F452539

General Info

Members Datasets Scaffolds Average Seq Length
482 357 965 327

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10035930|rootH1_100359304
Length 346
Sequence MSHGNSSGSRSNLDRRTFLGASAASLVTAGIGLXXXRAAAADKVLLRLSSPATETDQRAVALTSVFGPAVADFATFEPHWNATLFKQGTELEAIARGNLEMSITSPQELATIIPAWSIFSAGYLLRDAEHQKKVFASSIMDGMKKDVEDQLGVKLLTVMYLGRRQLNLRMSKADKTVKTPADLNGVKLRMPGGDAWLFLGKALGANPVPVAFTEIYTSLQTGAIDGQDNPLPTDKDSKFYEVTKQICLTSHLVDQNYLAFSKKVWDGLSPDQQATVQKAADDAAESGRQKQLKLEDDLAQFFKDQGLDVYEPDIDAFRSHVQQAYLASDLAKDWPKGMVDQVNAIK

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
90 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
128 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
153 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
240 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
252 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
253 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
254 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
255 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
256 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
257 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
258 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
259 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
260 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
261 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
262 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
263 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
264 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
265 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
266 2643221580 Devosia sp. Root635 Isolate Unclassified
267 2643221591 Devosia sp. Root685 Isolate Unclassified
268 2643221618 Ensifer sp. Root231 Isolate Unclassified
269 2643221626 Ensifer sp. Root31 Isolate Unclassified
270 2643221629 Devosia sp. Root105 Isolate Unclassified
271 2643221655 Ensifer sp. Root1252 Isolate Unclassified
272 2643221659 Ensifer sp. Root127 Isolate Unclassified
273 2643221662 Devosia sp. Root413D1 Isolate Unclassified
274 2643221674 Devosia sp. Root436 Isolate Unclassified
275 2643221688 Rhizobium sp. Root482 Isolate Unclassified
276 2643221698 Ensifer sp. Root142 Isolate Unclassified
277 2643221712 Ensifer sp. Root258 Isolate Unclassified
278 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
279 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
280 2738543024 Aminobacter sp. AP02 Isolate Unclassified
281 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
282 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
283 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
284 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
285 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
286 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
287 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
288 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
289 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
290 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
291 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
292 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
293 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
294 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
295 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
296 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
297 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
298 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
299 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
300 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
301 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
302 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
303 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
304 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
305 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
306 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
307 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
308 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
309 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
310 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
311 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
312 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
313 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
314 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
315 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
316 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
317 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
318 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
319 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
320 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
321 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
322 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
323 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
324 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
325 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
326 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
327 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
328 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
329 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
330 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
331 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
332 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
333 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
334 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
335 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
336 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
337 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
338 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
339 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
340 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
341 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
342 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
343 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
344 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
345 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
346 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
347 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
348 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
349 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
350 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
351 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
352 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
353 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
354 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
355 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
356 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
357 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.76
Metatranscriptomes 0.41
Isolates 22.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.81
Nodule 18.26
Rhizoplane 1.66
Rhizosphere 66.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10035930 3300003316 Bacteria 3678
2 rootH1_10035930 3300003323 Bacteria 9579
3 rootH1_10056629 3300003323 Bacteria 3374
4 JGI26145J50221_1003577 3300003371 Bacteria 1241
5 Ga0065704_10011026 3300005289 Bacteria 2038
6 Ga0065715_10139502 3300005293 Bacteria 1875
7 Ga0070676_10065938 3300005328 Bacteria 2162
8 Ga0070690_100019686 3300005330 Bacteria 4102
9 Ga0070690_100125548 3300005330 Bacteria 1727
10 Ga0070670_100005195 3300005331 Bacteria 10960
11 Ga0068869_100003269 3300005334 Bacteria 9895
12 Ga0068869_100003339 3300005334 Bacteria 9801
13 Ga0070680_100001207 3300005336 Bacteria 18617
14 Ga0068868_100003224 3300005338 Bacteria 11348
15 Ga0070660_100069831 3300005339 Bacteria 2740
16 Ga0070689_100030682 3300005340 Bacteria 4081
17 Ga0070691_10024683 3300005341 Bacteria 2795
18 Ga0070687_100000139 3300005343 Bacteria 25149
19 Ga0070661_100006094 3300005344 Bacteria 8300
20 Ga0070692_10008048 3300005345 Bacteria 4679
21 Ga0070668_100060181 3300005347 Bacteria 2940
22 Ga0070668_100198930 3300005347 Bacteria 1644
23 Ga0070669_100073637 3300005353 Bacteria 2531
24 Ga0070675_100107221 3300005354 Bacteria 2359
25 Ga0070675_100201507 3300005354 Bacteria 1728
26 Ga0070675_100312968 3300005354 Bacteria 1386
27 Ga0070671_100014791 3300005355 Bacteria 6305
28 Ga0070671_100198798 3300005355 Bacteria 1700
29 Ga0070671_100220300 3300005355 Bacteria 1610
30 Ga0070673_100206289 3300005364 Bacteria 1695
31 Ga0070659_100129150 3300005366 Bacteria 2051
32 Ga0070659_100228557 3300005366 Bacteria 1537
33 Ga0070667_100072035 3300005367 Bacteria 2944
34 Ga0070705_100019347 3300005440 Bacteria 3583
35 Ga0070700_100000374 3300005441 Bacteria 22955
36 Ga0070694_100001221 3300005444 Bacteria 14849
37 Ga0070694_100025093 3300005444 Bacteria 3855
38 Ga0070662_100000736 3300005457 Bacteria 20017
39 Ga0070662_100098061 3300005457 Bacteria 2213
40 Ga0068867_100026483 3300005459 Bacteria 4164
41 Ga0070679_100025788 3300005530 Bacteria 5769
42 Ga0070679_100284078 3300005530 Bacteria 1607
43 Ga0068853_100001643 3300005539 Bacteria 16346
44 Ga0068853_100110643 3300005539 Bacteria 2440
45 Ga0070672_100094372 3300005543 Bacteria 2418
46 Ga0070672_100207582 3300005543 Bacteria 1640
47 Ga0070695_100004913 3300005545 Bacteria 7883
48 Ga0070695_100011120 3300005545 Bacteria 5379
49 Ga0070696_100009847 3300005546 Bacteria 6393
50 Ga0070693_100084436 3300005547 Bacteria 1900
51 Ga0070665_100015473 3300005548 Bacteria 7664
52 Ga0070704_100056487 3300005549 Bacteria 2787
53 Ga0070704_100241654 3300005549 Bacteria 1478
54 Ga0068855_100011048 3300005563 Bacteria 10893
55 Ga0068857_100301952 3300005577 Bacteria 1476
56 Ga0068854_100048676 3300005578 Bacteria 3025
57 Ga0068856_100000246 3300005614 Bacteria 59117
58 Ga0068856_100012483 3300005614 Bacteria 8223
59 Ga0070702_100007791 3300005615 Bacteria 5149
60 Ga0068852_100026984 3300005616 Bacteria 4675
61 Ga0068852_100147557 3300005616 Bacteria 2183
62 Ga0068859_100051616 3300005617 Bacteria 4134
63 Ga0068859_100106540 3300005617 Bacteria 2862
64 Ga0068859_100292917 3300005617 Bacteria 1721
65 Ga0068864_100056893 3300005618 Bacteria 3378
66 Ga0068866_10001678 3300005718 Bacteria 9328
67 Ga0068861_100071956 3300005719 Bacteria 2681
68 Ga0068861_100081661 3300005719 Bacteria 2531
69 Ga0068863_100029642 3300005841 Bacteria 5223
70 Ga0068863_100072481 3300005841 Bacteria 3258
71 Ga0068863_100359282 3300005841 Bacteria 1420
72 Ga0068858_100022411 3300005842 Bacteria 5895
73 Ga0068858_100487002 3300005842 Bacteria 1191
74 Ga0068860_100016867 3300005843 Bacteria 7119
75 Ga0068860_100191583 3300005843 Bacteria 1979
76 Ga0068862_100128972 3300005844 Bacteria 2235
77 Ga0068862_100376063 3300005844 Bacteria 1324
78 Ga0081455_10168408 3300005937 Bacteria 1671
79 Ga0075365_10006735 3300006038 Bacteria 6355
80 Ga0075363_100013781 3300006048 Bacteria 3933
81 Ga0075363_100019219 3300006048 Bacteria 3413
82 Ga0075364_10032143 3300006051 Bacteria 3372
83 Ga0075364_10227844 3300006051 Bacteria 1266
84 Ga0075369_10124416 3300006186 Bacteria 1169
85 Ga0075366_10041006 3300006195 Bacteria 2739
86 Ga0097621_100004433 3300006237 Bacteria 9772
87 Ga0097621_100059139 3300006237 Bacteria 3136
88 Ga0097621_100302095 3300006237 Bacteria 1414
89 Ga0068871_100001947 3300006358 Bacteria 13973
90 Ga0068871_100024471 3300006358 Bacteria 4684
91 Ga0075428_100007359 3300006844 Bacteria 12203
92 Ga0075428_100032310 3300006844 Bacteria 5780
93 Ga0075428_100532890 3300006844 Bacteria 1256
94 Ga0075430_100008955 3300006846 Bacteria 8454
95 Ga0075434_100189918 3300006871 Bacteria 2074
96 Ga0068865_100058970 3300006881 Bacteria 2683
97 Ga0097620_100051611 3300006931 Bacteria 4134
98 Ga0097620_100106540 3300006931 Bacteria 2862
99 Ga0097620_100292914 3300006931 Bacteria 1721
100 Ga0079104_1001319 3300006946 Bacteria 17030
101 Ga0105240_10039398 3300009093 Bacteria 6051
102 Ga0111539_10000195 3300009094 Bacteria 71206
103 Ga0111539_10769444 3300009094 Bacteria 1121
104 Ga0105245_10007955 3300009098 Bacteria 9273
105 Ga0105245_10140491 3300009098 Bacteria 2274
106 Ga0105247_10038720 3300009101 Bacteria 2912
107 Ga0105248_10008149 3300009177 Bacteria 11507
108 Ga0105248_10308649 3300009177 Bacteria 1782
109 Ga0105238_10017739 3300009551 Bacteria 7237
110 Ga0105249_10010159 3300009553 Bacteria 8264
111 Ga0105249_10056270 3300009553 Bacteria 3601
112 Ga0105246_10159079 3300011119 Bacteria 1719
113 Ga0105246_10405518 3300011119 Bacteria 1133
114 Ga0157373_10001898 3300013100 Bacteria 15867
115 Ga0157371_10003489 3300013102 Bacteria 14224
116 Ga0157371_10126068 3300013102 Bacteria 1821
117 Ga0157370_10073805 3300013104 Bacteria 3218
118 Ga0157369_10050495 3300013105 Bacteria 4504
119 Ga0157378_10028624 3300013297 Bacteria 4918
120 Ga0157378_10149000 3300013297 Bacteria 2179
121 Ga0163162_10187695 3300013306 Bacteria 2194
122 Ga0157372_10051005 3300013307 Bacteria 4604
123 Ga0157372_10158219 3300013307 Bacteria 2617
124 Ga0157372_10244786 3300013307 Bacteria 2081
125 Ga0157372_10385753 3300013307 Bacteria 1632
126 Ga0157375_10040255 3300013308 Bacteria 4504
127 Ga0157375_10209989 3300013308 Bacteria 2104
128 Ga0163163_10006010 3300014325 Bacteria 10561
129 Ga0157380_10076631 3300014326 Bacteria 2722
130 Ga0157377_10066918 3300014745 Bacteria 2067
131 Ga0157377_10081900 3300014745 Bacteria 1889
132 Ga0157379_10007045 3300014968 Bacteria 9716
133 Ga0157376_10062102 3300014969 Bacteria 3143
134 Ga0214544_1000893 3300021320 Bacteria 58796
135 Ga0214542_1000115 3300021321 Bacteria 109873
136 Ga0214543_1000098 3300021327 Bacteria 109894
137 Ga0228711_1025203 3300022739 Bacteria 4051
138 Ga0228710_1024810 3300022740 Bacteria 4051
139 Ga0209130_1008581 3300025284 Bacteria 3002
140 Ga0207688_10013129 3300025901 Bacteria 4502
141 Ga0207647_10049106 3300025904 Bacteria 2619
142 Ga0207645_10067716 3300025907 Bacteria 2282
143 Ga0207645_10073047 3300025907 Bacteria 2196
144 Ga0207643_10013531 3300025908 Bacteria 4420
145 Ga0207695_10039975 3300025913 Bacteria 5036
146 Ga0207660_10096600 3300025917 Bacteria 2200
147 Ga0207660_10264436 3300025917 Bacteria 1361
148 Ga0207662_10000214 3300025918 Bacteria 26908
149 Ga0207681_10053714 3300025923 Bacteria 2736
150 Ga0207650_10017437 3300025925 Bacteria 5029
151 Ga0207650_10081064 3300025925 Bacteria 2461
152 Ga0207659_10022668 3300025926 Bacteria 4183
153 Ga0207687_10045463 3300025927 Bacteria 3035
154 Ga0207644_10007428 3300025931 Bacteria 7143
155 Ga0207644_10156898 3300025931 Bacteria 1766
156 Ga0207690_10010711 3300025932 Bacteria 5464
157 Ga0207706_10000190 3300025933 Bacteria 68803
158 Ga0207706_10050841 3300025933 Bacteria 3662
159 Ga0207706_10313357 3300025933 Bacteria 1366
160 Ga0207686_10019943 3300025934 Bacteria 3823
161 Ga0207670_10142475 3300025936 Bacteria 1769
162 Ga0207669_10148646 3300025937 Bacteria 1638
163 Ga0207691_10007762 3300025940 Bacteria 10333
164 Ga0207691_10042870 3300025940 Bacteria 4171
165 Ga0207691_10045827 3300025940 Bacteria 4019
166 Ga0207689_10001553 3300025942 Bacteria 21776
167 Ga0207689_10014359 3300025942 Bacteria 6737
168 Ga0207679_10005470 3300025945 Bacteria 7959
169 Ga0207667_10046115 3300025949 Bacteria 4615
170 Ga0207667_10070422 3300025949 Bacteria 3640
171 Ga0207667_10082654 3300025949 Bacteria 3326
172 Ga0207667_10094804 3300025949 Bacteria 3081
173 Ga0207712_10046922 3300025961 Bacteria 2997
174 Ga0207712_10048193 3300025961 Bacteria 2962
175 Ga0207668_10039464 3300025972 Bacteria 3178
176 Ga0207703_10000559 3300026035 Bacteria 38247
177 Ga0207639_10128920 3300026041 Bacteria 2091
178 Ga0207678_10029539 3300026067 Bacteria 4785
179 Ga0207708_10016731 3300026075 Bacteria 5518
180 Ga0207708_10043297 3300026075 Bacteria 3431
181 Ga0207702_10004336 3300026078 Bacteria 12655
182 Ga0207702_10059945 3300026078 Bacteria 3243
183 Ga0207702_10103727 3300026078 Bacteria 2516
184 Ga0207641_10041229 3300026088 Bacteria 3868
185 Ga0207648_10041382 3300026089 Bacteria 4046
186 Ga0207676_10030901 3300026095 Bacteria 4024
187 Ga0207674_10011703 3300026116 Bacteria 9848
188 Ga0207675_100001190 3300026118 Bacteria 25909
189 Ga0207683_10012744 3300026121 Bacteria 7176
190 Ga0207698_10077462 3300026142 Bacteria 2666
191 Ga0207698_10138473 3300026142 Bacteria 2092
192 Ga0207698_10406637 3300026142 Bacteria 1302
193 Ga0209281_1000988 3300027111 Bacteria 22602
194 Ga0209281_1004638 3300027111 Bacteria 4051
195 Ga0209981_1007331 3300027378 Bacteria 1487
196 Ga0209995_1002897 3300027471 Bacteria 2721
197 Ga0209999_1020026 3300027543 Bacteria 1227
198 Ga0209282_1021731 3300027666 Bacteria 4051
199 Ga0209974_10000626 3300027876 Bacteria 11888
200 Ga0209974_10036953 3300027876 Bacteria 1622
201 Ga0207428_10003048 3300027907 Bacteria 16490
202 Ga0268265_10019253 3300028380 Bacteria 4740
203 Ga0268264_10044768 3300028381 Bacteria 3672
204 Ga0268264_10053029 3300028381 Bacteria 3383
205 Ga0268264_10224389 3300028381 Bacteria 1731
206 Ga0307515_10000375 3300028794 Bacteria 109285
207 Ga0307515_10000444 3300028794 Bacteria 99282
208 Ga0307513_10002502 3300031456 Bacteria 25439
209 Ga0307408_100004584 3300031548 Bacteria 9353
210 Ga0307408_100040787 3300031548 Bacteria 3288
211 Ga0307408_100225134 3300031548 Bacteria 1533
212 Ga0307408_100332772 3300031548 Bacteria 1283
213 Ga0316576_10018231 3300031727 Bacteria 4788
214 Ga0307516_10005985 3300031730 Bacteria 14376
215 Ga0307405_10005949 3300031731 Bacteria 5952
216 Ga0307405_10012740 3300031731 Bacteria 4465
217 Ga0307413_10001161 3300031824 Bacteria 9678
218 Ga0307410_10001726 3300031852 Bacteria 10093
219 Ga0307406_10004201 3300031901 Bacteria 7841
220 Ga0307406_10274987 3300031901 Bacteria 1281
221 Ga0307412_10019201 3300031911 Bacteria 4133
222 Ga0307412_10025231 3300031911 Bacteria 3679
223 Ga0307412_10217912 3300031911 Bacteria 1461
224 Ga0315914_1019379 3300031967 Bacteria 5846
225 Ga0307409_100149422 3300031995 Bacteria 2026
226 Ga0307416_100008129 3300032002 Bacteria 6737
227 Ga0307416_100192674 3300032002 Bacteria 1924
228 Ga0307414_10092700 3300032004 Bacteria 2249
229 Ga0307411_10000419 3300032005 Bacteria 14481
230 Ga0307415_100003744 3300032126 Bacteria 7791
231 Ga0315913_1028013 3300033430 Bacteria 4293
232 Ga0315915_1018009 3300033464 Bacteria 6329
233 Ga0373938_0025455 3300034957 Bacteria 1232
234 Ga0373926_0001761 3300035083 Bacteria 6721
235 Ga0373936_0002101 3300035113 Bacteria 7395
236 Ga0373941_0135712 3300035115 Bacteria 890
237 Ga0373945_0001227 3300035116 Bacteria 7807
238 Ga0373946_0003237 3300035171 Bacteria 5783
239 Ga0373961_0013003 3300035241 Bacteria 2092
240 Ga0373935_0009698 3300035692 Bacteria 5763
241 Ga0373927_0004974 3300035695 Bacteria 9213
242 Ga0373937_0001375 3300036401 Bacteria 20333
243 Ga0373937_0194143 3300036401 Bacteria 1908
244 Ga0316584_0035127 3300036712 Bacteria 3719
245 Ga0316584_0173359 3300036712 Bacteria 1599
246 Ga0439436_0001382 3300041404 Bacteria 7000
247 Ga0439439_0000456 3300041406 Bacteria 6943
248 Ga0439447_012435 3300041407 Bacteria 2446
249 Ga0439466_0010452 3300041411 Bacteria 3449
250 Ga0451849_0857631 3300041505 Bacteria 1132
251 Ga0439431_0011181 3300041997 Bacteria 2047
252 Ga0439433_0007126 3300041999 Bacteria 2413
253 Ga0439442_011190 3300042002 Bacteria 1824
254 Ga0439449_0000761 3300042007 Bacteria 12371
255 Ga0439449_0010322 3300042007 Bacteria 3525
256 Ga0439462_0001093 3300042015 Bacteria 5850
257 Ga0450896_002485 3300042133 Bacteria 2382
258 Ga0450908_002800 3300042184 Bacteria 3390
259 Ga0439434_0002746 3300042435 Bacteria 5133
260 Ga0439434_0104063 3300042435 Bacteria 916
261 Ga0451577_0062880 3300042876 Bacteria 3310
262 Ga0453683_0053955 3300044673 Bacteria 2516
263 Ga0453684_0016599 3300044712 Bacteria 11492
264 Ga0453684_0211823 3300044712 Bacteria 2252
265 Ga0451576_0112647 3300045051 Bacteria 2831
266 Ga0451576_0211234 3300045051 Bacteria 2027
267 Ga0495603_0080813 3300046455 Bacteria 1905
268 Ga0495638_0016705 3300046460 Bacteria 4909
269 Ga0495580_0003258 3300046472 Bacteria 13879
270 Ga0495639_0020270 3300046475 Bacteria 2905
271 Ga0495594_0038985 3300046499 Bacteria 2596
272 Ga0495666_0005431 3300046526 Bacteria 6420
273 Ga0495652_0159090 3300046529 Bacteria 1756
274 Ga0495665_0010183 3300046531 Bacteria 5095
275 Ga0495586_0003330 3300046535 Bacteria 8623
276 Ga0495625_0127218 3300046660 Bacteria 1729
277 Ga0495588_0008086 3300046674 Bacteria 4811
278 Ga0495658_0001458 3300046683 Bacteria 12454
279 Ga0495581_0007160 3300047315 Bacteria 6458
280 Ga0495676_0004858 3300047321 Bacteria 12334
281 Ga0495602_0092121 3300048088 Bacteria 2512
282 Ga0496101_0332464 3300048904 Bacteria 1193
283 Ga0496102_0013655 3300048905 Bacteria 7039
284 Ga0496102_0070946 3300048905 Bacteria 3199
285 Ga0496102_0345126 3300048905 Bacteria 1402
286 Ga0496106_0000353 3300048909 Bacteria 32583
287 Ga0496107_0002903 3300048910 Bacteria 11327
288 Ga0496110_0229788 3300048913 Bacteria 1687
289 Ga0496111_0015559 3300048914 Bacteria 5226
290 Ga0496124_0094391 3300048927 Bacteria 2433
291 Ga0496124_0199307 3300048927 Bacteria 1524
292 Ga0496125_0001513 3300048928 Bacteria 33304
293 Ga0501031_0010069 3300049568 Bacteria 6161
294 Ga0501032_0055042 3300049569 Bacteria 2677
295 Ga0501033_0018390 3300049570 Bacteria 5278
296 Ga0501033_0029795 3300049570 Bacteria 4102
297 Ga0501034_0000648 3300049571 Bacteria 53584
298 Ga0501034_0002664 3300049571 Bacteria 21114
299 Ga0501034_0049164 3300049571 Bacteria 4255
300 Ga0501034_0141889 3300049571 Bacteria 2381
301 Ga0501034_0174432 3300049571 Bacteria 2116
302 Ga0501034_0245450 3300049571 Bacteria 1736
303 Ga0501034_0390168 3300049571 Bacteria 1316
304 Ga0501036_0012283 3300049572 Bacteria 7091
305 Ga0501036_0236910 3300049572 Bacteria 1531
306 Ga0501036_0237236 3300049572 Bacteria 1530
307 Ga0501037_0000742 3300049573 Bacteria 24738
308 Ga0501037_0017449 3300049573 Bacteria 5283
309 Ga0501037_0122892 3300049573 Bacteria 1865
310 Ga0501038_0045020 3300049574 Bacteria 3831
311 Ga0501038_0193458 3300049574 Bacteria 1636
312 Ga0501039_0364835 3300049575 Bacteria 1135
313 Ga0501040_0046639 3300049576 Bacteria 2958
314 Ga0501041_0027145 3300049577 Bacteria 3450
315 Ga0501042_0075351 3300049578 Bacteria 2415
316 Ga0501043_0000022 3300049579 Bacteria 154467
317 Ga0501043_0081499 3300049579 Bacteria 2543
318 Ga0501047_0042033 3300049581 Bacteria 4417
319 Ga0501069_0000012 3300049585 Bacteria 148453
320 Ga0501070_0001122 3300049586 Bacteria 24014
321 Ga0501070_0020835 3300049586 Bacteria 5500
322 Ga0501070_0159123 3300049586 Bacteria 1862
323 Ga0501070_0493425 3300049586 Bacteria 984
324 Ga0501072_0097666 3300049588 Bacteria 2335
325 Ga0501072_0120494 3300049588 Bacteria 2090
326 Ga0501073_0074261 3300049589 Bacteria 2368
327 Ga0501073_0105637 3300049589 Bacteria 1954
328 Ga0501074_0000021 3300049590 Bacteria 71950
329 Ga0501075_0060907 3300049591 Bacteria 2843
330 Ga0501077_0117763 3300049593 Bacteria 1683
331 Ga0501079_0094111 3300049741 Bacteria 2322
332 Ga0501079_0166055 3300049741 Bacteria 1722
333 Ga0501080_0007699 3300049742 Bacteria 9735
334 Ga0501080_0276963 3300049742 Bacteria 1526
335 Ga0501083_0000114 3300049744 Bacteria 55139
336 Ga0501241_011626 3300049758 Bacteria 1598
337 Ga0501035_0000039 3300049822 Bacteria 156824
338 Ga0501035_0013276 3300049822 Bacteria 7602
339 Ga0501035_0043259 3300049822 Bacteria 4059
340 Ga0501044_0000047 3300049823 Bacteria 146449
341 Ga0501044_0005353 3300049823 Bacteria 14265
342 Ga0501044_0135148 3300049823 Bacteria 2457
343 Ga0501044_0381870 3300049823 Bacteria 1324
344 Ga0501044_0396600 3300049823 Bacteria 1293
345 nmdc:mga03683_1730_c1 3300050489 Bacteria 6585
346 nmdc:mga03n38_11878_c1 3300050490 Bacteria 3258
347 nmdc:mga00v17_37358_c2 3300050491 Bacteria 2581
348 nmdc:mga0yw44_20913_c1 3300050492 Bacteria 3642
349 nmdc:mga0k408_37390_c1 3300050493 Bacteria 2787
350 nmdc:mga0k408_7119_c1 3300050493 Bacteria 5978
351 nmdc:mga07m45_34754_c1 3300050496 Bacteria 2802
352 nmdc:mga0qj67_23981_c1 3300050509 Bacteria 4700
353 nmdc:mga0qj67_64450_c1 3300050509 Bacteria 2914
354 nmdc:mga08y16_3351_c1 3300050511 Bacteria 16593
355 nmdc:mga08y16_658841_c1 3300050511 Bacteria 1050
356 Ga0500610_0156018 3300053079 Bacteria 1139
357 Ga0500644_0032486 3300053088 Bacteria 1668
358 Ga0500592_006769 3300053116 Bacteria 1825
359 Ga0500568_0000682 3300053139 Bacteria 24448
360 Ga0500616_0000510 3300053153 Bacteria 49274
361 Ga0500616_0062788 3300053153 Bacteria 1917
362 Ga0500622_0002549 3300053156 Bacteria 13052
363 Ga0500624_003471 3300053157 Bacteria 2068
364 Ga0500627_0010323 3300053158 Bacteria 3401
365 Ga0500627_0013101 3300053158 Bacteria 3130
366 Ga0500627_0029986 3300053158 Bacteria 2274
367 Ga0500634_0000001 3300053161 Bacteria 258285
368 Ga0500634_0011781 3300053161 Bacteria 4526
369 Ga0501084_0053408 3300054114 Bacteria 3380
370 Ga0590071_018895 3300059421 Bacteria 1622
371 Ga0587077_021294 3300059493 Bacteria 1149
372 Ga0587077_021569 3300059493 Bacteria 1144
373 Ga0530510_0331332 3300061734 Bacteria 1142
374 2503200789 2503198000 Bacteria 6884444
375 2509139818 2508501127 Bacteria 7037543
376 2510840321 2510461069 Bacteria 5505000
377 2512975323 2512875026 Bacteria 6861065
378 2513605722 2513237089 Bacteria 6553624
379 2513610277 2513237090 Bacteria 7096802
380 2513884001 2513237140 Bacteria 7076289
381 2513901667 2513237143 Bacteria 6664116
382 2514008216 2513237160 Bacteria 6650282
383 2514589127 2513237351 Bacteria 6968952
384 2514589397 2513237351 Bacteria 6968952
385 2517566937 2517487022 Bacteria 7227575
386 2643776046 2643221551 Bacteria 3750538
387 2643794493 2643221555 Bacteria 3749717
388 2643840585 2643221564 Bacteria 4193379
389 2643910245 2643221580 Bacteria 3816678
390 2643965015 2643221591 Bacteria 4397626
391 2644106915 2643221618 Bacteria 7717186
392 2644149703 2643221626 Bacteria 8069654
393 2644169088 2643221629 Bacteria 5850260
394 2644311304 2643221655 Bacteria 7722067
395 2644331912 2643221659 Bacteria 7890716
396 2644350500 2643221662 Bacteria 5851492
397 2644410850 2643221674 Bacteria 3919126
398 2644496584 2643221688 Bacteria 5260751
399 2644543670 2643221698 Bacteria 7756764
400 2644615843 2643221712 Bacteria 7729434
401 2657684078 2657244999 Bacteria 5946535
402 2738948407 2738541317 Bacteria 5340176
403 2739306659 2738543024 Bacteria 5603683
404 2792580604 2791355082 Bacteria 5973319
405 2792582641 2791355082 Bacteria 5973319
406 2802721669 2802428858 Bacteria 6636079
407 2802728419 2802428859 Bacteria 6667919
408 2802733889 2802428860 Bacteria 6525526
409 2802741420 2802428861 Bacteria 6534206
410 2802747387 2802428862 Bacteria 6633353
411 2802753564 2802428863 Bacteria 6410669
412 2804753233 2802429268 Bacteria 6094027
413 2819243361 2818991272 Bacteria 4622173
414 2841735468 2841734538 Bacteria 6784580
415 2856347849 2856342000 Bacteria 7176905
416 2871436907 2871435913 Bacteria 6880295
417 2871476279 2871474448 Bacteria 6806570
418 2874126531 2874123672 Bacteria 7238285
419 2878796446 2878788777 Bacteria 6567085
420 2882639016 2882632389 Bacteria 8154593
421 2885318671 2885312484 Bacteria 6415165
422 2888346462 2888343758 Bacteria 6611049
423 2888352983 2888350351 Bacteria 7372807
424 2889020191 2889016732 Bacteria 6700763
425 2889795079 2889790730 Bacteria 5689708
426 2889915366 2889914905 Bacteria 5702301
427 2899806282 2899803654 Bacteria 5577784
428 2906360867 2906354277 Bacteria 6991324
429 2913299748 2913295892 Bacteria 6333755
430 2913313196 2913308742 Bacteria 5350706
431 2915984919 2915980308 Bacteria 6624279
432 2919681857 2919679072 Bacteria 4629602
433 2919706891 2919704043 Bacteria 5560311
434 2921262525 2921257292 Bacteria 6808382
435 2922134939 2922130491 Bacteria 7173936
436 2924738261 2924733363 Bacteria 7574837
437 2937027754 2937023124 Bacteria 6815156
438 2937034031 2937029754 Bacteria 6424026
439 2937039571 2937036028 Bacteria 6846469
440 2937082570 2937078374 Bacteria 6610289
441 2937087545 2937084907 Bacteria 6618516
442 2937842284 2937836603 Bacteria 6811263
443 2937843707 2937843397 Bacteria 5256375
444 2937845790 2937843397 Bacteria 5256375
445 2957380870 2957375807 Bacteria 6425588
446 2957383901 2957382221 Bacteria 6737050
447 2957400580 2957395598 Bacteria 6822399
448 2957405242 2957402308 Bacteria 6741770
449 2957443119 2957437181 Bacteria 6568994
450 2958064834 2958064165 Bacteria 7158582
451 2958075534 2958071322 Bacteria 6815895
452 2958100987 2958100919 Bacteria 6800575
453 2958177698 2958172287 Bacteria 6716688
454 2960595229 2960591022 Bacteria 6622873
455 2960633519 2960631154 Bacteria 6732508
456 2960685472 2960680706 Bacteria 6624464
457 2964620634 2964615318 Bacteria 6809089
458 2965126962 2965119406 Bacteria 6956431
459 2967692120 2967686174 Bacteria 6678622
460 2967731861 2967728569 Bacteria 6641507
461 2967760679 2967755722 Bacteria 6814706
462 2970030805 2970026789 Bacteria 6785236
463 2970107142 2970102677 Bacteria 6812532
464 2970126805 2970122695 Bacteria 6625855
465 2970144328 2970143518 Bacteria 6446480
466 2970528016 2970524798 Bacteria 6840927
467 2977535368 2977530762 Bacteria 6951399
468 2977545274 2977544691 Bacteria 6875412
469 2977871064 2977864932 Bacteria 7534097
470 2977973891 2977971508 Bacteria 7472917
471 2979714577 2979710463 Bacteria 6785254
472 2979751684 2979742915 Bacteria 7301278
473 2987658481 2987652177 Bacteria 6969023
474 2989775501 2989771324 Bacteria 5605128
475 2996390039 2996386984 Bacteria 6978667
476 8004005504 8003999396 Bacteria 7063185
477 8004312769 8004312739 Bacteria 7444653
478 8004639429 8004633249 Bacteria 6723080
479 8049295200 8049293176 Bacteria 6128433
480 8049295845 8049293176 Bacteria 6128433
481 8054559505 8054558443 Bacteria 5204801
482 8055620125 8055617313 Bacteria 7548464
483 8056877848 8056875544 Bacteria 4355797
484 rootH1_10035930
485 rootH1_10056629
486 JGI26145J50221_1003577
487 Ga0065704_10011026
488 Ga0065715_10139502
489 Ga0070676_10065938
490 Ga0070690_100019686
491 Ga0070690_100125548
492 Ga0070670_100005195
493 Ga0068869_100003269
494 Ga0068869_100003339
495 Ga0070680_100001207
496 Ga0068868_100003224
497 Ga0070660_100069831
498 Ga0070689_100030682
499 Ga0070691_10024683
500 Ga0070687_100000139
501 Ga0070661_100006094
502 Ga0070692_10008048
503 Ga0070668_100060181
504 Ga0070668_100198930
505 Ga0070669_100073637
506 Ga0070675_100107221
507 Ga0070675_100201507
508 Ga0070675_100312968
509 Ga0070671_100014791
510 Ga0070671_100198798
511 Ga0070671_100220300
512 Ga0070673_100206289
513 Ga0070659_100129150
514 Ga0070659_100228557
515 Ga0070667_100072035
516 Ga0070705_100019347
517 Ga0070700_100000374
518 Ga0070694_100001221
519 Ga0070694_100025093
520 Ga0070662_100000736
521 Ga0070662_100098061
522 Ga0068867_100026483
523 Ga0070679_100025788
524 Ga0070679_100284078
525 Ga0068853_100001643
526 Ga0068853_100110643
527 Ga0070672_100094372
528 Ga0070672_100207582
529 Ga0070695_100004913
530 Ga0070695_100011120
531 Ga0070696_100009847
532 Ga0070693_100084436
533 Ga0070665_100015473
534 Ga0070704_100056487
535 Ga0070704_100241654
536 Ga0068855_100011048
537 Ga0068857_100301952
538 Ga0068854_100048676
539 Ga0068856_100000246
540 Ga0068856_100012483
541 Ga0070702_100007791
542 Ga0068852_100026984
543 Ga0068852_100147557
544 Ga0068859_100051616
545 Ga0068859_100106540
546 Ga0068859_100292917
547 Ga0068864_100056893
548 Ga0068866_10001678
549 Ga0068861_100071956
550 Ga0068861_100081661
551 Ga0068863_100029642
552 Ga0068863_100072481
553 Ga0068863_100359282
554 Ga0068858_100022411
555 Ga0068858_100487002
556 Ga0068860_100016867
557 Ga0068860_100191583
558 Ga0068862_100128972
559 Ga0068862_100376063
560 Ga0081455_10168408
561 Ga0075365_10006735
562 Ga0075363_100013781
563 Ga0075363_100019219
564 Ga0075364_10032143
565 Ga0075364_10227844
566 Ga0075369_10124416
567 Ga0075366_10041006
568 Ga0097621_100004433
569 Ga0097621_100059139
570 Ga0097621_100302095
571 Ga0068871_100001947
572 Ga0068871_100024471
573 Ga0075428_100007359
574 Ga0075428_100032310
575 Ga0075428_100532890
576 Ga0075430_100008955
577 Ga0075434_100189918
578 Ga0068865_100058970
579 Ga0097620_100051611
580 Ga0097620_100106540
581 Ga0097620_100292914
582 Ga0079104_1001319
583 Ga0105240_10039398
584 Ga0111539_10000195
585 Ga0111539_10769444
586 Ga0105245_10007955
587 Ga0105245_10140491
588 Ga0105247_10038720
589 Ga0105248_10008149
590 Ga0105248_10308649
591 Ga0105238_10017739
592 Ga0105249_10010159
593 Ga0105249_10056270
594 Ga0105246_10159079
595 Ga0105246_10405518
596 Ga0157373_10001898
597 Ga0157371_10003489
598 Ga0157371_10126068
599 Ga0157370_10073805
600 Ga0157369_10050495
601 Ga0157378_10028624
602 Ga0157378_10149000
603 Ga0163162_10187695
604 Ga0157372_10051005
605 Ga0157372_10158219
606 Ga0157372_10244786
607 Ga0157372_10385753
608 Ga0157375_10040255
609 Ga0157375_10209989
610 Ga0163163_10006010
611 Ga0157380_10076631
612 Ga0157377_10066918
613 Ga0157377_10081900
614 Ga0157379_10007045
615 Ga0157376_10062102
616 Ga0214544_1000893
617 Ga0214542_1000115
618 Ga0214543_1000098
619 Ga0228711_1025203
620 Ga0228710_1024810
621 Ga0209130_1008581
622 Ga0207688_10013129
623 Ga0207647_10049106
624 Ga0207645_10067716
625 Ga0207645_10073047
626 Ga0207643_10013531
627 Ga0207695_10039975
628 Ga0207660_10096600
629 Ga0207660_10264436
630 Ga0207662_10000214
631 Ga0207681_10053714
632 Ga0207650_10017437
633 Ga0207650_10081064
634 Ga0207659_10022668
635 Ga0207687_10045463
636 Ga0207644_10007428
637 Ga0207644_10156898
638 Ga0207690_10010711
639 Ga0207706_10000190
640 Ga0207706_10050841
641 Ga0207706_10313357
642 Ga0207686_10019943
643 Ga0207670_10142475
644 Ga0207669_10148646
645 Ga0207691_10007762
646 Ga0207691_10042870
647 Ga0207691_10045827
648 Ga0207689_10001553
649 Ga0207689_10014359
650 Ga0207679_10005470
651 Ga0207667_10046115
652 Ga0207667_10070422
653 Ga0207667_10082654
654 Ga0207667_10094804
655 Ga0207712_10046922
656 Ga0207712_10048193
657 Ga0207668_10039464
658 Ga0207703_10000559
659 Ga0207639_10128920
660 Ga0207678_10029539
661 Ga0207708_10016731
662 Ga0207708_10043297
663 Ga0207702_10004336
664 Ga0207702_10059945
665 Ga0207702_10103727
666 Ga0207641_10041229
667 Ga0207648_10041382
668 Ga0207676_10030901
669 Ga0207674_10011703
670 Ga0207675_100001190
671 Ga0207683_10012744
672 Ga0207698_10077462
673 Ga0207698_10138473
674 Ga0207698_10406637
675 Ga0209281_1000988
676 Ga0209281_1004638
677 Ga0209981_1007331
678 Ga0209995_1002897
679 Ga0209999_1020026
680 Ga0209282_1021731
681 Ga0209974_10000626
682 Ga0209974_10036953
683 Ga0207428_10003048
684 Ga0268265_10019253
685 Ga0268264_10044768
686 Ga0268264_10053029
687 Ga0268264_10224389
688 Ga0307515_10000375
689 Ga0307515_10000444
690 Ga0307513_10002502
691 Ga0307408_100004584
692 Ga0307408_100040787
693 Ga0307408_100225134
694 Ga0307408_100332772
695 Ga0316576_10018231
696 Ga0307516_10005985
697 Ga0307405_10005949
698 Ga0307405_10012740
699 Ga0307413_10001161
700 Ga0307410_10001726
701 Ga0307406_10004201
702 Ga0307406_10274987
703 Ga0307412_10019201
704 Ga0307412_10025231
705 Ga0307412_10217912
706 Ga0315914_1019379
707 Ga0307409_100149422
708 Ga0307416_100008129
709 Ga0307416_100192674
710 Ga0307414_10092700
711 Ga0307411_10000419
712 Ga0307415_100003744
713 Ga0315913_1028013
714 Ga0315915_1018009
715 Ga0373938_0025455
716 Ga0373926_0001761
717 Ga0373936_0002101
718 Ga0373941_0135712
719 Ga0373945_0001227
720 Ga0373946_0003237
721 Ga0373961_0013003
722 Ga0373935_0009698
723 Ga0373927_0004974
724 Ga0373937_0001375
725 Ga0373937_0194143
726 Ga0316584_0035127
727 Ga0316584_0173359
728 Ga0439436_0001382
729 Ga0439439_0000456
730 Ga0439447_012435
731 Ga0439466_0010452
732 Ga0451849_0857631
733 Ga0439431_0011181
734 Ga0439433_0007126
735 Ga0439442_011190
736 Ga0439449_0000761
737 Ga0439449_0010322
738 Ga0439462_0001093
739 Ga0450896_002485
740 Ga0450908_002800
741 Ga0439434_0002746
742 Ga0439434_0104063
743 Ga0451577_0062880
744 Ga0453683_0053955
745 Ga0453684_0016599
746 Ga0453684_0211823
747 Ga0451576_0112647
748 Ga0451576_0211234
749 Ga0495603_0080813
750 Ga0495638_0016705
751 Ga0495580_0003258
752 Ga0495639_0020270
753 Ga0495594_0038985
754 Ga0495666_0005431
755 Ga0495652_0159090
756 Ga0495665_0010183
757 Ga0495586_0003330
758 Ga0495625_0127218
759 Ga0495588_0008086
760 Ga0495658_0001458
761 Ga0495581_0007160
762 Ga0495676_0004858
763 Ga0495602_0092121
764 Ga0496101_0332464
765 Ga0496102_0013655
766 Ga0496102_0070946
767 Ga0496102_0345126
768 Ga0496106_0000353
769 Ga0496107_0002903
770 Ga0496110_0229788
771 Ga0496111_0015559
772 Ga0496124_0094391
773 Ga0496124_0199307
774 Ga0496125_0001513
775 Ga0501031_0010069
776 Ga0501032_0055042
777 Ga0501033_0018390
778 Ga0501033_0029795
779 Ga0501034_0000648
780 Ga0501034_0002664
781 Ga0501034_0049164
782 Ga0501034_0141889
783 Ga0501034_0174432
784 Ga0501034_0245450
785 Ga0501034_0390168
786 Ga0501036_0012283
787 Ga0501036_0236910
788 Ga0501036_0237236
789 Ga0501037_0000742
790 Ga0501037_0017449
791 Ga0501037_0122892
792 Ga0501038_0045020
793 Ga0501038_0193458
794 Ga0501039_0364835
795 Ga0501040_0046639
796 Ga0501041_0027145
797 Ga0501042_0075351
798 Ga0501043_0000022
799 Ga0501043_0081499
800 Ga0501047_0042033
801 Ga0501069_0000012
802 Ga0501070_0001122
803 Ga0501070_0020835
804 Ga0501070_0159123
805 Ga0501070_0493425
806 Ga0501072_0097666
807 Ga0501072_0120494
808 Ga0501073_0074261
809 Ga0501073_0105637
810 Ga0501074_0000021
811 Ga0501075_0060907
812 Ga0501077_0117763
813 Ga0501079_0094111
814 Ga0501079_0166055
815 Ga0501080_0007699
816 Ga0501080_0276963
817 Ga0501083_0000114
818 Ga0501241_011626
819 Ga0501035_0000039
820 Ga0501035_0013276
821 Ga0501035_0043259
822 Ga0501044_0000047
823 Ga0501044_0005353
824 Ga0501044_0135148
825 Ga0501044_0381870
826 Ga0501044_0396600
827 nmdc:mga03683_1730_c1
828 nmdc:mga03n38_11878_c1
829 nmdc:mga00v17_37358_c2
830 nmdc:mga0yw44_20913_c1
831 nmdc:mga0k408_37390_c1
832 nmdc:mga0k408_7119_c1
833 nmdc:mga07m45_34754_c1
834 nmdc:mga0qj67_23981_c1
835 nmdc:mga0qj67_64450_c1
836 nmdc:mga08y16_3351_c1
837 nmdc:mga08y16_658841_c1
838 Ga0500610_0156018
839 Ga0500644_0032486
840 Ga0500592_006769
841 Ga0500568_0000682
842 Ga0500616_0000510
843 Ga0500616_0062788
844 Ga0500622_0002549
845 Ga0500624_003471
846 Ga0500627_0010323
847 Ga0500627_0013101
848 Ga0500627_0029986
849 Ga0500634_0000001
850 Ga0500634_0011781
851 Ga0501084_0053408
852 Ga0590071_018895
853 Ga0587077_021294
854 Ga0587077_021569
855 Ga0530510_0331332
856 2503200789
857 2509139818
858 2510840321
859 2512975323
860 2513605722
861 2513610277
862 2513884001
863 2513901667
864 2514008216
865 2514589127
866 2514589397
867 2517566937
868 2643776046
869 2643794493
870 2643840585
871 2643910245
872 2643965015
873 2644106915
874 2644149703
875 2644169088
876 2644311304
877 2644331912
878 2644350500
879 2644410850
880 2644496584
881 2644543670
882 2644615843
883 2657684078
884 2738948407
885 2739306659
886 2792580604
887 2792582641
888 2802721669
889 2802728419
890 2802733889
891 2802741420
892 2802747387
893 2802753564
894 2804753233
895 2819243361
896 2841735468
897 2856347849
898 2871436907
899 2871476279
900 2874126531
901 2878796446
902 2882639016
903 2885318671
904 2888346462
905 2888352983
906 2889020191
907 2889795079
908 2889915366
909 2899806282
910 2906360867
911 2913299748
912 2913313196
913 2915984919
914 2919681857
915 2919706891
916 2921262525
917 2922134939
918 2924738261
919 2937027754
920 2937034031
921 2937039571
922 2937082570
923 2937087545
924 2937842284
925 2937843707
926 2937845790
927 2957380870
928 2957383901
929 2957400580
930 2957405242
931 2957443119
932 2958064834
933 2958075534
934 2958100987
935 2958177698
936 2960595229
937 2960633519
938 2960685472
939 2964620634
940 2965126962
941 2967692120
942 2967731861
943 2967760679
944 2970030805
945 2970107142
946 2970126805
947 2970144328
948 2970528016
949 2977535368
950 2977545274
951 2977871064
952 2977973891
953 2979714577
954 2979751684
955 2987658481
956 2989775501
957 2996390039
958 8004005504
959 8004312769
960 8004639429
961 8049295200
962 8049295845
963 8054559505
964 8055620125
965 8056877848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

73

330

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ltc-assembly2.cif.gz_A crystal structure of doubly spin labelled vcsiap r125 0.9256 41 341
5ltc-assembly2.cif.gz_A crystal structure of doubly spin labelled vcsiap r125 0.9167 41 341
7a5c-assembly1.cif.gz_B crystal structure of spin labelled vcsiap r125a bound to an artificial peptide ligand. 0.9145 36 341
2cex-assembly3.cif.gz_C structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en 0.9131 40 343
2cex-assembly3.cif.gz_C structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en 0.9102 40 343
ID Description Score Start End Superfamily
4magA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9296 41 341 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9061 42 343 3.40.190.170
4p47A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9001 40 341 3.40.190.170
4magA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8976 41 341 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8975 42 343 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A356E0V8-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9068 39 342 GO:0055085
AF-A0A3B8HFH5-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9007 57 319 GO:0055085
AF-A0A1Y6C6L5-F1-model_v4 Tripartite ATP-independent transporter solute receptor, DctP family 0.8888 40 341 GO:0006935
GO:0007165
GO:0016020
GO:0030288
GO:0055085
AF-A0A655YBH5-F1-model_v4 deleted 0.8858 63 341
AF-A0A3B8HFH5-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.8817 57 319 GO:0055085

Map