F452598

General Info

Members Datasets Scaffolds Average Seq Length
482 210 964 246

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10025974|Ga0111539_100259744
Length 257
Sequence MIIVCQKCATRLQVDEEKSPARPFNVRCPKCNATVSSGVASPASEHGALAVGGSPSTEHPRFEQNTARAYEPAATVSSNGENGATITDGSVRMLMDLLSKGSTNRAPEHPGARPAWDQRKALVCAAENYRDTVARHLTQSGYQVFVAEDTRQAIETMRSNKMDVVLLEPQFDPAEQGSAFVIREINVLRPPQRRRMFFVLISPSLRTMDAHAAFLSNVNLVVNVADVDELHRIMDVALREYNELYRDFNAAFNLTAL

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
179 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
186 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
187 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
188 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
194 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
197 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
200 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
201 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
202 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.32
Rhizosphere 96.68
Stem 0
Stem Tuber 0
Unclassified 13.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10025974 3300009094 Bacteria 7168
2 SwRhRL3b_contig_4022357 2162886006 Unclassified 1075
3 MBSR1b_contig_2495450 2162886012 Bacteria 1303
4 JGI24751J29686_10000003 3300002459 Bacteria 157815
5 JGI25406J46586_10039653 3300003203 Unclassified 1676
6 Ga0065714_10064425 3300005288 Bacteria 189652
7 Ga0065704_10126331 3300005289 Bacteria 1691
8 Ga0065712_10003451 3300005290 Bacteria 4195
9 Ga0065712_10067727 3300005290 Bacteria 189643
10 Ga0065712_10097124 3300005290 Bacteria 2160
11 Ga0065712_10114630 3300005290 Bacteria 1764
12 Ga0065715_10002390 3300005293 Bacteria 7903
13 Ga0065715_10089680 3300005293 Bacteria 8941
14 Ga0065715_10106361 3300005293 Unclassified 2835
15 Ga0065715_10113389 3300005293 Bacteria 2479
16 Ga0065715_10148591 3300005293 Bacteria 1757
17 Ga0065715_10165680 3300005293 Bacteria 1589
18 Ga0065707_10005126 3300005295 Bacteria 3510
19 Ga0065707_10097468 3300005295 Bacteria 3163
20 Ga0070690_100002542 3300005330 Bacteria 9819
21 Ga0070670_100000167 3300005331 Bacteria 59452
22 Ga0070670_100020157 3300005331 Bacteria 5728
23 Ga0070670_100071306 3300005331 Bacteria 2983
24 Ga0070670_100354481 3300005331 Unclassified 1289
25 Ga0070670_100855378 3300005331 Unclassified 823
26 Ga0070670_100952038 3300005331 Unclassified 780
27 Ga0068869_100003991 3300005334 Bacteria 9122
28 Ga0068869_100010114 3300005334 Bacteria 6139
29 Ga0068869_100066775 3300005334 Bacteria 2651
30 Ga0068869_100273548 3300005334 Bacteria 1356
31 Ga0068869_100596539 3300005334 Bacteria 932
32 Ga0068869_100654764 3300005334 Bacteria 892
33 Ga0070680_100005302 3300005336 Bacteria 9753
34 Ga0070680_100058302 3300005336 Bacteria 3158
35 Ga0070680_100464677 3300005336 Unclassified 1081
36 Ga0068868_100031212 3300005338 Bacteria 4091
37 Ga0068868_100084728 3300005338 Bacteria 2546
38 Ga0070689_100001217 3300005340 Bacteria 16325
39 Ga0070689_100008748 3300005340 Bacteria 7146
40 Ga0070689_100595034 3300005340 Unclassified 957
41 Ga0070687_100286145 3300005343 Bacteria 1040
42 Ga0070692_10012822 3300005345 Bacteria 3894
43 Ga0070692_10104566 3300005345 Bacteria 1557
44 Ga0070692_10132526 3300005345 Bacteria 1402
45 Ga0070692_10151298 3300005345 Bacteria 1322
46 Ga0070668_100234966 3300005347 Bacteria 1517
47 Ga0070669_100017674 3300005353 Bacteria 5088
48 Ga0070675_100175535 3300005354 Bacteria 1850
49 Ga0070675_100207660 3300005354 Bacteria 1701
50 Ga0070671_100010271 3300005355 Bacteria 7514
51 Ga0070671_100130192 3300005355 Bacteria 2119
52 Ga0070673_100006236 3300005364 Bacteria 7730
53 Ga0070673_100040577 3300005364 Bacteria 3572
54 Ga0070673_100064073 3300005364 Bacteria 2927
55 Ga0070673_100131164 3300005364 Bacteria 2103
56 Ga0070673_100315106 3300005364 Unclassified 1381
57 Ga0070673_100428830 3300005364 Bacteria 1186
58 Ga0070688_100061678 3300005365 Bacteria 2371
59 Ga0070659_100000353 3300005366 Bacteria 35063
60 Ga0070659_100106920 3300005366 Bacteria 2256
61 Ga0070667_100057130 3300005367 Bacteria 3297
62 Ga0070667_100242958 3300005367 Bacteria 1608
63 Ga0070701_10051027 3300005438 Bacteria 2145
64 Ga0070701_10145164 3300005438 Bacteria 1361
65 Ga0070705_100018971 3300005440 Bacteria 3613
66 Ga0070705_100240522 3300005440 Bacteria 1265
67 Ga0070700_100000426 3300005441 Bacteria 21450
68 Ga0070700_100021379 3300005441 Bacteria 3760
69 Ga0070694_100008924 3300005444 Bacteria 6142
70 Ga0070694_100025903 3300005444 Bacteria 3798
71 Ga0070694_100053063 3300005444 Bacteria 2742
72 Ga0070708_100000200 3300005445 Bacteria 43782
73 Ga0070708_100048471 3300005445 Bacteria 3755
74 Ga0070678_100366189 3300005456 Bacteria 1243
75 Ga0070662_100068040 3300005457 Bacteria 2617
76 Ga0070662_100197290 3300005457 Bacteria 1595
77 Ga0070681_10000103 3300005458 Bacteria 63054
78 Ga0070681_10002024 3300005458 Bacteria 18349
79 Ga0070681_10010542 3300005458 Bacteria 9126
80 Ga0070681_10017969 3300005458 Bacteria 7067
81 Ga0070681_10346050 3300005458 Bacteria 1397
82 Ga0068867_100010337 3300005459 Bacteria 6584
83 Ga0070685_10089640 3300005466 Bacteria 1859
84 Ga0070685_10195836 3300005466 Bacteria 1310
85 Ga0070706_100260149 3300005467 Unclassified 1620
86 Ga0070707_100019896 3300005468 Bacteria 6327
87 Ga0070698_100001782 3300005471 Bacteria 23961
88 Ga0070698_100014516 3300005471 Bacteria 8316
89 Ga0070698_100156669 3300005471 Bacteria 2223
90 Ga0070699_100001150 3300005518 Bacteria 24554
91 Ga0070699_100026342 3300005518 Bacteria 5015
92 Ga0070699_100062578 3300005518 Bacteria 3225
93 Ga0070679_100000492 3300005530 Bacteria 33622
94 Ga0070679_100211403 3300005530 Unclassified 1904
95 Ga0070697_100069911 3300005536 Bacteria 2877
96 Ga0070697_100105253 3300005536 Unclassified 2347
97 Ga0070697_100362964 3300005536 Bacteria 1252
98 Ga0070697_100413600 3300005536 Unclassified 1171
99 Ga0068853_100048220 3300005539 Bacteria 3658
100 Ga0068853_100071249 3300005539 Bacteria 3026
101 Ga0068853_100145536 3300005539 Bacteria 2129
102 Ga0068853_100454154 3300005539 Bacteria 1205
103 Ga0070672_100008885 3300005543 Bacteria 6901
104 Ga0070672_100056632 3300005543 Bacteria 3075
105 Ga0070672_100136371 3300005543 Unclassified 2021
106 Ga0070686_100097273 3300005544 Bacteria 1981
107 Ga0070695_100040334 3300005545 Bacteria 2955
108 Ga0070695_100082947 3300005545 Bacteria 2123
109 Ga0070695_100129272 3300005545 Bacteria 1739
110 Ga0070695_100210575 3300005545 Bacteria 1395
111 Ga0070696_100031285 3300005546 Bacteria 3646
112 Ga0070696_100080329 3300005546 Bacteria 2308
113 Ga0070696_100109865 3300005546 Bacteria 1985
114 Ga0070696_100142236 3300005546 Bacteria 1754
115 Ga0070696_100414212 3300005546 Unclassified 1057
116 Ga0070693_100029326 3300005547 Bacteria 3000
117 Ga0070704_100038804 3300005549 Bacteria 3266
118 Ga0070704_100251091 3300005549 Unclassified 1453
119 Ga0070704_100344972 3300005549 Bacteria 1255
120 Ga0070704_100470077 3300005549 Bacteria 1086
121 Ga0070664_100000399 3300005564 Bacteria 32416
122 Ga0068857_100000175 3300005577 Bacteria 40688
123 Ga0068857_100160710 3300005577 Bacteria 2038
124 Ga0068857_100209491 3300005577 Bacteria 1778
125 Ga0068854_100443166 3300005578 Bacteria 1083
126 Ga0068856_100001146 3300005614 Bacteria 27859
127 Ga0068856_100123545 3300005614 Bacteria 2591
128 Ga0068856_100365238 3300005614 Bacteria 1462
129 Ga0070702_100003556 3300005615 Bacteria 6988
130 Ga0070702_100006283 3300005615 Bacteria 5612
131 Ga0068852_100129725 3300005616 Bacteria 2320
132 Ga0068859_100000994 3300005617 Bacteria 29030
133 Ga0068859_100023721 3300005617 Bacteria 6157
134 Ga0068859_100078506 3300005617 Bacteria 3341
135 Ga0068859_100149197 3300005617 Bacteria 2414
136 Ga0068859_100309015 3300005617 Bacteria 1674
137 Ga0068859_100551344 3300005617 Unclassified 1247
138 Ga0068859_100734761 3300005617 Bacteria 1076
139 Ga0068864_100004772 3300005618 Bacteria 11107
140 Ga0068864_100006700 3300005618 Bacteria 9435
141 Ga0068864_100040438 3300005618 Bacteria 3989
142 Ga0068864_100149925 3300005618 Bacteria 2112
143 Ga0068864_100357364 3300005618 Bacteria 1380
144 Ga0068864_100546077 3300005618 Unclassified 1119
145 Ga0068866_10001172 3300005718 Bacteria 11472
146 Ga0068866_10147098 3300005718 Bacteria 1360
147 Ga0068861_100005082 3300005719 Bacteria 8875
148 Ga0068861_100011402 3300005719 Bacteria 6178
149 Ga0068861_100026750 3300005719 Bacteria 4197
150 Ga0068861_100214263 3300005719 Bacteria 1624
151 Ga0068870_10009101 3300005840 Bacteria 4499
152 Ga0068870_10012076 3300005840 Bacteria 4025
153 Ga0068863_100050162 3300005841 Bacteria 3957
154 Ga0068858_100091253 3300005842 Bacteria 2835
155 Ga0068858_100126975 3300005842 Bacteria 2389
156 Ga0068858_100317162 3300005842 Bacteria 1489
157 Ga0068860_100039213 3300005843 Bacteria 4530
158 Ga0068860_100095452 3300005843 Bacteria 2834
159 Ga0068860_100142518 3300005843 Bacteria 2304
160 Ga0068860_100556447 3300005843 Unclassified 1150
161 Ga0068860_100739312 3300005843 Unclassified 995
162 Ga0068862_100007480 3300005844 Bacteria 9055
163 Ga0068862_100043019 3300005844 Bacteria 3850
164 Ga0068862_100069800 3300005844 Bacteria 3033
165 Ga0081539_10002144 3300005985 Bacteria 29163
166 Ga0081539_10014114 3300005985 Bacteria 5940
167 Ga0070716_100008888 3300006173 Bacteria 4995
168 Ga0070716_100419645 3300006173 Unclassified 967
169 Ga0097621_100004469 3300006237 Bacteria 9745
170 Ga0097621_100007943 3300006237 Bacteria 7614
171 Ga0097621_100013473 3300006237 Bacteria 6096
172 Ga0097621_100221782 3300006237 Bacteria 1648
173 Ga0097621_100231944 3300006237 Bacteria 1612
174 Ga0068871_100001307 3300006358 Bacteria 16665
175 Ga0068871_100005476 3300006358 Bacteria 8904
176 Ga0068871_100035614 3300006358 Unclassified 3957
177 Ga0068871_100043143 3300006358 Bacteria 3623
178 Ga0075428_100266233 3300006844 Bacteria 1845
179 Ga0075430_100055926 3300006846 Bacteria 3317
180 Ga0075433_10020603 3300006852 Bacteria 5519
181 Ga0075433_10030942 3300006852 Bacteria 4570
182 Ga0075433_10045364 3300006852 Bacteria 3821
183 Ga0075433_10046666 3300006852 Unclassified 3768
184 Ga0075433_10088533 3300006852 Bacteria 2736
185 Ga0075433_10358980 3300006852 Bacteria 1287
186 Ga0075434_100131122 3300006871 Bacteria 2525
187 Ga0075434_100184989 3300006871 Bacteria 2104
188 Ga0075434_100430831 3300006871 Bacteria 1340
189 Ga0075434_100525700 3300006871 Bacteria 1203
190 Ga0075429_100200666 3300006880 Bacteria 1747
191 Ga0075436_100115989 3300006914 Bacteria 1871
192 Ga0097620_100000994 3300006931 Bacteria 29030
193 Ga0097620_100023722 3300006931 Bacteria 6157
194 Ga0097620_100078512 3300006931 Bacteria 3341
195 Ga0097620_100149187 3300006931 Bacteria 2414
196 Ga0097620_100309029 3300006931 Bacteria 1674
197 Ga0097620_100551394 3300006931 Unclassified 1247
198 Ga0097620_100734750 3300006931 Bacteria 1076
199 Ga0075435_100143921 3300007076 Bacteria 2001
200 Ga0111539_10101155 3300009094 Bacteria 3384
201 Ga0111539_10124598 3300009094 Bacteria 3020
202 Ga0105245_10008436 3300009098 Bacteria 8999
203 Ga0105247_10306786 3300009101 Bacteria 1103
204 Ga0114129_10019683 3300009147 Bacteria 9607
205 Ga0114129_10176732 3300009147 Bacteria 2908
206 Ga0114129_10319900 3300009147 Bacteria 2063
207 Ga0114129_10734635 3300009147 Bacteria 1265
208 Ga0114129_11024266 3300009147 Bacteria 1038
209 Ga0105243_10390146 3300009148 Bacteria 1290
210 Ga0105243_10586126 3300009148 Bacteria 1071
211 Ga0105241_10088718 3300009174 Bacteria 2436
212 Ga0105241_10398901 3300009174 Unclassified 1206
213 Ga0105241_10742436 3300009174 Unclassified 899
214 Ga0105248_10005745 3300009177 Bacteria 13628
215 Ga0105248_10007586 3300009177 Bacteria 11917
216 Ga0105248_10014806 3300009177 Bacteria 8591
217 Ga0105248_10030455 3300009177 Bacteria 6024
218 Ga0105248_10036256 3300009177 Bacteria 5515
219 Ga0105248_10042610 3300009177 Bacteria 5091
220 Ga0105248_10322155 3300009177 Unclassified 1741
221 Ga0105237_10057378 3300009545 Bacteria 3897
222 Ga0105237_10189198 3300009545 Bacteria 2059
223 Ga0105237_10423322 3300009545 Bacteria 1337
224 Ga0105238_10023957 3300009551 Bacteria 6223
225 Ga0105249_10023501 3300009553 Bacteria 5531
226 Ga0105249_10085182 3300009553 Bacteria 2944
227 Ga0105249_10086802 3300009553 Bacteria 2918
228 Ga0105239_10013715 3300010375 Bacteria 8999
229 Ga0105239_10283141 3300010375 Bacteria 1866
230 Ga0105239_10380513 3300010375 Unclassified 1596
231 Ga0105246_10164700 3300011119 Bacteria 1692
232 Ga0157373_10011160 3300013100 Bacteria 6611
233 Ga0157373_10198448 3300013100 Bacteria 1414
234 Ga0157373_10294219 3300013100 Bacteria 1152
235 Ga0157374_10081210 3300013296 Bacteria 3076
236 Ga0157374_10203152 3300013296 Bacteria 1941
237 Ga0157378_10001815 3300013297 Bacteria 19141
238 Ga0157378_10056973 3300013297 Unclassified 3483
239 Ga0157378_10208054 3300013297 Bacteria 1854
240 Ga0163162_10008085 3300013306 Bacteria 10266
241 Ga0163162_10123147 3300013306 Bacteria 2698
242 Ga0163162_10751354 3300013306 Unclassified 1094
243 Ga0157372_10572012 3300013307 Bacteria 1317
244 Ga0157375_10005710 3300013308 Bacteria 10825
245 Ga0157375_10263514 3300013308 Bacteria 1885
246 Ga0157375_10420909 3300013308 Unclassified 1502
247 Ga0157375_10984100 3300013308 Bacteria 984
248 Ga0163163_10000298 3300014325 Bacteria 49128
249 Ga0163163_10000801 3300014325 Bacteria 26677
250 Ga0163163_10001930 3300014325 Bacteria 17559
251 Ga0163163_10029517 3300014325 Bacteria 5276
252 Ga0163163_10032454 3300014325 Bacteria 5043
253 Ga0163163_10074006 3300014325 Unclassified 3397
254 Ga0163163_10242628 3300014325 Bacteria 1852
255 Ga0157380_10000312 3300014326 Bacteria 29376
256 Ga0157380_10012132 3300014326 Bacteria 6238
257 Ga0157380_10188513 3300014326 Bacteria 1818
258 Ga0157377_10005476 3300014745 Bacteria 5970
259 Ga0157377_10057401 3300014745 Bacteria 2213
260 Ga0157377_10202882 3300014745 Bacteria 1260
261 Ga0157379_10075934 3300014968 Bacteria 3009
262 Ga0157376_10016582 3300014969 Bacteria 5597
263 Ga0157376_10042235 3300014969 Bacteria 3737
264 Ga0163161_10013529 3300017792 Bacteria 5681
265 Ga0207697_10018916 3300025315 Bacteria 2823
266 Ga0207647_10001353 3300025904 Bacteria 18823
267 Ga0207647_10245968 3300025904 Unclassified 1027
268 Ga0207643_10005581 3300025908 Bacteria 6722
269 Ga0207643_10097539 3300025908 Bacteria 1720
270 Ga0207684_10216431 3300025910 Unclassified 1653
271 Ga0207654_10155565 3300025911 Unclassified 1472
272 Ga0207707_10000033 3300025912 Bacteria 158362
273 Ga0207707_10011347 3300025912 Bacteria 7757
274 Ga0207707_10419656 3300025912 Unclassified 1147
275 Ga0207671_10041781 3300025914 Bacteria 3394
276 Ga0207671_10091267 3300025914 Bacteria 2295
277 Ga0207660_10000364 3300025917 Bacteria 29558
278 Ga0207660_10040394 3300025917 Bacteria 3266
279 Ga0207660_10718394 3300025917 Unclassified 815
280 Ga0207662_10041902 3300025918 Bacteria 2697
281 Ga0207662_10042508 3300025918 Bacteria 2679
282 Ga0207662_10127811 3300025918 Bacteria 1599
283 Ga0207652_10000032 3300025921 Bacteria 143319
284 Ga0207652_10526530 3300025921 Bacteria 1063
285 Ga0207646_10146783 3300025922 Bacteria 2126
286 Ga0207681_10061649 3300025923 Bacteria 2579
287 Ga0207681_10573390 3300025923 Unclassified 930
288 Ga0207681_10656839 3300025923 Bacteria 870
289 Ga0207694_10051892 3300025924 Bacteria 3179
290 Ga0207650_10000007 3300025925 Bacteria 530810
291 Ga0207650_10062286 3300025925 Bacteria 2787
292 Ga0207650_10156508 3300025925 Bacteria 1802
293 Ga0207659_10269108 3300025926 Bacteria 1389
294 Ga0207644_10015494 3300025931 Bacteria 5119
295 Ga0207644_10030083 3300025931 Bacteria 3772
296 Ga0207644_10105625 3300025931 Bacteria 2122
297 Ga0207644_10203085 3300025931 Bacteria 1564
298 Ga0207690_10001726 3300025932 Bacteria 13434
299 Ga0207706_10199253 3300025933 Bacteria 1756
300 Ga0207686_10007822 3300025934 Bacteria 5762
301 Ga0207709_10051637 3300025935 Bacteria 2521
302 Ga0207709_10137873 3300025935 Bacteria 1673
303 Ga0207709_10250020 3300025935 Bacteria 1294
304 Ga0207670_10021411 3300025936 Bacteria 3989
305 Ga0207670_10061061 3300025936 Bacteria 2570
306 Ga0207704_10089928 3300025938 Bacteria 2013
307 Ga0207704_10611287 3300025938 Unclassified 893
308 Ga0207665_10018584 3300025939 Bacteria 4567
309 Ga0207691_10000991 3300025940 Bacteria 28224
310 Ga0207691_10135213 3300025940 Bacteria 2175
311 Ga0207711_10004098 3300025941 Bacteria 12495
312 Ga0207711_10004633 3300025941 Bacteria 11686
313 Ga0207711_10010700 3300025941 Bacteria 7629
314 Ga0207711_10016776 3300025941 Bacteria 6081
315 Ga0207711_10065163 3300025941 Bacteria 3149
316 Ga0207689_10000395 3300025942 Bacteria 40984
317 Ga0207689_10038218 3300025942 Bacteria 3977
318 Ga0207689_10056170 3300025942 Bacteria 3239
319 Ga0207689_10566364 3300025942 Unclassified 955
320 Ga0207689_10572889 3300025942 Bacteria 949
321 Ga0207661_10877308 3300025944 Unclassified 826
322 Ga0207679_10005164 3300025945 Bacteria 8177
323 Ga0207679_10364941 3300025945 Bacteria 1262
324 Ga0207679_10472293 3300025945 Bacteria 1115
325 Ga0207651_10002568 3300025960 Bacteria 8678
326 Ga0207651_10051428 3300025960 Bacteria 2803
327 Ga0207651_10068103 3300025960 Bacteria 2508
328 Ga0207712_10012212 3300025961 Bacteria 5488
329 Ga0207712_10014977 3300025961 Bacteria 4996
330 Ga0207712_10187285 3300025961 Bacteria 1631
331 Ga0207668_10069310 3300025972 Bacteria 2511
332 Ga0207640_10353292 3300025981 Bacteria 1182
333 Ga0207640_10415955 3300025981 Unclassified 1099
334 Ga0207658_10109493 3300025986 Bacteria 2181
335 Ga0207677_10059280 3300026023 Bacteria 2639
336 Ga0207677_10074381 3300026023 Bacteria 2410
337 Ga0207677_10123242 3300026023 Bacteria 1954
338 Ga0207703_10025753 3300026035 Bacteria 4629
339 Ga0207703_10425903 3300026035 Bacteria 1236
340 Ga0207639_10009780 3300026041 Bacteria 6627
341 Ga0207639_10072043 3300026041 Bacteria 2705
342 Ga0207639_10122265 3300026041 Bacteria 2140
343 Ga0207708_10000096 3300026075 Bacteria 67574
344 Ga0207708_10001571 3300026075 Bacteria 17065
345 Ga0207708_10009543 3300026075 Bacteria 7194
346 Ga0207708_10025532 3300026075 Bacteria 4471
347 Ga0207708_10236296 3300026075 Bacteria 1469
348 Ga0207708_10397459 3300026075 Bacteria 1139
349 Ga0207702_10009860 3300026078 Bacteria 8005
350 Ga0207702_10175866 3300026078 Bacteria 1967
351 Ga0207641_10045350 3300026088 Bacteria 3701
352 Ga0207641_10184003 3300026088 Bacteria 1915
353 Ga0207641_10424220 3300026088 Archaea 1281
354 Ga0207648_10001293 3300026089 Bacteria 27927
355 Ga0207648_10238696 3300026089 Bacteria 1618
356 Ga0207676_10005526 3300026095 Bacteria 8946
357 Ga0207676_10013310 3300026095 Bacteria 5909
358 Ga0207676_10200578 3300026095 Bacteria 1762
359 Ga0207676_10221854 3300026095 Bacteria 1684
360 Ga0207674_10000058 3300026116 Bacteria 113012
361 Ga0207674_10011190 3300026116 Bacteria 10086
362 Ga0207674_10088480 3300026116 Bacteria 3090
363 Ga0207674_10317624 3300026116 Bacteria 1507
364 Ga0207675_100001711 3300026118 Bacteria 21971
365 Ga0207675_100018458 3300026118 Bacteria 6505
366 Ga0207675_100157888 3300026118 Bacteria 2162
367 Ga0207675_100455812 3300026118 Bacteria 1268
368 Ga0207683_10354051 3300026121 Bacteria 1348
369 Ga0207698_10203350 3300026142 Bacteria 1775
370 Ga0207428_10449208 3300027907 Unclassified 940
371 Ga0268265_10063969 3300028380 Bacteria 2832
372 Ga0268265_10225088 3300028380 Bacteria 1644
373 Ga0268264_10069614 3300028381 Bacteria 2976
374 Ga0268264_10121307 3300028381 Bacteria 2304
375 Ga0268264_10161329 3300028381 Bacteria 2020
376 Ga0268264_10192821 3300028381 Bacteria 1858
377 Ga0307408_100005184 3300031548 Bacteria 8742
378 Ga0307408_100348048 3300031548 Bacteria 1257
379 Ga0307413_10004984 3300031824 Bacteria 5857
380 Ga0307410_10043813 3300031852 Bacteria 2968
381 Ga0307410_10145074 3300031852 Bacteria 1761
382 Ga0307406_10013913 3300031901 Bacteria 4619
383 Ga0307406_10505104 3300031901 Unclassified 981
384 Ga0307407_10074995 3300031903 Bacteria 2026
385 Ga0307412_10128240 3300031911 Bacteria 1838
386 Ga0307409_100057181 3300031995 Bacteria 3021
387 Ga0307409_100242707 3300031995 Bacteria 1641
388 Ga0307416_100047139 3300032002 Bacteria 3408
389 Ga0307414_10077116 3300032004 Bacteria 2424
390 Ga0307414_10083542 3300032004 Bacteria 2345
391 Ga0307411_10033887 3300032005 Bacteria 3172
392 Ga0307411_10072613 3300032005 Bacteria 2337
393 Ga0307411_10302913 3300032005 Bacteria 1282
394 Ga0307415_100000463 3300032126 Bacteria 17506
395 Ga0373951_0066623 3300035091 Bacteria 910
396 Ga0373941_0004376 3300035115 Bacteria 3260
397 Ga0373942_0006503 3300035207 Bacteria 2699
398 Ga0373942_0025731 3300035207 Bacteria 1519
399 Ga0395900_0103087 3300037418 Bacteria 2931
400 Ga0395900_0507940 3300037418 Bacteria 1155
401 Ga0395898_0134618 3300037466 Bacteria 2366
402 Ga0395901_0037345 3300038443 Bacteria 5024
403 Ga0395901_0239123 3300038443 Bacteria 1894
404 Ga0453683_0245367 3300044673 Bacteria 1141
405 Ga0451576_0334610 3300045051 Bacteria 1585
406 Ga0495643_0144639 3300046522 Bacteria 1182
407 Ga0496103_0190888 3300048906 Bacteria 1317
408 Ga0496104_0138421 3300048907 Bacteria 2339
409 Ga0496104_0508077 3300048907 Bacteria 1116
410 Ga0496106_0047596 3300048909 Unclassified 3228
411 Ga0496107_0785276 3300048910 Unclassified 698
412 Ga0496108_0102898 3300048911 Bacteria 2437
413 Ga0496108_0348954 3300048911 Bacteria 1291
414 Ga0496109_0263144 3300048912 Bacteria 1625
415 Ga0496110_0170082 3300048913 Bacteria 1977
416 Ga0496111_0596433 3300048914 Viruses 809
417 Ga0496112_0060470 3300048915 Bacteria 3734
418 Ga0496112_0155732 3300048915 Bacteria 2252
419 Ga0496112_0594184 3300048915 Bacteria 1039
420 Ga0496112_0905560 3300048915 Unclassified 804
421 Ga0496113_0544775 3300048916 Unclassified 931
422 Ga0496113_0632756 3300048916 Unclassified 856
423 Ga0501292_001435 3300049515 Bacteria 2937
424 Ga0501292_002665 3300049515 Bacteria 2322
425 Ga0501298_006539 3300049521 Bacteria 1908
426 Ga0501298_018069 3300049521 Unclassified 1293
427 Ga0501298_041038 3300049521 Bacteria 938
428 Ga0501038_0013221 3300049574 Bacteria 7528
429 Ga0501041_0156850 3300049577 Unclassified 1422
430 Ga0501042_0182085 3300049578 Bacteria 1516
431 Ga0501198_004744 3300049649 Unclassified 1896
432 Ga0501198_005023 3300049649 Bacteria 1852
433 Ga0501202_001312 3300049652 Bacteria 3946
434 Ga0501209_013956 3300049656 Bacteria 1753
435 Ga0501216_004685 3300049660 Bacteria 2034
436 Ga0501216_008298 3300049660 Bacteria 1632
437 Ga0501223_001755 3300049663 Bacteria 4922
438 Ga0501224_004014 3300049664 Bacteria 2073
439 Ga0501235_004214 3300049669 Bacteria 3116
440 Ga0501235_010204 3300049669 Bacteria 2053
441 Ga0501240_001344 3300049673 Unclassified 2364
442 Ga0501243_004425 3300049675 Bacteria 2104
443 Ga0501249_006421 3300049679 Bacteria 2417
444 Ga0501252_006408 3300049682 Unclassified 1308
445 Ga0501253_037309 3300049683 Unclassified 961
446 Ga0501257_011362 3300049686 Bacteria 2032
447 Ga0501257_017580 3300049686 Unclassified 1664
448 Ga0501258_004649 3300049687 Unclassified 1305
449 Ga0501261_004450 3300049690 Bacteria 1734
450 Ga0501225_0003728 3300049705 Bacteria 4586
451 Ga0501234_001068 3300049707 Bacteria 4332
452 Ga0501234_025500 3300049707 Bacteria 948
453 Ga0501245_013270 3300049708 Unclassified 1217
454 Ga0501279_004244 3300049775 Bacteria 1880
455 Ga0501279_026554 3300049775 Bacteria 845
456 Ga0501212_001297 3300049851 Bacteria 2785
457 nmdc:mga05p37_382619_c1 3300050507 Bacteria 1648
458 nmdc:mga05p37_427228_c1 3300050507 Bacteria 1540
459 nmdc:mga05p37_94813_c1 3300050507 Unclassified 3677
460 nmdc:mga05p37_987185_c1 3300050507 Bacteria 896
461 nmdc:mga09592_29561_c1 3300050508 Unclassified 4556
462 nmdc:mga06r32_329140_c1 3300050510 Bacteria 1513
463 nmdc:mga06r32_332512_c1 3300050510 Bacteria 1504
464 nmdc:mga08y16_136061_c1 3300050511 Unclassified 2554
465 nmdc:mga08y16_214552_c1 3300050511 Unclassified 1993
466 nmdc:mga08y16_34308_c1 3300050511 Bacteria 5331
467 nmdc:mga08y16_80398_c1 3300050511 Bacteria 3398
468 nmdc:mga0n895_139195_c1 3300050512 Bacteria 2455
469 nmdc:mga0n895_163353_c1 3300050512 Unclassified 2258
470 nmdc:mga0n895_239294_c1 3300050512 Bacteria 1842
471 nmdc:mga0n895_55014_c1 3300050512 Bacteria 3915
472 nmdc:mga0n895_64308_c1 3300050512 Bacteria 3628
473 nmdc:mga0n895_79245_c1 3300050512 Bacteria 3271
474 nmdc:mga08x19_154196_c1 3300050514 Bacteria 1557
475 nmdc:mga08x19_285430_c1 3300050514 Bacteria 1144
476 nmdc:mga0a205_172203_c1 3300050515 Bacteria 2061
477 nmdc:mga0a205_279158_c1 3300050515 Bacteria 1546
478 nmdc:mga0a205_381240_c1 3300050515 Unclassified 1275
479 nmdc:mga0a205_41981_c1 3300050515 Bacteria 4407
480 nmdc:mga0a205_487684_c1 3300050515 Bacteria 1090
481 nmdc:mga0a205_51961_c1 3300050515 Bacteria 3639
482 Ga0501084_0106093 3300054114 Bacteria 2360
483 Ga0111539_10025974
484 SwRhRL3b_contig_4022357
485 MBSR1b_contig_2495450
486 JGI24751J29686_10000003
487 JGI25406J46586_10039653
488 Ga0065714_10064425
489 Ga0065704_10126331
490 Ga0065712_10003451
491 Ga0065712_10067727
492 Ga0065712_10097124
493 Ga0065712_10114630
494 Ga0065715_10002390
495 Ga0065715_10089680
496 Ga0065715_10106361
497 Ga0065715_10113389
498 Ga0065715_10148591
499 Ga0065715_10165680
500 Ga0065707_10005126
501 Ga0065707_10097468
502 Ga0070690_100002542
503 Ga0070670_100000167
504 Ga0070670_100020157
505 Ga0070670_100071306
506 Ga0070670_100354481
507 Ga0070670_100855378
508 Ga0070670_100952038
509 Ga0068869_100003991
510 Ga0068869_100010114
511 Ga0068869_100066775
512 Ga0068869_100273548
513 Ga0068869_100596539
514 Ga0068869_100654764
515 Ga0070680_100005302
516 Ga0070680_100058302
517 Ga0070680_100464677
518 Ga0068868_100031212
519 Ga0068868_100084728
520 Ga0070689_100001217
521 Ga0070689_100008748
522 Ga0070689_100595034
523 Ga0070687_100286145
524 Ga0070692_10012822
525 Ga0070692_10104566
526 Ga0070692_10132526
527 Ga0070692_10151298
528 Ga0070668_100234966
529 Ga0070669_100017674
530 Ga0070675_100175535
531 Ga0070675_100207660
532 Ga0070671_100010271
533 Ga0070671_100130192
534 Ga0070673_100006236
535 Ga0070673_100040577
536 Ga0070673_100064073
537 Ga0070673_100131164
538 Ga0070673_100315106
539 Ga0070673_100428830
540 Ga0070688_100061678
541 Ga0070659_100000353
542 Ga0070659_100106920
543 Ga0070667_100057130
544 Ga0070667_100242958
545 Ga0070701_10051027
546 Ga0070701_10145164
547 Ga0070705_100018971
548 Ga0070705_100240522
549 Ga0070700_100000426
550 Ga0070700_100021379
551 Ga0070694_100008924
552 Ga0070694_100025903
553 Ga0070694_100053063
554 Ga0070708_100000200
555 Ga0070708_100048471
556 Ga0070678_100366189
557 Ga0070662_100068040
558 Ga0070662_100197290
559 Ga0070681_10000103
560 Ga0070681_10002024
561 Ga0070681_10010542
562 Ga0070681_10017969
563 Ga0070681_10346050
564 Ga0068867_100010337
565 Ga0070685_10089640
566 Ga0070685_10195836
567 Ga0070706_100260149
568 Ga0070707_100019896
569 Ga0070698_100001782
570 Ga0070698_100014516
571 Ga0070698_100156669
572 Ga0070699_100001150
573 Ga0070699_100026342
574 Ga0070699_100062578
575 Ga0070679_100000492
576 Ga0070679_100211403
577 Ga0070697_100069911
578 Ga0070697_100105253
579 Ga0070697_100362964
580 Ga0070697_100413600
581 Ga0068853_100048220
582 Ga0068853_100071249
583 Ga0068853_100145536
584 Ga0068853_100454154
585 Ga0070672_100008885
586 Ga0070672_100056632
587 Ga0070672_100136371
588 Ga0070686_100097273
589 Ga0070695_100040334
590 Ga0070695_100082947
591 Ga0070695_100129272
592 Ga0070695_100210575
593 Ga0070696_100031285
594 Ga0070696_100080329
595 Ga0070696_100109865
596 Ga0070696_100142236
597 Ga0070696_100414212
598 Ga0070693_100029326
599 Ga0070704_100038804
600 Ga0070704_100251091
601 Ga0070704_100344972
602 Ga0070704_100470077
603 Ga0070664_100000399
604 Ga0068857_100000175
605 Ga0068857_100160710
606 Ga0068857_100209491
607 Ga0068854_100443166
608 Ga0068856_100001146
609 Ga0068856_100123545
610 Ga0068856_100365238
611 Ga0070702_100003556
612 Ga0070702_100006283
613 Ga0068852_100129725
614 Ga0068859_100000994
615 Ga0068859_100023721
616 Ga0068859_100078506
617 Ga0068859_100149197
618 Ga0068859_100309015
619 Ga0068859_100551344
620 Ga0068859_100734761
621 Ga0068864_100004772
622 Ga0068864_100006700
623 Ga0068864_100040438
624 Ga0068864_100149925
625 Ga0068864_100357364
626 Ga0068864_100546077
627 Ga0068866_10001172
628 Ga0068866_10147098
629 Ga0068861_100005082
630 Ga0068861_100011402
631 Ga0068861_100026750
632 Ga0068861_100214263
633 Ga0068870_10009101
634 Ga0068870_10012076
635 Ga0068863_100050162
636 Ga0068858_100091253
637 Ga0068858_100126975
638 Ga0068858_100317162
639 Ga0068860_100039213
640 Ga0068860_100095452
641 Ga0068860_100142518
642 Ga0068860_100556447
643 Ga0068860_100739312
644 Ga0068862_100007480
645 Ga0068862_100043019
646 Ga0068862_100069800
647 Ga0081539_10002144
648 Ga0081539_10014114
649 Ga0070716_100008888
650 Ga0070716_100419645
651 Ga0097621_100004469
652 Ga0097621_100007943
653 Ga0097621_100013473
654 Ga0097621_100221782
655 Ga0097621_100231944
656 Ga0068871_100001307
657 Ga0068871_100005476
658 Ga0068871_100035614
659 Ga0068871_100043143
660 Ga0075428_100266233
661 Ga0075430_100055926
662 Ga0075433_10020603
663 Ga0075433_10030942
664 Ga0075433_10045364
665 Ga0075433_10046666
666 Ga0075433_10088533
667 Ga0075433_10358980
668 Ga0075434_100131122
669 Ga0075434_100184989
670 Ga0075434_100430831
671 Ga0075434_100525700
672 Ga0075429_100200666
673 Ga0075436_100115989
674 Ga0097620_100000994
675 Ga0097620_100023722
676 Ga0097620_100078512
677 Ga0097620_100149187
678 Ga0097620_100309029
679 Ga0097620_100551394
680 Ga0097620_100734750
681 Ga0075435_100143921
682 Ga0111539_10101155
683 Ga0111539_10124598
684 Ga0105245_10008436
685 Ga0105247_10306786
686 Ga0114129_10019683
687 Ga0114129_10176732
688 Ga0114129_10319900
689 Ga0114129_10734635
690 Ga0114129_11024266
691 Ga0105243_10390146
692 Ga0105243_10586126
693 Ga0105241_10088718
694 Ga0105241_10398901
695 Ga0105241_10742436
696 Ga0105248_10005745
697 Ga0105248_10007586
698 Ga0105248_10014806
699 Ga0105248_10030455
700 Ga0105248_10036256
701 Ga0105248_10042610
702 Ga0105248_10322155
703 Ga0105237_10057378
704 Ga0105237_10189198
705 Ga0105237_10423322
706 Ga0105238_10023957
707 Ga0105249_10023501
708 Ga0105249_10085182
709 Ga0105249_10086802
710 Ga0105239_10013715
711 Ga0105239_10283141
712 Ga0105239_10380513
713 Ga0105246_10164700
714 Ga0157373_10011160
715 Ga0157373_10198448
716 Ga0157373_10294219
717 Ga0157374_10081210
718 Ga0157374_10203152
719 Ga0157378_10001815
720 Ga0157378_10056973
721 Ga0157378_10208054
722 Ga0163162_10008085
723 Ga0163162_10123147
724 Ga0163162_10751354
725 Ga0157372_10572012
726 Ga0157375_10005710
727 Ga0157375_10263514
728 Ga0157375_10420909
729 Ga0157375_10984100
730 Ga0163163_10000298
731 Ga0163163_10000801
732 Ga0163163_10001930
733 Ga0163163_10029517
734 Ga0163163_10032454
735 Ga0163163_10074006
736 Ga0163163_10242628
737 Ga0157380_10000312
738 Ga0157380_10012132
739 Ga0157380_10188513
740 Ga0157377_10005476
741 Ga0157377_10057401
742 Ga0157377_10202882
743 Ga0157379_10075934
744 Ga0157376_10016582
745 Ga0157376_10042235
746 Ga0163161_10013529
747 Ga0207697_10018916
748 Ga0207647_10001353
749 Ga0207647_10245968
750 Ga0207643_10005581
751 Ga0207643_10097539
752 Ga0207684_10216431
753 Ga0207654_10155565
754 Ga0207707_10000033
755 Ga0207707_10011347
756 Ga0207707_10419656
757 Ga0207671_10041781
758 Ga0207671_10091267
759 Ga0207660_10000364
760 Ga0207660_10040394
761 Ga0207660_10718394
762 Ga0207662_10041902
763 Ga0207662_10042508
764 Ga0207662_10127811
765 Ga0207652_10000032
766 Ga0207652_10526530
767 Ga0207646_10146783
768 Ga0207681_10061649
769 Ga0207681_10573390
770 Ga0207681_10656839
771 Ga0207694_10051892
772 Ga0207650_10000007
773 Ga0207650_10062286
774 Ga0207650_10156508
775 Ga0207659_10269108
776 Ga0207644_10015494
777 Ga0207644_10030083
778 Ga0207644_10105625
779 Ga0207644_10203085
780 Ga0207690_10001726
781 Ga0207706_10199253
782 Ga0207686_10007822
783 Ga0207709_10051637
784 Ga0207709_10137873
785 Ga0207709_10250020
786 Ga0207670_10021411
787 Ga0207670_10061061
788 Ga0207704_10089928
789 Ga0207704_10611287
790 Ga0207665_10018584
791 Ga0207691_10000991
792 Ga0207691_10135213
793 Ga0207711_10004098
794 Ga0207711_10004633
795 Ga0207711_10010700
796 Ga0207711_10016776
797 Ga0207711_10065163
798 Ga0207689_10000395
799 Ga0207689_10038218
800 Ga0207689_10056170
801 Ga0207689_10566364
802 Ga0207689_10572889
803 Ga0207661_10877308
804 Ga0207679_10005164
805 Ga0207679_10364941
806 Ga0207679_10472293
807 Ga0207651_10002568
808 Ga0207651_10051428
809 Ga0207651_10068103
810 Ga0207712_10012212
811 Ga0207712_10014977
812 Ga0207712_10187285
813 Ga0207668_10069310
814 Ga0207640_10353292
815 Ga0207640_10415955
816 Ga0207658_10109493
817 Ga0207677_10059280
818 Ga0207677_10074381
819 Ga0207677_10123242
820 Ga0207703_10025753
821 Ga0207703_10425903
822 Ga0207639_10009780
823 Ga0207639_10072043
824 Ga0207639_10122265
825 Ga0207708_10000096
826 Ga0207708_10001571
827 Ga0207708_10009543
828 Ga0207708_10025532
829 Ga0207708_10236296
830 Ga0207708_10397459
831 Ga0207702_10009860
832 Ga0207702_10175866
833 Ga0207641_10045350
834 Ga0207641_10184003
835 Ga0207641_10424220
836 Ga0207648_10001293
837 Ga0207648_10238696
838 Ga0207676_10005526
839 Ga0207676_10013310
840 Ga0207676_10200578
841 Ga0207676_10221854
842 Ga0207674_10000058
843 Ga0207674_10011190
844 Ga0207674_10088480
845 Ga0207674_10317624
846 Ga0207675_100001711
847 Ga0207675_100018458
848 Ga0207675_100157888
849 Ga0207675_100455812
850 Ga0207683_10354051
851 Ga0207698_10203350
852 Ga0207428_10449208
853 Ga0268265_10063969
854 Ga0268265_10225088
855 Ga0268264_10069614
856 Ga0268264_10121307
857 Ga0268264_10161329
858 Ga0268264_10192821
859 Ga0307408_100005184
860 Ga0307408_100348048
861 Ga0307413_10004984
862 Ga0307410_10043813
863 Ga0307410_10145074
864 Ga0307406_10013913
865 Ga0307406_10505104
866 Ga0307407_10074995
867 Ga0307412_10128240
868 Ga0307409_100057181
869 Ga0307409_100242707
870 Ga0307416_100047139
871 Ga0307414_10077116
872 Ga0307414_10083542
873 Ga0307411_10033887
874 Ga0307411_10072613
875 Ga0307411_10302913
876 Ga0307415_100000463
877 Ga0373951_0066623
878 Ga0373941_0004376
879 Ga0373942_0006503
880 Ga0373942_0025731
881 Ga0395900_0103087
882 Ga0395900_0507940
883 Ga0395898_0134618
884 Ga0395901_0037345
885 Ga0395901_0239123
886 Ga0453683_0245367
887 Ga0451576_0334610
888 Ga0495643_0144639
889 Ga0496103_0190888
890 Ga0496104_0138421
891 Ga0496104_0508077
892 Ga0496106_0047596
893 Ga0496107_0785276
894 Ga0496108_0102898
895 Ga0496108_0348954
896 Ga0496109_0263144
897 Ga0496110_0170082
898 Ga0496111_0596433
899 Ga0496112_0060470
900 Ga0496112_0155732
901 Ga0496112_0594184
902 Ga0496112_0905560
903 Ga0496113_0544775
904 Ga0496113_0632756
905 Ga0501292_001435
906 Ga0501292_002665
907 Ga0501298_006539
908 Ga0501298_018069
909 Ga0501298_041038
910 Ga0501038_0013221
911 Ga0501041_0156850
912 Ga0501042_0182085
913 Ga0501198_004744
914 Ga0501198_005023
915 Ga0501202_001312
916 Ga0501209_013956
917 Ga0501216_004685
918 Ga0501216_008298
919 Ga0501223_001755
920 Ga0501224_004014
921 Ga0501235_004214
922 Ga0501235_010204
923 Ga0501240_001344
924 Ga0501243_004425
925 Ga0501249_006421
926 Ga0501252_006408
927 Ga0501253_037309
928 Ga0501257_011362
929 Ga0501257_017580
930 Ga0501258_004649
931 Ga0501261_004450
932 Ga0501225_0003728
933 Ga0501234_001068
934 Ga0501234_025500
935 Ga0501245_013270
936 Ga0501279_004244
937 Ga0501279_026554
938 Ga0501212_001297
939 nmdc:mga05p37_382619_c1
940 nmdc:mga05p37_427228_c1
941 nmdc:mga05p37_94813_c1
942 nmdc:mga05p37_987185_c1
943 nmdc:mga09592_29561_c1
944 nmdc:mga06r32_329140_c1
945 nmdc:mga06r32_332512_c1
946 nmdc:mga08y16_136061_c1
947 nmdc:mga08y16_214552_c1
948 nmdc:mga08y16_34308_c1
949 nmdc:mga08y16_80398_c1
950 nmdc:mga0n895_139195_c1
951 nmdc:mga0n895_163353_c1
952 nmdc:mga0n895_239294_c1
953 nmdc:mga0n895_55014_c1
954 nmdc:mga0n895_64308_c1
955 nmdc:mga0n895_79245_c1
956 nmdc:mga08x19_154196_c1
957 nmdc:mga08x19_285430_c1
958 nmdc:mga0a205_172203_c1
959 nmdc:mga0a205_279158_c1
960 nmdc:mga0a205_381240_c1
961 nmdc:mga0a205_41981_c1
962 nmdc:mga0a205_487684_c1
963 nmdc:mga0a205_51961_c1
964 Ga0501084_0106093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13717

zinc_ribbon_4

zinc-ribbon domain

1

35

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.8626 115 235
1m5t-assembly1.cif.gz_A crystal structure of the response regulator divk 0.8528 117 236
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.851 117 236
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.851 117 236
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.8441 117 237
ID Description Score Start End Superfamily
3t6kB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8535 115 235 3.40.50.2300
af_A0A0R0KVT4_634_762_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.84 117 241 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8385 113 198 3.40.50.2300
2oqrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8368 117 200 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8368 118 198 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Q8A2P8-F1-model_v4 Response regulatory domain-containing protein 0.9114 120 255 GO:0000160
AF-A0A1Q8A2P8-F1-model_v4 Response regulatory domain-containing protein 0.8988 120 255 GO:0000160
AF-A0A2V8RHM0-F1-model_v4 Response regulatory domain-containing protein 0.8782 141 255 GO:0000160
AF-A0A2V8RHM0-F1-model_v4 Response regulatory domain-containing protein 0.871 141 255 GO:0000160
AF-A0A0S7YFT8-F1-model_v4 Response regulatory domain-containing protein 0.8617 117 236 GO:0000160
GO:0003677

Map