bacteria 3396
215 Ga0157378_10081351 3300013297 Unclassified 2928
216 Ga0157378_10082512 3300013297 Bacteria 2907
217 Ga0157378_10082964 3300013297 Unclassified 2899
218 Ga0157378_10099282 3300013297 Bacteria 2656
219 Ga0157378_10101110 3300013297 Bacteria 2633
220 Ga0157378_10193697 3300013297 Bacteria 1919
221 Ga0157378_10259020 3300013297 Unclassified 1668
222 Ga0157378_10660447 3300013297 Bacteria 1062
223 Ga0163162_10089137 3300013306 Bacteria 3165
224 Ga0163162_10163855 3300013306 Bacteria 2346
225 Ga0163162_10331281 3300013306 Bacteria 1655
226 Ga0157372_10017729 3300013307 Bacteria 7643
227 Ga0157372_10178302 3300013307 Bacteria 2460
228 Ga0157372_10521953 3300013307 Bacteria 1384
229 Ga0157375_10008128 3300013308 Bacteria 9182
230 Ga0157375_10093805 3300013308 Bacteria 3068
231 Ga0157375_10120562 3300013308 Bacteria 2732
232 Ga0157375_10326373 3300013308 Bacteria 1699
233 Ga0157375_10457917 3300013308 Bacteria 1441
234 Ga0163163_10474536 3300014325 Bacteria 1312
235 Ga0157379_10002989 3300014968 Bacteria 14257
236 Ga0157379_10737949 3300014968 Bacteria 926
237 Ga0157376_10074091 3300014969 Bacteria 2901
238 Ga0157376_10075708 3300014969 Unclassified 2873
239 Ga0157376_10096800 3300014969 Bacteria 2569
240 Ga0157376_10318648 3300014969 Bacteria 1478
241 Ga0157376_10538967 3300014969 Bacteria 1153
242 Ga0207666_1000317 3300025271 Bacteria 6709
243 Ga0207673_1000642 3300025290 Unclassified 3724
244 Ga0207697_10000526 3300025315 Bacteria 21613
245 Ga0207697_10000601 3300025315 Bacteria 20500
246 Ga0207697_10000696 3300025315 Bacteria 19118
247 Ga0207697_10001469 3300025315 Bacteria 12875
248 Ga0207697_10003647 3300025315 Bacteria 7542
249 Ga0207697_10005458 3300025315 Bacteria 5910
250 Ga0207697_10153107 3300025315 Bacteria 1004
251 Ga0207642_10030546 3300025899 Bacteria 2246
252 Ga0207688_10011920 3300025901 Bacteria 4731
253 Ga0207688_10027717 3300025901 Bacteria 3115
254 Ga0207688_10175751 3300025901 Bacteria 1275
255 Ga0207680_10172564 3300025903 Bacteria 1457
256 Ga0207647_10028547 3300025904 Unclassified 3621
257 Ga0207685_10013008 3300025905 Bacteria 2561
258 Ga0207685_10150511 3300025905 Bacteria 1053
259 Ga0207685_10160459 3300025905 Bacteria 1026
260 Ga0207699_10020672 3300025906 Bacteria 3533
261 Ga0207699_10357350 3300025906 Bacteria 1032
262 Ga0207645_10002422 3300025907 Bacteria 14692
263 Ga0207645_10011564 3300025907 Bacteria 6018
264 Ga0207645_10319435 3300025907 Bacteria 1036
265 Ga0207684_10000118 3300025910 Bacteria 145120
266 Ga0207684_10003192 3300025910 Bacteria 16087
267 Ga0207684_10013757 3300025910 Bacteria 6989
268 Ga0207684_10071533 3300025910 Bacteria 2947
269 Ga0207684_10082341 3300025910 Unclassified 2740
270 Ga0207684_10102551 3300025910 Bacteria 2446
271 Ga0207684_10477501 3300025910 Bacteria 1069
272 Ga0207654_10119096 3300025911 Bacteria 1655
273 Ga0207654_10248505 3300025911 Bacteria 1191
274 Ga0207707_10579427 3300025912 Bacteria 951
275 Ga0207693_10010744 3300025915 Bacteria 7433
276 Ga0207693_10015701 3300025915 Bacteria 6069
277 Ga0207693_10019379 3300025915 Bacteria 5412
278 Ga0207693_10022635 3300025915 Bacteria 4992
279 Ga0207693_10060994 3300025915 Bacteria 2954
280 Ga0207663_10008519 3300025916 Bacteria 5368
281 Ga0207663_10010481 3300025916 Bacteria 4936
282 Ga0207663_10060115 3300025916 Bacteria 2407
283 Ga0207663_10190888 3300025916 Bacteria 1471
284 Ga0207662_10004566 3300025918 Bacteria 7297
285 Ga0207662_10017558 3300025918 Unclassified 4050
286 Ga0207652_10122348 3300025921 Bacteria 2316
287 Ga0207646_10001329 3300025922 Bacteria 30714
288 Ga0207646_10004180 3300025922 Bacteria 15816
289 Ga0207646_10008643 3300025922 Bacteria 10180
290 Ga0207646_10024877 3300025922 Bacteria 5480
291 Ga0207646_10030984 3300025922 Unclassified 4845
292 Ga0207646_10047874 3300025922 Bacteria 3834
293 Ga0207646_10064472 3300025922 Unclassified 3270
294 Ga0207646_10065776 3300025922 Bacteria 3236
295 Ga0207646_10099947 3300025922 Bacteria 2600
296 Ga0207646_10130362 3300025922 Bacteria 2262
297 Ga0207646_10213169 3300025922 Bacteria 1744
298 Ga0207646_10289736 3300025922 Bacteria 1479
299 Ga0207681_10014304 3300025923 Bacteria 4928
300 Ga0207681_10030265 3300025923 Bacteria 3527
301 Ga0207659_10080530 3300025926 Bacteria 2406
302 Ga0207659_10129509 3300025926 Bacteria 1945
303 Ga0207659_10259351 3300025926 Bacteria 1413
304 Ga0207659_10267976 3300025926 Bacteria 1392
305 Ga0207659_10627873 3300025926 Bacteria 917
306 Ga0207687_10337816 3300025927 Unclassified 1224
307 Ga0207687_10479328 3300025927 Bacteria 1036
308 Ga0207700_10083182 3300025928 Bacteria 2505
309 Ga0207700_10160270 3300025928 Bacteria 1868
310 Ga0207700_10303676 3300025928 Bacteria 1379
311 Ga0207664_10021610 3300025929 Bacteria 4789
312 Ga0207664_10098767 3300025929 Bacteria 2408
313 Ga0207664_10350791 3300025929 Bacteria 1306
314 Ga0207644_10042579 3300025931 Bacteria 3219
315 Ga0207644_10140379 3300025931 Bacteria 1860
316 Ga0207690_10003273 3300025932 Bacteria 9709
317 Ga0207706_10001969 3300025933 Bacteria 20134
318 Ga0207706_10020101 3300025933 Bacteria 6001
319 Ga0207706_10030991 3300025933 Unclassified 4766
320 Ga0207706_10077278 3300025933 Bacteria 2928
321 Ga0207686_10001360 3300025934 Bacteria 13914
322 Ga0207670_10002217 3300025936 Bacteria 10162
323 Ga0207670_10102821 3300025936 Bacteria 2043
324 Ga0207670_10152127 3300025936 Bacteria 1718
325 Ga0207670_10177197 3300025936 Bacteria 1603
326 Ga0207670_10235791 3300025936 Bacteria 1407
327 Ga0207704_10260595 3300025938 Bacteria 1307
328 Ga0207704_10342242 3300025938 Bacteria 1161
329 Ga0207665_10082619 3300025939 Bacteria 2214
330 Ga0207691_10016865 3300025940 Bacteria 6930
331 Ga0207691_10040622 3300025940 Unclassified 4297
332 Ga0207711_10314107 3300025941 Bacteria 1447
333 Ga0207661_10181112 3300025944 Bacteria 1841
334 Ga0207661_10228390 3300025944 Unclassified 1647
335 Ga0207661_10288438 3300025944 Bacteria 1468
336 Ga0207679_10009739 3300025945 Bacteria 6163
337 Ga0207651_10254479 3300025960 Bacteria 1438
338 Ga0207712_10204597 3300025961 Bacteria 1568
339 Ga0207668_10030935 3300025972 Bacteria 3521
340 Ga0207668_10037820 3300025972 Bacteria 3234
341 Ga0207668_10354976 3300025972 Bacteria 1227
342 Ga0207677_10144613 3300026023 Bacteria 1826
343 Ga0207677_10279892 3300026023 Bacteria 1369
344 Ga0207703_10006218 3300026035 Bacteria 9557
345 Ga0207678_10009813 3300026067 Bacteria 8419
346 Ga0207678_10263235 3300026067 Bacteria 1478
347 Ga0207708_10047795 3300026075 Unclassified 3256
348 Ga0207702_10394297 3300026078 Unclassified 1334
349 Ga0207641_10013983 3300026088 Bacteria 6579
350 Ga0207648_10279048 3300026089 Bacteria 1494
351 Ga0207674_10408429 3300026116 Unclassified 1312
352 Ga0207683_10038278 3300026121 Bacteria 4179
353 Ga0207683_10121117 3300026121 Unclassified 2349
354 Ga0209998_10001563 3300027717 Bacteria 5505
355 Ga0209974_10017998 3300027876 Bacteria 2343
356 Ga0268266_10053999 3300028379 Bacteria 3453
357 Ga0268266_10111274 3300028379 Bacteria 2427
358 Ga0268266_10188539 3300028379 Bacteria 1882
359 Ga0268266_10272490 3300028379 Bacteria 1571
360 Ga0268265_10563510 3300028380 Bacteria 1083
361 Ga0307513_10019408 3300031456 Bacteria 8093
362 Ga0373945_0071153 3300035116 Bacteria 1317
363 Ga0373956_0096333 3300035119 Unclassified 1369
364 Ga0373943_0017906 3300035170 Bacteria 3248
365 Ga0373943_0087107 3300035170 Bacteria 1611
366 Ga0373943_0113417 3300035170 Bacteria 1432
367 Ga0373943_0331664 3300035170 Bacteria 869
368 Ga0373946_0014878 3300035171 Bacteria 2941
369 Ga0373946_0091623 3300035171 Bacteria 1348
370 Ga0373955_0125888 3300035172 Bacteria 1493
371 Ga0373931_0092085 3300035691 Bacteria 1691
372 Ga0373935_0019056 3300035692 Bacteria 4185
373 Ga0373935_0171508 3300035692 Bacteria 1484
374 Ga0373935_0258162 3300035692 Bacteria 1221
375 Ga0373927_0061697 3300035695 Bacteria 2425
376 Ga0373947_0020413 3300035725 Bacteria 3825
377 Ga0373947_0063596 3300035725 Bacteria 2248
378 Ga0373947_0069661 3300035725 Bacteria 2153
379 Ga0373947_0070429 3300035725 Bacteria 2143
380 Ga0373947_0092756 3300035725 Bacteria 1886
381 Ga0373937_0108184 3300036401 Unclassified 2585
382 Ga0373937_0201826 3300036401 Bacteria 1869
383 Ga0373937_0681026 3300036401 Bacteria 974
384 Ga0373925_0080472 3300037068 Bacteria 2476
385 Ga0373925_0082200 3300037068 Bacteria 2451
386 Ga0373925_0114930 3300037068 Unclassified 2083
387 Ga0395900_0028588 3300037418 Bacteria 5713
388 Ga0395900_0042580 3300037418 Bacteria 4679
389 Ga0395900_0485182 3300037418 Unclassified 1188
390 Ga0395898_0011613 3300037466 Bacteria 9141
391 Ga0395898_0090973 3300037466 Bacteria 2936
392 Ga0395898_0380719 3300037466 Bacteria 1346
393 Ga0395905_0022061 3300037471 Bacteria 6023
394 Ga0395905_0371876 3300037471 Bacteria 1323
395 Ga0395901_0012003 3300038443 Bacteria 8789
396 Ga0395901_0067110 3300038443 Unclassified 3736
397 Ga0395901_0197525 3300038443 Bacteria 2109
398 Ga0436363_1619763 3300039450 Unclassified 2321
399 Ga0439460_0023340 3300042461 Bacteria 1705
400 Ga0439460_0026381 3300042461 Bacteria 1625
401 Ga0466967_0052290 3300045976 Bacteria 3585
402 Ga0495629_0102349 3300046459 Unclassified 1998
403 Ga0495629_0168794 3300046459 Unclassified 1519
404 Ga0495651_0214119 3300046462 Unclassified 1338
405 Ga0495580_0043064 3300046472 Bacteria 3214
406 Ga0495664_0083381 3300046477 Unclassified 1918
407 Ga0495628_0005359 3300046516 Bacteria 11252
408 Ga0495630_0118851 3300046517 Unclassified 2005
409 Ga0495652_0036915 3300046529 Bacteria 4243
410 Ga0495652_0238349 3300046529 Unclassified 1355
411 Ga0495640_0336040 3300046533 Bacteria 934
412 Ga0495587_0117343 3300046536 Bacteria 1526
413 Ga0495598_0020138 3300046537 Bacteria 1758
414 Ga0495645_0001617 3300046543 Bacteria 15241
415 Ga0495634_0075731 3300046642 Bacteria 2209
416 Ga0495635_0143985 3300046663 Bacteria 1623
417 Ga0495623_0049182 3300046679 Unclassified 2672
418 Ga0495646_0073305 3300046680 Unclassified 2011
419 Ga0495613_0321259 3300046689 Bacteria 1068
420 Ga0495581_0069799 3300047315 Bacteria 2032
421 Ga0495680_0292203 3300047322 Bacteria 1146
422 Ga0495675_0134518 3300047444 Bacteria 1535
423 Ga0495675_0223403 3300047444 Bacteria 1139
424 Ga0495684_0047592 3300047471 Bacteria 3279
425 Ga0496100_0392676 3300048903 Bacteria 1055
426 Ga0496101_0030791 3300048904 Bacteria 3766
427 Ga0496101_0098362 3300048904 Bacteria 2186
428 Ga0496101_0165449 3300048904 Bacteria 1698
429 Ga0496102_0017672 3300048905 Bacteria 6251
430 Ga0496102_0051172 3300048905 Unclassified 3763
431 Ga0496103_0028741 3300048906 Bacteria 3376
432 Ga0496104_0042867 3300048907 Bacteria 4249
433 Ga0496104_0077516 3300048907 Unclassified 3167
434 Ga0496105_0007798 3300048908 Bacteria 8309
435 Ga0496105_0076773 3300048908 Bacteria 2759
436 Ga0496105_0156844 3300048908 Bacteria 1869
437 Ga0496105_0261738 3300048908 Bacteria 1399
438 Ga0496106_0022242 3300048909 Bacteria 4709
439 Ga0496106_0259333 3300048909 Bacteria 1391
440 Ga0496107_0001627 3300048910 Bacteria 14003
441 Ga0496107_0131159 3300048910 Unclassified 1850
442 Ga0496108_0103296 3300048911 Unclassified 2432
443 Ga0496109_0002248 3300048912 Bacteria 16049
444 Ga0496109_0007629 3300048912 Bacteria 9174
445 Ga0496109_0074183 3300048912 Bacteria 3127
446 Ga0496109_0080303 3300048912 Bacteria 3005
447 Ga0496109_0166517 3300048912 Unclassified 2067
448 Ga0496109_0195875 3300048912 Bacteria 1899
449 Ga0496110_0049527 3300048913 Unclassified 3685
450 Ga0496110_0102569 3300048913 Bacteria 2566
451 Ga0496110_0422076 3300048913 Bacteria 1216
452 Ga0496111_0080202 3300048914 Unclassified 2381
453 Ga0496111_0080419 3300048914 Bacteria 2378
454 Ga0496112_0010156 3300048915 Bacteria 8530
455 Ga0496112_0047743 3300048915 Bacteria 4200
456 Ga0496112_0239143 3300048915 Bacteria 1769
457 Ga0496112_0328341 3300048915 Bacteria 1474
458 Ga0496112_0479680 3300048915 Bacteria 1180
459 Ga0496112_0480771 3300048915 Bacteria 1179
460 Ga0496112_0483102 3300048915 Unclassified 1175
461 Ga0496112_0541423 3300048915 Unclassified 1098
462 Ga0496113_0010758 3300048916 Bacteria 6066
463 Ga0496113_0091852 3300048916 Bacteria 2341
464 Ga0496113_0118579 3300048916 Bacteria 2067
465 Ga0496113_0634455 3300048916 Bacteria 855
466 Ga0496114_0008749 3300048917 Bacteria 8018
467 Ga0496114_0237239 3300048917 Bacteria 1603
468 Ga0496115_0002792 3300048918 Bacteria 12549
469 Ga0496115_0009956 3300048918 Bacteria 7082
470 Ga0496115_0039753 3300048918 Bacteria 3737
471 Ga0496115_0080274 3300048918 Bacteria 2656
472 Ga0501069_0394981 3300049585 Unclassified 818
473 nmdc:mga05p37_16502_c1 3300050507 Bacteria 8896
474 nmdc:mga05p37_205125_c1 3300050507 Bacteria 2385
475 nmdc:mga08y16_526342_c1 3300050511 Bacteria 1198
476 nmdc:mga0n895_153359_c1 3300050512 Bacteria 2334
477 nmdc:mga0n895_347153_c1 3300050512 Bacteria 1503
478 nmdc:mga08x19_179206_c1 3300050514 Bacteria 1446
479 nmdc:mga08x19_35004_c1 3300050514 Bacteria 3176
480 Ga0495601_0001406 3300053077 Bacteria 13252
481 Ga0495595_0241826 3300053084 Bacteria 903
482 Ga0495619_0261090 3300053085 Bacteria 1200
483 Ga0207684_10048069
484 SwRhRL2b_contig_1374981
485 CNXas_1000023
486 JGI24035J26624_1004041
487 JGI25406J46586_10000371
488 JGI25404J52841_10003467
489 JGI25405J52794_10000408
490 Ga0065703_1019064
491 Ga0065714_10134065
492 Ga0065704_10007320
493 Ga0065704_10079203
494 Ga0065704_10104785
495 Ga0065704_10173097
496 Ga0065712_10015669
497 Ga0065712_10088177
498 Ga0065712_10117985
499 Ga0065712_10137238
500 Ga0065712_10157715
501 Ga0065712_10160655
502 Ga0065715_10001383
503 Ga0065715_10089626
504 Ga0065715_10093533
505 Ga0065715_10124782
506 Ga0065715_10190036
507 Ga0065715_10198274
508 Ga0065707_10007161
509 Ga0065707_10107881
510 Ga0070683_100009625
511 Ga0070690_100027829
512 Ga0070670_100375049
513 Ga0070677_10009669
514 Ga0070666_10089306
515 Ga0068868_100099500
516 Ga0070660_100221696
517 Ga0070660_100526513
518 Ga0070689_100001220
519 Ga0070689_100049404
520 Ga0070689_100254877
521 Ga0070687_100021833
522 Ga0070687_100054660
523 Ga0070661_100108850
524 Ga0070668_100084061
525 Ga0070668_100321434
526 Ga0070669_100064508
527 Ga0070669_100277343
528 Ga0070675_100006645
529 Ga0070675_100010634
530 Ga0070675_100239516
531 Ga0070671_100033023
532 Ga0070674_100015471
533 Ga0070674_100356082
534 Ga0070673_100060093
535 Ga0070673_100529680
536 Ga0070688_100002236
537 Ga0070688_100082744
538 Ga0070688_100223685
539 Ga0070659_100003425
540 Ga0070659_100014007
541 Ga0070659_100271634
542 Ga0070667_100352443
543 Ga0070667_100699826
544 Ga0070709_10047202
545 Ga0070709_10052614
546 Ga0070709_10169481
547 Ga0070714_100053230
548 Ga0070714_100083522
549 Ga0070714_100340567
550 Ga0070714_100401416
551 Ga0070714_100518017
552 Ga0070713_100139108
553 Ga0070710_10099815
554 Ga0070710_10278851
555 Ga0070710_10298105
556 Ga0070711_100005359
557 Ga0070711_100023886
558 Ga0070711_100081565
559 Ga0070711_100091449
560 Ga0070700_100030574
561 Ga0070694_100027627
562 Ga0070708_100064688
563 Ga0070708_100074027
564 Ga0070708_100112379
565 Ga0070708_100157077
566 Ga0070708_100238031
567 Ga0070708_100421725
568 Ga0070708_100718550
569 Ga0070663_100063848
570 Ga0070663_100219496
571 Ga0070678_100046701
572 Ga0070662_100117938
573 Ga0070681_10088164
574 Ga0070685_10010586
575 Ga0070706_100000060
576 Ga0070706_100009440
577 Ga0070706_100025684
578 Ga0070706_100026004
579 Ga0070706_100040068
580 Ga0070706_100086095
581 Ga0070706_100109728
582 Ga0070706_100138436
583 Ga0070706_100250847
584 Ga0070706_100275996
585 Ga0070706_100316889
586 Ga0070707_100000404
587 Ga0070707_100015230
588 Ga0070707_100019622
589 Ga0070707_100025187
590 Ga0070707_100025836
591 Ga0070707_100048861
592 Ga0070707_100077177
593 Ga0070707_100081234
594 Ga0070707_100090325
595 Ga0070707_100124464
596 Ga0070707_100133950
597 Ga0070707_100161194
598 Ga0070707_100188440
599 Ga0070698_100001013
600 Ga0070698_100003428
601 Ga0070698_100045788
602 Ga0070698_100058610
603 Ga0070698_100218490
604 Ga0070699_100039281
605 Ga0070699_100191128
606 Ga0070699_100262202
607 Ga0070684_100010891
608 Ga0070684_100099829
609 Ga0070697_100001547
610 Ga0070697_100006107
611 Ga0070697_100017683
612 Ga0070697_100021707
613 Ga0070697_100038667
614 Ga0070697_100133751
615 Ga0070697_100174484
616 Ga0070697_100204339
617 Ga0070697_100384781
618 Ga0070672_100047765
619 Ga0070696_100021215
620 Ga0070665_100057290
621 Ga0070665_100336678
622 Ga0070665_100599604
623 Ga0070704_100000817
624 Ga0068854_100422943
625 Ga0068856_100066023
626 Ga0068859_100005082
627 Ga0068864_100052934
628 Ga0068863_100003588
629 Ga0068858_100004288
630 Ga0081455_10000581
631 Ga0081455_10000604
632 Ga0081455_10005692
633 Ga0081455_10011482
634 Ga0081455_10014846
635 Ga0081455_10029399
636 Ga0081455_10038931
637 Ga0081455_10063368
638 Ga0081540_1000603
639 Ga0081540_1023247
640 Ga0081539_10000153
641 Ga0081539_10003387
642 Ga0081539_10009102
643 Ga0081539_10025684
644 Ga0070717_10002894
645 Ga0070717_10003242
646 Ga0070717_10006880
647 Ga0070717_10014664
648 Ga0070717_10087914
649 Ga0070717_10184004
650 Ga0070715_10020370
651 Ga0070716_100067002
652 Ga0070716_100077344
653 Ga0070712_100005358
654 Ga0070712_100010093
655 Ga0070712_100010200
656 Ga0070712_100018841
657 Ga0070712_100028297
658 Ga0070712_100085864
659 Ga0070712_100228503
660 Ga0068871_100035755
661 Ga0075428_100669798
662 Ga0075434_100186834
663 Ga0075434_100610905
664 Ga0068865_100376862
665 Ga0068865_100388907
666 Ga0075436_100020204
667 Ga0097620_100005082
668 Ga0099794_10069704
669 Ga0099795_10033801
670 Ga0105250_10142227
671 Ga0111539_10270823
672 Ga0111539_10562532
673 Ga0105245_10402518
674 Ga0105247_10307575
675 Ga0114129_10002181
676 Ga0114129_10238394
677 Ga0105243_10197474
678 Ga0105241_10422275
679 Ga0105242_10015528
680 Ga0105242_10478490
681 Ga0105248_10207149
682 Ga0105249_10013320
683 Ga0105249_10251180
684 Ga0105249_10261904
685 Ga0099796_10031430
686 Ga0105239_10018313
687 Ga0105239_10023962
688 Ga0105246_10313323
689 Ga0157371_10172576
690 Ga0157369_10120167
691 Ga0157374_10051657
692 Ga0157374_10077342
693 Ga0157374_10179837
694 Ga0157374_10208298
695 Ga0157374_10341989
696 Ga0157378_10059935
697 Ga0157378_10081351
698 Ga0157378_10082512
699 Ga0157378_10082964
700 Ga0157378_10099282
701 Ga0157378_10101110
702 Ga0157378_10193697
703 Ga0157378_10259020
704 Ga0157378_10660447
705 Ga0163162_10089137
706 Ga0163162_10163855
707 Ga0163162_10331281
708 Ga0157372_10017729
709 Ga0157372_10178302
710 Ga0157372_10521953
711 Ga0157375_10008128
712 Ga0157375_10093805
713 Ga0157375_10120562
714 Ga0157375_10326373
715 Ga0157375_10457917
716 Ga0163163_10474536
717 Ga0157379_10002989
718 Ga0157379_10737949
719 Ga0157376_10074091
720 Ga0157376_10075708
721 Ga0157376_10096800
722 Ga0157376_10318648
723 Ga0157376_10538967
724 Ga0207666_1000317
725 Ga0207673_1000642
726 Ga0207697_10000526
727 Ga0207697_10000601
728 Ga0207697_10000696
729 Ga0207697_10001469
730 Ga0207697_10003647
731 Ga0207697_10005458
732 Ga0207697_10153107
733 Ga0207642_10030546
734 Ga0207688_10011920
735 Ga0207688_10027717
736 Ga0207688_10175751
737 Ga0207680_10172564
738 Ga0207647_10028547
739 Ga0207685_10013008
740 Ga0207685_10150511
741 Ga0207685_10160459
742 Ga0207699_10020672
743 Ga0207699_10357350
744 Ga0207645_10002422
745 Ga0207645_10011564
746 Ga0207645_10319435
747 Ga0207684_10000118
748 Ga0207684_10003192
749 Ga0207684_10013757
750 Ga0207684_10071533
751 Ga0207684_10082341
752 Ga0207684_10102551
753 Ga0207684_10477501
754 Ga0207654_10119096
755 Ga0207654_10248505
756 Ga0207707_10579427
757 Ga0207693_10010744
758 Ga0207693_10015701
759 Ga0207693_10019379
760 Ga0207693_10022635
761 Ga0207693_10060994
762 Ga0207663_10008519
763 Ga0207663_10010481
764 Ga0207663_10060115
765 Ga0207663_10190888
766 Ga0207662_10004566
767 Ga0207662_10017558
768 Ga0207652_10122348
769 Ga0207646_10001329
770 Ga0207646_10004180
771 Ga0207646_10008643
772 Ga0207646_10024877
773 Ga0207646_10030984
774 Ga0207646_10047874
775 Ga0207646_10064472
776 Ga0207646_10065776
777 Ga0207646_10099947
778 Ga0207646_10130362
779 Ga0207646_10213169
780 Ga0207646_10289736
781 Ga0207681_10014304
782 Ga0207681_10030265
783 Ga0207659_10080530
784 Ga0207659_10129509
785 Ga0207659_10259351
786 Ga0207659_10267976
787 Ga0207659_10627873
788 Ga0207687_10337816
789 Ga0207687_10479328
790 Ga0207700_10083182
791 Ga0207700_10160270
792 Ga0207700_10303676
793 Ga0207664_10021610
794 Ga0207664_10098767
795 Ga0207664_10350791
796 Ga0207644_10042579
797 Ga0207644_10140379
798 Ga0207690_10003273
799 Ga0207706_10001969
800 Ga0207706_10020101
801 Ga0207706_10030991
802 Ga0207706_10077278
803 Ga0207686_10001360
804 Ga0207670_10002217
805 Ga0207670_10102821
806 Ga0207670_10152127
807 Ga0207670_10177197
808 Ga0207670_10235791
809 Ga0207704_10260595
810 Ga0207704_10342242
811 Ga0207665_10082619
812 Ga0207691_10016865
813 Ga0207691_10040622
814 Ga0207711_10314107
815 Ga0207661_10181112
816 Ga0207661_10228390
817 Ga0207661_10288438
818 Ga0207679_10009739
819 Ga0207651_10254479
820 Ga0207712_10204597
821 Ga0207668_10030935
822 Ga0207668_10037820
823 Ga0207668_10354976
824 Ga0207677_10144613
825 Ga0207677_10279892
826 Ga0207703_10006218
827 Ga0207678_10009813
828 Ga0207678_10263235
829 Ga0207708_10047795
830 Ga0207702_10394297
831 Ga0207641_10013983
832 Ga0207648_10279048
833 Ga0207674_10408429
834 Ga0207683_10038278
835 Ga0207683_10121117
836 Ga0209998_10001563
837 Ga0209974_10017998
838 Ga0268266_10053999
839 Ga0268266_10111274
840 Ga0268266_10188539
841 Ga0268266_10272490
842 Ga0268265_10563510
843 Ga0307513_10019408
844 Ga0373945_0071153
845 Ga0373956_0096333
846 Ga0373943_0017906
847 Ga0373943_0087107
848 Ga0373943_0113417
849 Ga0373943_0331664
850 Ga0373946_0014878
851 Ga0373946_0091623
852 Ga0373955_0125888
853 Ga0373931_0092085
854 Ga0373935_0019056
855 Ga0373935_0171508
856 Ga0373935_0258162
857 Ga0373927_0061697
858 Ga0373947_0020413
859 Ga0373947_0063596
860 Ga0373947_0069661
861 Ga0373947_0070429
862 Ga0373947_0092756
863 Ga0373937_0108184
864 Ga0373937_0201826
865 Ga0373937_0681026
866 Ga0373925_0080472
867 Ga0373925_0082200
868 Ga0373925_0114930
869 Ga0395900_0028588
870 Ga0395900_0042580
871 Ga0395900_0485182
872 Ga0395898_0011613
873 Ga0395898_0090973
874 Ga0395898_0380719
875 Ga0395905_0022061
876 Ga0395905_0371876
877 Ga0395901_0012003
878 Ga0395901_0067110
879 Ga0395901_0197525
880 Ga0436363_1619763
881 Ga0439460_0023340
882 Ga0439460_0026381
883 Ga0466967_0052290
884 Ga0495629_0102349
885 Ga0495629_0168794
886 Ga0495651_0214119
887 Ga0495580_0043064
888 Ga0495664_0083381
889 Ga0495628_0005359
890 Ga0495630_0118851
891 Ga0495652_0036915
892 Ga0495652_0238349
893 Ga0495640_0336040
894 Ga0495587_0117343
895 Ga0495598_0020138
896 Ga0495645_0001617
897 Ga0495634_0075731
898 Ga0495635_0143985
899 Ga0495623_0049182
900 Ga0495646_0073305
901 Ga0495613_0321259
902 Ga0495581_0069799
903 Ga0495680_0292203
904 Ga0495675_0134518
905 Ga0495675_0223403
906 Ga0495684_0047592
907 Ga0496100_0392676
908 Ga0496101_0030791
909 Ga0496101_0098362
910 Ga0496101_0165449
911 Ga0496102_0017672
912 Ga0496102_0051172
913 Ga0496103_0028741
914 Ga0496104_0042867
915 Ga0496104_0077516
916 Ga0496105_0007798
917 Ga0496105_0076773
918 Ga0496105_0156844
919 Ga0496105_0261738
920 Ga0496106_0022242
921 Ga0496106_0259333
922 Ga0496107_0001627
923 Ga0496107_0131159
924 Ga0496108_0103296
925 Ga0496109_0002248
926 Ga0496109_0007629
927 Ga0496109_0074183
928 Ga0496109_0080303
929 Ga0496109_0166517
930 Ga0496109_0195875
931 Ga0496110_0049527
932 Ga0496110_0102569
933 Ga0496110_0422076
934 Ga0496111_0080202
935 Ga0496111_0080419
936 Ga0496112_0010156
937 Ga0496112_0047743
938 Ga0496112_0239143
939 Ga0496112_0328341
940 Ga0496112_0479680
941 Ga0496112_0480771
942 Ga0496112_0483102
943 Ga0496112_0541423
944 Ga0496113_0010758
945 Ga0496113_0091852
946 Ga0496113_0118579
947 Ga0496113_0634455
948 Ga0496114_0008749
949 Ga0496114_0237239
950 Ga0496115_0002792
951 Ga0496115_0009956
952 Ga0496115_0039753
953 Ga0496115_0080274
954 Ga0501069_0394981
955 nmdc:mga05p37_16502_c1
956 nmdc:mga05p37_205125_c1
957 nmdc:mga08y16_526342_c1
958 nmdc:mga0n895_153359_c1
959 nmdc:mga0n895_347153_c1
960 nmdc:mga08x19_179206_c1
961 nmdc:mga08x19_35004_c1
962 Ga0495601_0001406
963 Ga0495595_0241826
964 Ga0495619_0261090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

35

278

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8868 1 263
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8762 2 261
6juy-assembly1.cif.gz_B crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8754 2 263
6lrh-assembly1.cif.gz_B crystal structure of the binary complex of agre c264a mutant with l-arginine 0.8741 1 265
6lrg-assembly1.cif.gz_B-2 crystal structure of the ternary complex of agre with ornithine and nad+ 0.8738 1 261
ID Description Score Start End Superfamily
af_Q23042_14_281_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8817 1 260 3.75.10.10
af_P71889_53_299_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.877 16 260 3.75.10.10
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8736 2 261 3.75.10.10
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8614 2 261 3.75.10.10
af_P71889_53_299_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8607 16 260 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A2V5M766-F1-model_v4 Amidinotransferase 0.9627 119 199 GO:0016740
AF-A0A2V5M766-F1-model_v4 Amidinotransferase 0.9513 119 199 GO:0016740
AF-A0A1F7RTV6-F1-model_v4 Amidinotransferase 0.9247 66 248
AF-A0A2V5XTA4-F1-model_v4 Amidinotransferase 0.9232 64 269 GO:0016740
AF-A0A1Q7TCW6-F1-model_v4 Amidinotransferase 0.918 1 234 GO:0016740

Map