F452522

General Info

Members Datasets Scaffolds Average Seq Length
481 290 427 294

Family's Representative Sequence

Representative Sequence 3300053079|Ga0500610_0002426|Ga0500610_0002426_265_1239
Length 324
Sequence MLRAQPVQRLAKSGSPRQVKMAADLFSGHRPMPSLAASSFQPLAGIRVLSLALNLPGPAALLRCRGMGAACLKLEPPGGDPMGLYDKAAYAALHEGIAIETADLKTEAGQRQLHAELAKTDVLLTSFRPSALRKLGLDWPALQARHPALSQVAIVGAPGERAEEPGHDLTYLAESGLVTGTELPPTLYADMGGALLASEAVLTAVLQRARAEGQAGGVYLEVALNASADWLALPRTWGLTQPTGAVGGAHAGYRVYACADGRVAVAALEPHFAARLCEAAGVTPPDMMATATHEGLAAWLATRTRAELDAMGRERDVPLLTLAD

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2842677519 Variovorax sp. R-72495 Isolate Unclassified
28 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
29 2842733646 Variovorax sp. R-72446 Isolate Unclassified
30 2842747753 Variovorax sp. R-72060 Isolate Unclassified
31 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
32 2885198086 Variovorax sp. 679 Isolate Unclassified
33 2885211737 Variovorax sp. 553 Isolate Unclassified
34 2899924645 Variovorax sp. 369 Isolate Unclassified
35 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
36 2904456579 Variovorax sp. 2002 Isolate Unclassified
37 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
38 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
39 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
40 2928037797 Variovorax sp. 1126 Isolate Unclassified
41 2928044640 Variovorax sp. 1128 Isolate Unclassified
42 2928051484 Variovorax sp. 1133 Isolate Unclassified
43 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
44 2928070936 Variovorax gossypii 1167 Isolate Unclassified
45 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
46 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
47 2929520902 Variovorax beijingensis 502 Isolate Unclassified
48 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
49 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
50 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
51 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
52 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
53 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
54 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
55 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
56 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
57 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
58 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
59 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
60 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
61 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
65 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
70 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
194 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
195 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
196 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
197 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
256 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
270 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
271 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
272 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
275 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
276 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
281 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
282 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
285 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
286 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
287 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
288 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
289 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
290 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.36
Metatranscriptomes 0.21
Isolates 11.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.8
Nodule 0.62
Rhizoplane 3.74
Rhizosphere 43.45
Stem 0
Stem Tuber 0
Unclassified 15.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006548 3300001979 Bacteria 4810
2 JGI24739J22299_10019132 3300001989 Bacteria 2454
3 JGI25155J39150_1000002 3300002704 Bacteria 292156
4 JGI25156J39149_1000003 3300002705 Bacteria 305434
5 JGI25154J39366_1000009 3300002738 Bacteria 305408
6 JGI25157J39369_1000002 3300002741 Bacteria 305434
7 JGI25159J45721_1000204 3300002987 Bacteria 27544
8 JGI25151J46595_10002791 3300003187 Bacteria 10112
9 JGI25151J46595_10003325 3300003187 Bacteria 8917
10 JGI25151J46595_10013259 3300003187 Bacteria 3716
11 rootH1_10044355 3300003316 Bacteria 1948
12 rootH1_10044355 3300003323 Bacteria 3232
13 rootL2_10011842 3300003322 Bacteria 1809
14 JGI25160J50197_1000277 3300003354 Bacteria 37489
15 JGI25160J50197_1024956 3300003354 Bacteria 1684
16 JGI25161J50226_1000018 3300003374 Bacteria 172599
17 JGI25161J50226_1004682 3300003374 Bacteria 2812
18 Ga0006562J51391_1052559 3300003578 Bacteria 1680
19 Ga0055535_1001577 3300003761 Bacteria 11029
20 Ga0055542_1000027 3300003762 Bacteria 254819
21 Ga0055526_1017518 3300003771 Bacteria 2731
22 Ga0055526_1017648 3300003771 Bacteria 2715
23 Ga0055537_1000246 3300003773 Bacteria 39605
24 Ga0055537_1000414 3300003773 Bacteria 27997
25 Ga0055524_1000083 3300003775 Bacteria 119259
26 Ga0055536_1001325 3300003781 Bacteria 15163
27 Ga0055536_1005755 3300003781 Bacteria 5970
28 Ga0055536_1024297 3300003781 Bacteria 1758
29 Ga0055534_1000238 3300003784 Bacteria 39258
30 Ga0055534_1001261 3300003784 Bacteria 10366
31 Ga0055534_1004416 3300003784 Bacteria 4078
32 Ga0055528_1000450 3300003790 Bacteria 32880
33 Ga0055528_1000455 3300003790 Bacteria 32647
34 Ga0055530_10000327 3300003791 Bacteria 42981
35 Ga0055530_10001370 3300003791 Bacteria 18067
36 Ga0055530_10017685 3300003791 Bacteria 2224
37 Ga0055540_1000012 3300003792 Bacteria 262667
38 Ga0055540_1002252 3300003792 Bacteria 10408
39 Ga0055540_1005675 3300003792 Bacteria 5170
40 Ga0055540_1006807 3300003792 Bacteria 4457
41 Ga0055531_10003025 3300003794 Bacteria 10907
42 Ga0055531_10007586 3300003794 Bacteria 5881
43 Ga0055543_1000320 3300004625 Bacteria 33232
44 Ga0065165_1010448 3300005262 Bacteria 4012
45 Ga0065165_1011528 3300005262 Bacteria 3675
46 Ga0065165_1019350 3300005262 Bacteria 2434
47 Ga0070658_10254260 3300005327 Bacteria 1491
48 Ga0070680_100186769 3300005336 Bacteria 1746
49 Ga0070669_100127846 3300005353 Bacteria 1946
50 Ga0070659_100078333 3300005366 Bacteria 2637
51 Ga0070667_100217109 3300005367 Bacteria 1701
52 Ga0070667_100454861 3300005367 Bacteria 1170
53 Ga0070678_100051482 3300005456 Bacteria 2986
54 Ga0070662_100013017 3300005457 Bacteria 5529
55 Ga0070662_100135848 3300005457 Bacteria 1901
56 Ga0068853_100115804 3300005539 Bacteria 2386
57 Ga0068853_100241343 3300005539 Bacteria 1656
58 Ga0068853_100253652 3300005539 Bacteria 1615
59 Ga0070665_100050727 3300005548 Bacteria 4164
60 Ga0070664_100109732 3300005564 Bacteria 2407
61 Ga0068852_100200205 3300005616 Bacteria 1890
62 Ga0075363_100012674 3300006048 Bacteria 4067
63 Ga0075363_100046330 3300006048 Bacteria 2306
64 Ga0075364_10121202 3300006051 Bacteria 1750
65 Ga0075364_10136208 3300006051 Bacteria 1650
66 Ga0075432_10043771 3300006058 Bacteria 1569
67 Ga0075362_10025530 3300006177 Bacteria 2517
68 Ga0075362_10034192 3300006177 Bacteria 2214
69 Ga0075362_10043046 3300006177 Bacteria 1998
70 Ga0075370_10000123 3300006353 Bacteria 25631
71 Ga0075370_10000186 3300006353 Bacteria 21822
72 Ga0075370_10008137 3300006353 Bacteria 5382
73 Ga0075370_10009432 3300006353 Bacteria 5069
74 Ga0075370_10013997 3300006353 Bacteria 4271
75 Ga0075370_10062922 3300006353 Bacteria 2114
76 Ga0075370_10168505 3300006353 Bacteria 1287
77 Ga0099826_10003147 3300006948 Bacteria 11070
78 Ga0105244_10000970 3300009036 Bacteria 24111
79 Ga0105240_10066952 3300009093 Bacteria 4454
80 Ga0105243_10000527 3300009148 Bacteria 38948
81 Ga0105243_10004560 3300009148 Bacteria 10946
82 Ga0105243_10145559 3300009148 Bacteria 2027
83 Ga0105242_10014935 3300009176 Bacteria 6019
84 Ga0105237_10052415 3300009545 Bacteria 4096
85 Ga0105238_10580253 3300009551 Bacteria 1128
86 Ga0105246_10025372 3300011119 Bacteria 3863
87 Ga0157373_10013540 3300013100 Bacteria 5984
88 Ga0157371_10076290 3300013102 Bacteria 2373
89 Ga0157370_10247542 3300013104 Bacteria 1649
90 Ga0157375_10497940 3300013308 Bacteria 1383
91 Ga0182008_10001508 3300014497 Bacteria 15546
92 Ga0182008_10001879 3300014497 Bacteria 13663
93 Ga0182008_10030106 3300014497 Bacteria 2739
94 Ga0182008_10059734 3300014497 Bacteria 1881
95 Ga0182006_1005781 3300015261 Bacteria 5831
96 Ga0182006_1028788 3300015261 Bacteria 2256
97 Ga0182006_1032840 3300015261 Bacteria 2083
98 Ga0182007_10000399 3300015262 Bacteria 26817
99 Ga0182007_10001136 3300015262 Bacteria 14416
100 Ga0183362_10001 3300015683 Bacteria 2046624
101 Ga0163161_10000065 3300017792 Bacteria 108321
102 Ga0163161_10011367 3300017792 Bacteria 6173
103 Ga0163161_10042386 3300017792 Bacteria 3274
104 Ga0163161_10125381 3300017792 Bacteria 1933
105 Ga0213872_10008332 3300021361 Bacteria 5022
106 Ga0209435_100001 3300025206 Bacteria 1424171
107 Ga0209672_101073 3300025228 Bacteria 11654
108 Ga0209147_101870 3300025229 Bacteria 6410
109 Ga0209258_100048 3300025242 Bacteria 365881
110 Ga0207425_1000187 3300025245 Bacteria 50439
111 Ga0207425_1005712 3300025245 Bacteria 3507
112 Ga0207425_1009694 3300025245 Bacteria 2383
113 Ga0209646_1000001 3300025246 Bacteria 3092932
114 Ga0209026_1000003 3300025250 Bacteria 1060571
115 Ga0209148_1000040 3300025254 Bacteria 473531
116 Ga0209759_1000001 3300025256 Bacteria 2799452
117 Ga0209129_1000007 3300025258 Bacteria 771325
118 Ga0209565_1000004 3300025263 Bacteria 983150
119 Ga0209565_1000085 3300025263 Bacteria 153075
120 Ga0209565_1000105 3300025263 Bacteria 122895
121 Ga0209565_1000512 3300025263 Bacteria 27970
122 Ga0209565_1001851 3300025263 Bacteria 8485
123 Ga0209673_1000074 3300025273 Bacteria 233552
124 Ga0209673_1000739 3300025273 Bacteria 45015
125 Ga0209673_1001348 3300025273 Bacteria 24535
126 Ga0209673_1008091 3300025273 Bacteria 4728
127 Ga0209130_1000050 3300025284 Bacteria 222092
128 Ga0209130_1000172 3300025284 Bacteria 93199
129 Ga0209130_1000303 3300025284 Bacteria 60008
130 Ga0209130_1002660 3300025284 Bacteria 8535
131 Ga0209675_1000044 3300025291 Bacteria 230392
132 Ga0209675_1000083 3300025291 Bacteria 153075
133 Ga0209675_1003002 3300025291 Bacteria 8302
134 Ga0209675_1004165 3300025291 Bacteria 6550
135 Ga0209675_1006452 3300025291 Bacteria 4694
136 Ga0209675_1013155 3300025291 Bacteria 2611
137 Ga0209675_1023983 3300025291 Bacteria 1567
138 Ga0209676_1000004 3300025292 Bacteria 1138360
139 Ga0209676_1000029 3300025292 Bacteria 520536
140 Ga0209676_1000710 3300025292 Bacteria 46107
141 Ga0209676_1000779 3300025292 Bacteria 42577
142 Ga0209676_1006467 3300025292 Bacteria 5774
143 Ga0209676_1007774 3300025292 Bacteria 4938
144 Ga0209676_1009567 3300025292 Bacteria 4167
145 Ga0209676_1018878 3300025292 Bacteria 2391
146 Ga0209025_1000111 3300025294 Bacteria 218982
147 Ga0209025_1000600 3300025294 Bacteria 64945
148 Ga0209025_1000955 3300025294 Bacteria 43618
149 Ga0209025_1008130 3300025294 Bacteria 7618
150 Ga0209025_1009639 3300025294 Bacteria 6689
151 Ga0209025_1014549 3300025294 Bacteria 4827
152 Ga0209025_1061709 3300025294 Bacteria 1397
153 Ga0209025_1077758 3300025294 Bacteria 1142
154 Ga0209564_1000153 3300025295 Bacteria 166910
155 Ga0209564_1000337 3300025295 Bacteria 90545
156 Ga0209564_1000824 3300025295 Bacteria 42177
157 Ga0209564_1004308 3300025295 Bacteria 8799
158 Ga0209564_1004513 3300025295 Bacteria 8472
159 Ga0209758_1000025 3300025297 Bacteria 586687
160 Ga0209758_1009149 3300025297 Bacteria 6234
161 Ga0209758_1018098 3300025297 Bacteria 3472
162 Ga0209050_1000002 3300025298 Bacteria 1792849
163 Ga0209050_1000003 3300025298 Bacteria 1609245
164 Ga0209050_1000412 3300025298 Bacteria 79647
165 Ga0209050_1004498 3300025298 Bacteria 9379
166 Ga0209050_1004908 3300025298 Bacteria 8743
167 Ga0209256_1000001 3300025299 Bacteria 2166974
168 Ga0209256_1000425 3300025299 Bacteria 66308
169 Ga0209256_1003613 3300025299 Bacteria 10621
170 Ga0207426_1000001 3300025302 Bacteria 1341301
171 Ga0207426_1000028 3300025302 Bacteria 483955
172 Ga0207426_1000071 3300025302 Bacteria 329539
173 Ga0207426_1001024 3300025302 Bacteria 26788
174 Ga0209051_1000002 3300025303 Bacteria 1631846
175 Ga0209051_1000003 3300025303 Bacteria 1609245
176 Ga0209051_1000150 3300025303 Bacteria 132005
177 Ga0209051_1000268 3300025303 Bacteria 87155
178 Ga0209051_1000451 3300025303 Bacteria 54421
179 Ga0209051_1007014 3300025303 Bacteria 6241
180 Ga0209257_1000002 3300025304 Bacteria 1767052
181 Ga0209257_1000018 3300025304 Bacteria 836016
182 Ga0209257_1000275 3300025304 Bacteria 116952
183 Ga0209257_1005865 3300025304 Bacteria 8305
184 Ga0209257_1006894 3300025304 Bacteria 7111
185 Ga0209257_1008683 3300025304 Bacteria 5684
186 Ga0209257_1010510 3300025304 Bacteria 4667
187 Ga0207655_1000936 3300025728 Bacteria 30274
188 Ga0207682_10015099 3300025893 Bacteria 3008
189 Ga0207680_10367475 3300025903 Bacteria 1012
190 Ga0207681_10008934 3300025923 Bacteria 6118
191 Ga0207690_10072498 3300025932 Bacteria 2378
192 Ga0207706_10014409 3300025933 Bacteria 7166
193 Ga0207706_10107751 3300025933 Bacteria 2452
194 Ga0207709_10000815 3300025935 Bacteria 24134
195 Ga0207709_10002041 3300025935 Bacteria 13066
196 Ga0207709_10206021 3300025935 Bacteria 1408
197 Ga0207689_10329938 3300025942 Bacteria 1267
198 Ga0207679_10082427 3300025945 Bacteria 2462
199 Ga0207667_10091743 3300025949 Bacteria 3137
200 Ga0207667_10317147 3300025949 Bacteria 1592
201 Ga0207640_10236379 3300025981 Bacteria 1409
202 Ga0207658_10119188 3300025986 Bacteria 2101
203 Ga0207639_10148137 3300026041 Bacteria 1963
204 Ga0207683_10070787 3300026121 Bacteria 3082
205 Ga0207683_10104325 3300026121 Bacteria 2533
206 Ga0207683_10149871 3300026121 Bacteria 2105
207 Ga0209970_1001613 3300027614 Bacteria 3916
208 Ga0209282_1001087 3300027666 Bacteria 14411
209 Ga0268266_10098827 3300028379 Bacteria 2569
210 Ga0268265_10047500 3300028380 Bacteria 3217
211 Ga0307515_10000428 3300028794 Bacteria 101247
212 Ga0307515_10100716 3300028794 Bacteria 3495
213 Ga0316177_1060125 3300030731 Bacteria 6688
214 Ga0314311_1206624 3300030733 Bacteria 2770
215 Ga0316178_1073798 3300030735 Bacteria 1471
216 Ga0265327_10000293 3300031251 Bacteria 96862
217 Ga0265327_10071429 3300031251 Bacteria 1736
218 Ga0307513_10000014 3300031456 Bacteria 303157
219 Ga0307408_100000538 3300031548 Bacteria 32684
220 Ga0307408_100416322 3300031548 Bacteria 1157
221 Ga0307514_10005697 3300031649 Bacteria 11023
222 Ga0265314_10014000 3300031711 Bacteria 6449
223 Ga0307405_10014635 3300031731 Bacteria 4224
224 Ga0307405_10057620 3300031731 Bacteria 2441
225 Ga0307405_10071847 3300031731 Bacteria 2228
226 Ga0307405_10085716 3300031731 Bacteria 2071
227 Ga0307410_10034468 3300031852 Bacteria 3279
228 Ga0307406_10020909 3300031901 Bacteria 3863
229 Ga0307406_10240421 3300031901 Bacteria 1358
230 Ga0307406_10343922 3300031901 Bacteria 1163
231 Ga0307412_10089311 3300031911 Bacteria 2151
232 Ga0307412_10109360 3300031911 Bacteria 1970
233 Ga0307412_10112321 3300031911 Bacteria 1947
234 Ga0307412_10366343 3300031911 Bacteria 1162
235 Ga0307416_100069071 3300032002 Bacteria 2922
236 Ga0307414_10005352 3300032004 Bacteria 7063
237 Ga0307414_10502089 3300032004 Bacteria 1073
238 Ga0307414_10688555 3300032004 Bacteria 924
239 Ga0307411_10043924 3300032005 Bacteria 2862
240 Ga0307411_10070107 3300032005 Bacteria 2371
241 Ga0307411_10116115 3300032005 Bacteria 1926
242 Ga0395899_0010863 3300037312 Bacteria 6978
243 Ga0395899_0132864 3300037312 Unclassified 1776
244 Ga0395900_0009333 3300037418 Bacteria 10058
245 Ga0395900_0017829 3300037418 Bacteria 7246
246 Ga0395898_0003124 3300037466 Bacteria 18699
247 Ga0395898_0007854 3300037466 Bacteria 11321
248 Ga0395905_0000339 3300037471 Bacteria 66527
249 Ga0395905_0007557 3300037471 Bacteria 10798
250 Ga0395905_0016540 3300037471 Bacteria 7012
251 Ga0395905_0114973 3300037471 Bacteria 2528
252 Ga0395905_0230881 3300037471 Bacteria 1730
253 Ga0395905_0241837 3300037471 Bacteria 1686
254 Ga0395905_0289210 3300037471 Bacteria 1526
255 Ga0395905_0346643 3300037471 Bacteria 1377
256 Ga0395901_0009866 3300038443 Bacteria 9677
257 Ga0395901_0255171 3300038443 Bacteria 1826
258 Ga0436361_0955311 3300039447 Bacteria 18858
259 Ga0439436_0000338 3300041404 Bacteria 11564
260 Ga0439436_0043950 3300041404 Bacteria 1273
261 Ga0439439_0001930 3300041406 Bacteria 4287
262 Ga0439461_0038560 3300041410 Bacteria 1024
263 Ga0439466_0001095 3300041411 Bacteria 10525
264 Ga0439465_0053242 3300041413 Bacteria 1329
265 Ga0439465_0139062 3300041413 Bacteria 861
266 Ga0439431_0003210 3300041997 Bacteria 3592
267 Ga0439431_0024494 3300041997 Bacteria 1469
268 Ga0439433_0001104 3300041999 Bacteria 5506
269 Ga0439433_0043620 3300041999 Bacteria 1047
270 Ga0439442_004790 3300042002 Bacteria 2692
271 Ga0439445_0002711 3300042004 Bacteria 3942
272 Ga0439445_0003002 3300042004 Bacteria 3777
273 Ga0439432_000612 3300042006 Bacteria 13442
274 Ga0439432_000953 3300042006 Bacteria 10921
275 Ga0439432_007605 3300042006 Bacteria 3830
276 Ga0439449_0008905 3300042007 Bacteria 3807
277 Ga0439449_0013463 3300042007 Bacteria 3078
278 Ga0439449_0018326 3300042007 Bacteria 2627
279 Ga0439452_012265 3300042010 Bacteria 2443
280 Ga0439457_008787 3300042014 Bacteria 2370
281 Ga0439462_0013831 3300042015 Bacteria 2071
282 Ga0439462_0040396 3300042015 Bacteria 1244
283 Ga0450911_016088 3300042115 Bacteria 988
284 Ga0450921_000108 3300042123 Bacteria 2680
285 Ga0450923_002051 3300042125 Bacteria 2817
286 Ga0450923_019993 3300042125 Bacteria 1294
287 Ga0450897_000327 3300042128 Bacteria 2535
288 Ga0450898_000446 3300042134 Bacteria 4811
289 Ga0439446_0016799 3300042156 Bacteria 2040
290 Ga0439446_0031873 3300042156 Bacteria 1527
291 Ga0450908_004793 3300042184 Bacteria 2601
292 Ga0439434_0002554 3300042435 Bacteria 5298
293 Ga0439434_0025991 3300042435 Bacteria 1768
294 Ga0439434_0030409 3300042435 Bacteria 1639
295 Ga0439464_0002723 3300042439 Bacteria 4384
296 Ga0466969_0012127 3300044656 Bacteria 4555
297 Ga0466969_0035479 3300044656 Bacteria 2522
298 Ga0466965_0015551 3300044683 Bacteria 3615
299 Ga0466961_0011937 3300044693 Bacteria 5553
300 Ga0453684_0302611 3300044712 Bacteria 1817
301 Ga0466960_0024357 3300044901 Bacteria 2729
302 Ga0466959_0044271 3300045049 Bacteria 3280
303 Ga0466959_0151627 3300045049 Bacteria 1634
304 Ga0495627_003641 3300046453 Bacteria 6694
305 Ga0495638_0013932 3300046460 Bacteria 5454
306 Ga0495639_0088330 3300046475 Bacteria 1451
307 Ga0495610_0010983 3300046512 Bacteria 5575
308 Ga0495616_0020144 3300046513 Bacteria 3634
309 Ga0495620_0066267 3300046515 Bacteria 1488
310 Ga0495631_0000135 3300046518 Bacteria 50021
311 Ga0495637_0002483 3300046520 Bacteria 10187
312 Ga0495663_0020409 3300046525 Bacteria 1902
313 Ga0495663_0071690 3300046525 Bacteria 1104
314 Ga0495654_0001160 3300046530 Bacteria 18832
315 Ga0495654_0103901 3300046530 Bacteria 1304
316 Ga0495621_0037574 3300046539 Bacteria 1685
317 Ga0495645_0071030 3300046543 Bacteria 2512
318 Ga0495633_0095922 3300046558 Bacteria 1378
319 Ga0495656_0000223 3300046615 Bacteria 20232
320 Ga0495668_0073620 3300046616 Bacteria 1876
321 Ga0495625_0000436 3300046660 Bacteria 62756
322 Ga0495625_0178601 3300046660 Bacteria 1413
323 Ga0495588_0014173 3300046674 Bacteria 3812
324 Ga0495588_0016864 3300046674 Bacteria 3536
325 Ga0495588_0043158 3300046674 Bacteria 2307
326 Ga0495670_0018110 3300046691 Bacteria 3469
327 Ga0495671_0008420 3300046692 Bacteria 5803
328 Ga0495593_0155604 3300047673 Bacteria 1155
329 Ga0495615_0008010 3300048090 Bacteria 2026
330 Ga0496100_0006994 3300048903 Bacteria 6188
331 Ga0496100_0373386 3300048903 Bacteria 1082
332 Ga0496101_0054869 3300048904 Bacteria 2876
333 Ga0496101_0076743 3300048904 Bacteria 2462
334 Ga0496102_0002457 3300048905 Bacteria 15812
335 Ga0496103_0034771 3300048906 Bacteria 3083
336 Ga0496104_0003187 3300048907 Bacteria 14103
337 Ga0496105_0001816 3300048908 Bacteria 15280
338 Ga0496106_0031883 3300048909 Bacteria 3927
339 Ga0496108_0108442 3300048911 Bacteria 2372
340 Ga0496110_0007714 3300048913 Bacteria 8611
341 Ga0496110_0044455 3300048913 Bacteria 3878
342 Ga0496112_0140555 3300048915 Bacteria 2384
343 Ga0496114_0252333 3300048917 Bacteria 1552
344 Ga0496114_0364574 3300048917 Bacteria 1278
345 Ga0496116_0019603 3300048919 Bacteria 5173
346 Ga0496116_0062409 3300048919 Bacteria 2406
347 Ga0496116_0151780 3300048919 Bacteria 1285
348 Ga0496117_0058822 3300048920 Bacteria 2659
349 Ga0496117_0153589 3300048920 Bacteria 1359
350 Ga0496119_0037665 3300048922 Bacteria 3138
351 Ga0496119_0120094 3300048922 Bacteria 1446
352 Ga0496121_0003903 3300048924 Bacteria 20694
353 Ga0496121_0226013 3300048924 Bacteria 1314
354 Ga0496122_0000592 3300048925 Bacteria 74496
355 Ga0496122_0085171 3300048925 Bacteria 2182
356 Ga0496122_0111843 3300048925 Bacteria 1790
357 Ga0496123_0000656 3300048926 Bacteria 57313
358 Ga0496123_0040723 3300048926 Bacteria 3231
359 Ga0496123_0063178 3300048926 Bacteria 2368
360 Ga0496124_0044821 3300048927 Bacteria 3793
361 Ga0496124_0217601 3300048927 Bacteria 1439
362 Ga0496124_0316152 3300048927 Bacteria 1120
363 Ga0496125_0020271 3300048928 Bacteria 6243
364 Ga0496125_0021185 3300048928 Bacteria 6072
365 Ga0496125_0025184 3300048928 Bacteria 5455
366 Ga0496125_0077137 3300048928 Bacteria 2570
367 Ga0496126_0174971 3300048929 Bacteria 1826
368 Ga0496126_0206866 3300048929 Bacteria 1654
369 Ga0501031_0008190 3300049568 Bacteria 6803
370 Ga0501034_0187971 3300049571 Bacteria 2028
371 Ga0501043_0025037 3300049579 Bacteria 4682
372 Ga0501046_0062504 3300049580 Bacteria 2909
373 Ga0501047_0098312 3300049581 Bacteria 2805
374 Ga0501225_0002693 3300049705 Bacteria 5456
375 Ga0501262_000225 3300049759 Bacteria 6954
376 Ga0501266_001439 3300049763 Bacteria 3035
377 Ga0501044_0105530 3300049823 Bacteria 2830
378 nmdc:mga03683_13139_c1 3300050489 Bacteria 3040
379 nmdc:mga03683_32269_c1 3300050489 Bacteria 2106
380 nmdc:mga03683_38407_c1 3300050489 Bacteria 1955
381 nmdc:mga03683_7426_c1 3300050489 Bacteria 3804
382 nmdc:mga03n38_168147_c1 3300050490 Bacteria 1115
383 nmdc:mga03n38_35953_c1 3300050490 Bacteria 2126
384 nmdc:mga00v17_136269_c1 3300050491 Bacteria 1572
385 nmdc:mga0k408_218128_c1 3300050493 Bacteria 1139
386 nmdc:mga07m45_1094_c1 3300050496 Bacteria 12089
387 nmdc:mga07m45_1140_c1 3300050496 Bacteria 11908
388 nmdc:mga07m45_159536_c1 3300050496 Bacteria 1309
389 nmdc:mga07m45_213660_c1 3300050496 Bacteria 1122
390 nmdc:mga07m45_219217_c1 3300050496 Bacteria 1107
391 nmdc:mga07m45_23390_c1 3300050496 Bacteria 3377
392 nmdc:mga07m45_39504_c1 3300050496 Bacteria 2637
393 Ga0500610_0002426 3300053079 Bacteria 6861
394 Ga0500610_0005790 3300053079 Bacteria 5108
395 Ga0500643_001968 3300053087 Bacteria 11132
396 Ga0500644_0036099 3300053088 Bacteria 1606
397 Ga0500651_0000042 3300053093 Bacteria 87895
398 Ga0500650_0052127 3300053098 Bacteria 1902
399 Ga0500562_015475 3300053108 Bacteria 1957
400 Ga0500572_019065 3300053111 Bacteria 1787
401 Ga0500593_000922 3300053117 Bacteria 10921
402 Ga0500593_001598 3300053117 Bacteria 8164
403 Ga0500597_025706 3300053120 Bacteria 2376
404 Ga0500607_000790 3300053121 Bacteria 30561
405 Ga0500608_002191 3300053122 Bacteria 7037
406 Ga0500618_014554 3300053125 Bacteria 2006
407 Ga0500628_001023 3300053129 Bacteria 4878
408 Ga0500655_001319 3300053133 Bacteria 4703
409 Ga0500658_0000641 3300053134 Bacteria 14522
410 Ga0500658_0001086 3300053134 Bacteria 11125
411 Ga0500559_0001792 3300053136 Bacteria 11793
412 Ga0500559_0021347 3300053136 Bacteria 2743
413 Ga0500573_0054467 3300053140 Bacteria 2296
414 Ga0500574_000879 3300053141 Bacteria 4126
415 Ga0500577_0060758 3300053142 Bacteria 1452
416 Ga0500586_047593 3300053145 Bacteria 1472
417 Ga0500616_0048601 3300053153 Bacteria 2248
418 Ga0500634_0004711 3300053161 Bacteria 6365
419 Ga0500634_0032517 3300053161 Bacteria 2845
420 Ga0500638_053830 3300053162 Bacteria 1942
421 Ga0500636_0036757 3300053177 Bacteria 2898
422 Ga0500645_000100 3300053730 Bacteria 68299
423 Ga0500645_003222 3300053730 Bacteria 6753
424 Ga0500645_006249 3300053730 Bacteria 4274
425 Ga0500596_005879 3300053735 Bacteria 2119
426 Ga0500661_007194 3300055283 Bacteria 2065
427 Ga0590075_002696 3300059424 Bacteria 4246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0139062 Ga0439465_0139062_122_847 239
2 3300015261 Ga0182006_1028788 Ga0182006_10287882 254
3 3300053108 Ga0500562_015475 Ga0500562_015475_820_1599 254
4 3300013102 Ga0157371_10076290 Ga0157371_100762903 255
5 3300037418 Ga0395900_0009333 Ga0395900_0009333_42_845 255
6 3300048926 Ga0496123_0040723 Ga0496123_0040723_2428_3195 255
7 3300050490 nmdc:mga03n38_168147_c1 nmdc:mga03n38_168147_c1_301_1104 255
8 3300005353 Ga0070669_100127846 Ga0070669_1001278463 257
9 3300025923 Ga0207681_10008934 Ga0207681_100089345 257
10 3300048927 Ga0496124_0044821 Ga0496124_0044821_857_1759 257
11 3300046475 Ga0495639_0088330 Ga0495639_0088330_15_800 259
12 3300042115 Ga0450911_016088 Ga0450911_016088_28_822 260
13 3300045049 Ga0466959_0151627 Ga0466959_0151627_465_1349 268
14 3300059424 Ga0590075_002696 Ga0590075_002696_757_1605 269
15 3300003187 JGI25151J46595_10003325 JGI25151J46595_100033251 271
16 3300005327 Ga0070658_10254260 Ga0070658_102542601 271
17 3300025294 Ga0209025_1000600 Ga0209025_100060058 271
18 3300025903 Ga0207680_10367475 Ga0207680_103674751 273
19 3300041410 Ga0439461_0038560 Ga0439461_0038560_66_893 273
20 3300049763 Ga0501266_001439 Ga0501266_001439_2150_3001 273
21 3300050496 nmdc:mga07m45_213660_c1 nmdc:mga07m45_213660_c1_145_975 273
22 3300006353 Ga0075370_10000123 Ga0075370_1000012327 274
23 3300053142 Ga0500577_0060758 Ga0500577_0060758_159_1001 275
24 3300037471 Ga0395905_0230881 Ga0395905_0230881_168_1037 278
25 3300053145 Ga0500586_047593 Ga0500586_047593_179_1030 278
26 3300003781 Ga0055536_1024297 Ga0055536_10242972 279
27 3300031711 Ga0265314_10014000 Ga0265314_100140002 281
28 3300049571 Ga0501034_0187971 Ga0501034_0187971_150_1031 281
29 3300049579 Ga0501043_0025037 Ga0501043_0025037_1259_2140 281
30 3300049580 Ga0501046_0062504 Ga0501046_0062504_993_1874 281
31 3300049581 Ga0501047_0098312 Ga0501047_0098312_991_1872 281
32 3300049823 Ga0501044_0105530 Ga0501044_0105530_1415_2296 281
33 3300053125 Ga0500618_014554 Ga0500618_014554_896_1801 281
34 iso_pu_bacteria 2547132374 2548497252 282
35 iso_pu_bacteria 2643221570 2643865732 282
36 iso_pu_bacteria 2643221596 2643993020 282
37 iso_pu_bacteria 2643221609 2644060605 282
38 iso_pu_bacteria 2643221611 2644073926 282
39 iso_pu_bacteria 2643221652 2644294391 282
40 iso_pu_bacteria 2643221717 2644647580 282
41 iso_pu_bacteria 2738543012 2739242628 282
42 iso_pu_bacteria 2816332133 2816473051 282
43 iso_pu_bacteria 2842718218 2842719524 282
44 iso_pu_bacteria 2939631187 2939636719 282
45 iso_pu_bacteria 2974320154 2974323419 282
46 iso_pu_bacteria 2990710928 2990712554 282
47 3300003791 Ga0055530_10000327 Ga0055530_1000032710 283
48 3300003792 Ga0055540_1000012 Ga0055540_100001284 283
49 3300005336 Ga0070680_100186769 Ga0070680_1001867691 283
50 3300005539 Ga0068853_100253652 Ga0068853_1002536522 283
51 3300025284 Ga0209130_1000303 Ga0209130_100030337 283
52 3300025292 Ga0209676_1000029 Ga0209676_1000029232 283
53 3300025294 Ga0209025_1008130 Ga0209025_10081306 283
54 3300025298 Ga0209050_1000003 Ga0209050_1000003294 283
55 3300025302 Ga0207426_1001024 Ga0207426_100102422 283
56 3300025303 Ga0209051_1000003 Ga0209051_1000003294 283
57 3300025304 Ga0209257_1000018 Ga0209257_1000018294 283
58 3300037471 Ga0395905_0000339 Ga0395905_0000339_40177_41064 283
59 3300037471 Ga0395905_0016540 Ga0395905_0016540_4758_5660 283
60 3300046525 Ga0495663_0071690 Ga0495663_0071690_60_941 283
61 iso_pu_bacteria 2738543013 2739248880 283
62 iso_pu_bacteria 2842733646 2842735289 283
63 3300003792 Ga0055540_1006807 Ga0055540_10068072 284
64 3300021361 Ga0213872_10008332 Ga0213872_100083322 284
65 3300025949 Ga0207667_10317147 Ga0207667_103171472 284
66 3300027614 Ga0209970_1001613 Ga0209970_10016134 284
67 3300037312 Ga0395899_0010863 Ga0395899_0010863_1563_2459 284
68 3300037312 Ga0395899_0132864 Ga0395899_0132864_127_1017 284
69 3300037418 Ga0395900_0017829 Ga0395900_0017829_5939_6829 284
70 3300037466 Ga0395898_0003124 Ga0395898_0003124_17492_18382 284
71 3300037466 Ga0395898_0007854 Ga0395898_0007854_9324_10220 284
72 3300037471 Ga0395905_0007557 Ga0395905_0007557_1533_2432 284
73 3300037471 Ga0395905_0114973 Ga0395905_0114973_381_1271 284
74 3300037471 Ga0395905_0241837 Ga0395905_0241837_15_908 284
75 3300037471 Ga0395905_0289210 Ga0395905_0289210_172_1080 284
76 3300037471 Ga0395905_0346643 Ga0395905_0346643_462_1349 284
77 3300038443 Ga0395901_0009866 Ga0395901_0009866_3647_4537 284
78 3300038443 Ga0395901_0255171 Ga0395901_0255171_776_1672 284
79 3300039447 Ga0436361_0955311 Ga0436361_0955311_6507_7388 284
80 3300042439 Ga0439464_0002723 Ga0439464_0002723_2571_3464 284
81 3300044656 Ga0466969_0035479 Ga0466969_0035479_493_1386 284
82 iso_pu_bacteria 2842747753 2842748466 284
83 iso_pu_bacteria 2945909444 2945911345 284
84 iso_pu_bacteria 2945945610 2945947357 284
85 iso_pu_bacteria 2945984333 2945986367 284
86 3300003784 Ga0055534_1001261 Ga0055534_10012617 285
87 3300006051 Ga0075364_10136208 Ga0075364_101362082 285
88 3300025284 Ga0209130_1002660 Ga0209130_10026603 285
89 3300025291 Ga0209675_1003002 Ga0209675_10030027 285
90 3300025292 Ga0209676_1006467 Ga0209676_10064672 285
91 3300025303 Ga0209051_1007014 Ga0209051_10070147 285
92 3300025304 Ga0209257_1005865 Ga0209257_10058656 285
93 3300044712 Ga0453684_0302611 Ga0453684_0302611_145_1014 285
94 3300048922 Ga0496119_0120094 Ga0496119_0120094_112_999 285
95 3300048925 Ga0496122_0111843 Ga0496122_0111843_114_1001 285
96 3300049568 Ga0501031_0008190 Ga0501031_0008190_2108_2989 285
97 3300050491 nmdc:mga00v17_136269_c1 nmdc:mga00v17_136269_c1_532_1419 285
98 iso_pu_bacteria 2643221628 2644159427 285
99 iso_pu_bacteria 2842677519 2842679054 285
100 iso_pu_bacteria 2885192300 2885197514 285
101 iso_pu_bacteria 2904449895 2904456270 285
102 iso_pu_bacteria 2904456579 2904457626 285
103 iso_pu_bacteria 2904541872 2904543616 285
104 iso_pu_bacteria 2919462493 2919466984 285
105 iso_pu_bacteria 2929160207 2929162833 285
106 iso_pu_bacteria 2929520902 2929527329 285
107 iso_pu_bacteria 2945972063 2945977626 285
108 3300006177 Ga0075362_10025530 Ga0075362_100255303 286
109 3300006353 Ga0075370_10013997 Ga0075370_100139975 286
110 3300044656 Ga0466969_0012127 Ga0466969_0012127_3163_4062 286
111 3300044693 Ga0466961_0011937 Ga0466961_0011937_3342_4241 286
112 3300045049 Ga0466959_0044271 Ga0466959_0044271_1800_2699 286
113 3300050489 nmdc:mga03683_32269_c1 nmdc:mga03683_32269_c1_426_1343 286
114 3300050496 nmdc:mga07m45_219217_c1 nmdc:mga07m45_219217_c1_71_988 286
115 3300053136 Ga0500559_0001792 Ga0500559_0001792_8907_9806 286
116 3300053140 Ga0500573_0054467 Ga0500573_0054467_48_947 286
117 iso_pu_bacteria 2643221683 2644467978 286
118 iso_pu_bacteria 2919704043 2919704754 286
119 iso_pu_bacteria 2928084124 2928088264 286
120 3300014497 Ga0182008_10059734 Ga0182008_100597342 287
121 3300015683 Ga0183362_10001 Ga0183362_10001904 287
122 3300025245 Ga0207425_1005712 Ga0207425_10057122 287
123 3300025292 Ga0209676_1018878 Ga0209676_10188783 287
124 3300025294 Ga0209025_1061709 Ga0209025_10617091 287
125 3300031731 Ga0307405_10071847 Ga0307405_100718472 287
126 3300031901 Ga0307406_10240421 Ga0307406_102404212 287
127 3300042004 Ga0439445_0002711 Ga0439445_0002711_1001_1906 287
128 3300048903 Ga0496100_0373386 Ga0496100_0373386_41_922 287
129 3300048919 Ga0496116_0151780 Ga0496116_0151780_51_953 287
130 3300048924 Ga0496121_0003903 Ga0496121_0003903_8611_9516 287
131 3300048925 Ga0496122_0000592 Ga0496122_0000592_46091_46993 287
132 3300048926 Ga0496123_0000656 Ga0496123_0000656_11482_12384 287
133 3300048928 Ga0496125_0020271 Ga0496125_0020271_1709_2614 287
134 3300048928 Ga0496125_0077137 Ga0496125_0077137_1351_2256 287
135 3300048929 Ga0496126_0174971 Ga0496126_0174971_474_1379 287
136 3300053136 Ga0500559_0021347 Ga0500559_0021347_226_1128 287
137 iso_pu_bacteria 2818991446 2819597004 287
138 iso_pu_bacteria 2831265667 2831266087 287
139 iso_pu_bacteria 2838054893 2838057785 287
140 iso_pu_bacteria 2899924645 2899930255 287
141 iso_pu_bacteria 2928037797 2928039368 287
142 iso_pu_bacteria 2928044640 2928045027 287
143 iso_pu_bacteria 2928051484 2928052829 287
144 iso_pu_bacteria 2928064002 2928064499 287
145 3300006048 Ga0075363_100012674 Ga0075363_1000126743 288
146 3300006051 Ga0075364_10121202 Ga0075364_101212022 288
147 3300006177 Ga0075362_10043046 Ga0075362_100430462 288
148 3300013104 Ga0157370_10247542 Ga0157370_102475422 288
149 3300014497 Ga0182008_10030106 Ga0182008_100301062 288
150 3300015261 Ga0182006_1032840 Ga0182006_10328402 288
151 3300028794 Ga0307515_10000428 Ga0307515_1000042896 288
152 3300031251 Ga0265327_10000293 Ga0265327_1000029321 288
153 3300031911 Ga0307412_10109360 Ga0307412_101093602 288
154 3300032002 Ga0307416_100069071 Ga0307416_1000690712 288
155 3300032005 Ga0307411_10070107 Ga0307411_100701072 288
156 3300041404 Ga0439436_0000338 Ga0439436_0000338_1241_2116 288
157 3300041404 Ga0439436_0043950 Ga0439436_0043950_276_1151 288
158 3300041406 Ga0439439_0001930 Ga0439439_0001930_1073_1948 288
159 3300041411 Ga0439466_0001095 Ga0439466_0001095_3679_4554 288
160 3300041997 Ga0439431_0003210 Ga0439431_0003210_2637_3512 288
161 3300041999 Ga0439433_0001104 Ga0439433_0001104_83_958 288
162 3300041999 Ga0439433_0043620 Ga0439433_0043620_115_990 288
163 3300042002 Ga0439442_004790 Ga0439442_004790_1726_2601 288
164 3300042004 Ga0439445_0003002 Ga0439445_0003002_93_968 288
165 3300042006 Ga0439432_000612 Ga0439432_000612_12462_13337 288
166 3300042006 Ga0439432_000953 Ga0439432_000953_3938_4813 288
167 3300042006 Ga0439432_007605 Ga0439432_007605_1853_2728 288
168 3300042007 Ga0439449_0008905 Ga0439449_0008905_2143_3018 288
169 3300042007 Ga0439449_0013463 Ga0439449_0013463_2100_2975 288
170 3300042007 Ga0439449_0018326 Ga0439449_0018326_332_1207 288
171 3300042010 Ga0439452_012265 Ga0439452_012265_1019_1894 288
172 3300042014 Ga0439457_008787 Ga0439457_008787_1390_2265 288
173 3300042015 Ga0439462_0013831 Ga0439462_0013831_969_1844 288
174 3300042015 Ga0439462_0040396 Ga0439462_0040396_271_1146 288
175 3300042125 Ga0450923_019993 Ga0450923_019993_124_999 288
176 3300042128 Ga0450897_000327 Ga0450897_000327_1134_2009 288
177 3300042134 Ga0450898_000446 Ga0450898_000446_233_1108 288
178 3300042156 Ga0439446_0016799 Ga0439446_0016799_12_887 288
179 3300042156 Ga0439446_0031873 Ga0439446_0031873_469_1389 288
180 3300042435 Ga0439434_0002554 Ga0439434_0002554_886_1761 288
181 3300042435 Ga0439434_0025991 Ga0439434_0025991_225_1100 288
182 3300048917 Ga0496114_0364574 Ga0496114_0364574_86_997 288
183 3300050489 nmdc:mga03683_7426_c1 nmdc:mga03683_7426_c1_2474_3349 288
184 3300050490 nmdc:mga03n38_35953_c1 nmdc:mga03n38_35953_c1_975_1850 288
185 3300053088 Ga0500644_0036099 Ga0500644_0036099_350_1315 288
186 3300053730 Ga0500645_000100 Ga0500645_000100_57386_58303 288
187 iso_pu_bacteria 2513020051 2513226716 288
188 iso_pu_bacteria 2643221658 2644329354 288
189 iso_pu_bacteria 2643221672 2644401229 288
190 iso_pu_bacteria 2738541307 2738879093 288
191 iso_pu_bacteria 2954767861 2954772606 288
192 3300003322 rootL2_10011842 rootL2_100118422 289
193 3300003773 Ga0055537_1000414 Ga0055537_100041423 289
194 3300003784 Ga0055534_1000238 Ga0055534_100023818 289
195 3300003790 Ga0055528_1000455 Ga0055528_100045523 289
196 3300006058 Ga0075432_10043771 Ga0075432_100437712 289
197 3300006353 Ga0075370_10000186 Ga0075370_1000018617 289
198 3300006353 Ga0075370_10062922 Ga0075370_100629222 289
199 3300006948 Ga0099826_10003147 Ga0099826_100031474 289
200 3300013100 Ga0157373_10013540 Ga0157373_100135405 289
201 3300013308 Ga0157375_10497940 Ga0157375_104979401 289
202 3300015262 Ga0182007_10000399 Ga0182007_1000039912 289
203 3300017792 Ga0163161_10011367 Ga0163161_100113675 289
204 3300025263 Ga0209565_1000085 Ga0209565_100008518 289
205 3300025273 Ga0209673_1000739 Ga0209673_100073918 289
206 3300025273 Ga0209673_1001348 Ga0209673_100134821 289
207 3300025291 Ga0209675_1000083 Ga0209675_100008318 289
208 3300025294 Ga0209025_1014549 Ga0209025_10145492 289
209 3300025303 Ga0209051_1000268 Ga0209051_100026841 289
210 3300026121 Ga0207683_10070787 Ga0207683_100707873 289
211 3300027666 Ga0209282_1001087 Ga0209282_100108710 289
212 3300028379 Ga0268266_10098827 Ga0268266_100988273 289
213 3300030731 Ga0316177_1060125 Ga0316177_10601253 289
214 3300030733 Ga0314311_1206624 Ga0314311_12066242 289
215 3300030735 Ga0316178_1073798 Ga0316178_10737982 289
216 3300031251 Ga0265327_10071429 Ga0265327_100714291 289
217 3300031456 Ga0307513_10000014 Ga0307513_10000014209 289
218 3300031548 Ga0307408_100416322 Ga0307408_1004163221 289
219 3300031649 Ga0307514_10005697 Ga0307514_100056977 289
220 3300031731 Ga0307405_10057620 Ga0307405_100576202 289
221 3300031731 Ga0307405_10085716 Ga0307405_100857162 289
222 3300031901 Ga0307406_10020909 Ga0307406_100209092 289
223 3300031901 Ga0307406_10343922 Ga0307406_103439222 289
224 3300031911 Ga0307412_10089311 Ga0307412_100893112 289
225 3300031911 Ga0307412_10112321 Ga0307412_101123212 289
226 3300031911 Ga0307412_10366343 Ga0307412_103663432 289
227 3300032004 Ga0307414_10005352 Ga0307414_100053524 289
228 3300032004 Ga0307414_10502089 Ga0307414_105020891 289
229 3300032005 Ga0307411_10043924 Ga0307411_100439243 289
230 3300042125 Ga0450923_002051 Ga0450923_002051_1091_1969 289
231 3300046539 Ga0495621_0037574 Ga0495621_0037574_698_1579 289
232 3300046543 Ga0495645_0071030 Ga0495645_0071030_443_1324 289
233 3300046660 Ga0495625_0000436 Ga0495625_0000436_45900_46778 289
234 3300046674 Ga0495588_0043158 Ga0495588_0043158_208_1089 289
235 3300047673 Ga0495593_0155604 Ga0495593_0155604_17_898 289
236 3300048903 Ga0496100_0006994 Ga0496100_0006994_2935_3816 289
237 3300048904 Ga0496101_0076743 Ga0496101_0076743_684_1565 289
238 3300048905 Ga0496102_0002457 Ga0496102_0002457_9430_10311 289
239 3300048906 Ga0496103_0034771 Ga0496103_0034771_801_1682 289
240 3300048907 Ga0496104_0003187 Ga0496104_0003187_3145_4026 289
241 3300048908 Ga0496105_0001816 Ga0496105_0001816_4319_5200 289
242 3300048909 Ga0496106_0031883 Ga0496106_0031883_2059_2940 289
243 3300048911 Ga0496108_0108442 Ga0496108_0108442_1053_1934 289
244 3300048913 Ga0496110_0007714 Ga0496110_0007714_3081_3962 289
245 3300048913 Ga0496110_0044455 Ga0496110_0044455_598_1479 289
246 3300048915 Ga0496112_0140555 Ga0496112_0140555_678_1559 289
247 3300048917 Ga0496114_0252333 Ga0496114_0252333_177_1058 289
248 3300049705 Ga0501225_0002693 Ga0501225_0002693_2756_3667 289
249 3300049759 Ga0501262_000225 Ga0501262_000225_4151_5035 289
250 3300050489 nmdc:mga03683_13139_c1 nmdc:mga03683_13139_c1_580_1458 289
251 3300050496 nmdc:mga07m45_1094_c1 nmdc:mga07m45_1094_c1_7516_8427 289
252 3300050496 nmdc:mga07m45_23390_c1 nmdc:mga07m45_23390_c1_1856_2734 289
253 3300053730 Ga0500645_003222 Ga0500645_003222_5551_6474 289
254 iso_pu_bacteria 2738541277 2738717491 289
255 iso_pu_bacteria 2738543019 2739278177 289
256 iso_pu_bacteria 2885198086 2885203745 289
257 iso_pu_bacteria 2885211737 2885216905 289
258 3300002704 JGI25155J39150_1000002 JGI25155J39150_1000002181 290
259 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003125 290
260 3300002738 JGI25154J39366_1000009 JGI25154J39366_1000009181 290
261 3300002741 JGI25157J39369_1000002 JGI25157J39369_1000002181 290
262 3300003187 JGI25151J46595_10002791 JGI25151J46595_100027917 290
263 3300003781 Ga0055536_1001325 Ga0055536_100132510 290
264 3300003791 Ga0055530_10017685 Ga0055530_100176852 290
265 3300003792 Ga0055540_1002252 Ga0055540_10022526 290
266 3300003792 Ga0055540_1005675 Ga0055540_10056752 290
267 3300003794 Ga0055531_10007586 Ga0055531_100075866 290
268 3300005366 Ga0070659_100078333 Ga0070659_1000783332 290
269 3300005367 Ga0070667_100217109 Ga0070667_1002171092 290
270 3300005367 Ga0070667_100454861 Ga0070667_1004548611 290
271 3300005457 Ga0070662_100013017 Ga0070662_1000130175 290
272 3300005457 Ga0070662_100135848 Ga0070662_1001358482 290
273 3300005539 Ga0068853_100241343 Ga0068853_1002413432 290
274 3300005564 Ga0070664_100109732 Ga0070664_1001097322 290
275 3300005616 Ga0068852_100200205 Ga0068852_1002002052 290
276 3300006048 Ga0075363_100046330 Ga0075363_1000463302 290
277 3300006177 Ga0075362_10034192 Ga0075362_100341923 290
278 3300006353 Ga0075370_10008137 Ga0075370_100081372 290
279 3300006353 Ga0075370_10009432 Ga0075370_100094323 290
280 3300009036 Ga0105244_10000970 Ga0105244_1000097025 290
281 3300009148 Ga0105243_10000527 Ga0105243_1000052727 290
282 3300009148 Ga0105243_10004560 Ga0105243_100045606 290
283 3300009148 Ga0105243_10145559 Ga0105243_101455592 290
284 3300009545 Ga0105237_10052415 Ga0105237_100524153 290
285 3300009551 Ga0105238_10580253 Ga0105238_105802531 290
286 3300011119 Ga0105246_10025372 Ga0105246_100253722 290
287 3300014497 Ga0182008_10001508 Ga0182008_100015084 290
288 3300014497 Ga0182008_10001879 Ga0182008_100018796 290
289 3300015261 Ga0182006_1005781 Ga0182006_10057813 290
290 3300015262 Ga0182007_10001136 Ga0182007_100011363 290
291 3300017792 Ga0163161_10000065 Ga0163161_1000006533 290
292 3300017792 Ga0163161_10042386 Ga0163161_100423862 290
293 3300017792 Ga0163161_10125381 Ga0163161_101253812 290
294 3300025206 Ga0209435_100001 Ga0209435_100001536 290
295 3300025246 Ga0209646_1000001 Ga0209646_1000001905 290
296 3300025250 Ga0209026_1000003 Ga0209026_1000003536 290
297 3300025256 Ga0209759_1000001 Ga0209759_1000001536 290
298 3300025291 Ga0209675_1023983 Ga0209675_10239832 290
299 3300025292 Ga0209676_1000710 Ga0209676_100071047 290
300 3300025292 Ga0209676_1000779 Ga0209676_100077941 290
301 3300025292 Ga0209676_1009567 Ga0209676_10095674 290
302 3300025294 Ga0209025_1000955 Ga0209025_100095540 290
303 3300025298 Ga0209050_1000412 Ga0209050_100041247 290
304 3300025298 Ga0209050_1004908 Ga0209050_10049085 290
305 3300025303 Ga0209051_1000150 Ga0209051_100015096 290
306 3300025303 Ga0209051_1000451 Ga0209051_10004516 290
307 3300025304 Ga0209257_1000275 Ga0209257_100027566 290
308 3300025304 Ga0209257_1006894 Ga0209257_10068946 290
309 3300025728 Ga0207655_1000936 Ga0207655_100093616 290
310 3300025893 Ga0207682_10015099 Ga0207682_100150992 290
311 3300025932 Ga0207690_10072498 Ga0207690_100724982 290
312 3300025933 Ga0207706_10014409 Ga0207706_100144095 290
313 3300025933 Ga0207706_10107751 Ga0207706_101077512 290
314 3300025935 Ga0207709_10000815 Ga0207709_1000081516 290
315 3300025935 Ga0207709_10002041 Ga0207709_100020417 290
316 3300025935 Ga0207709_10206021 Ga0207709_102060212 290
317 3300025945 Ga0207679_10082427 Ga0207679_100824272 290
318 3300025949 Ga0207667_10091743 Ga0207667_100917433 290
319 3300025986 Ga0207658_10119188 Ga0207658_101191882 290
320 3300026041 Ga0207639_10148137 Ga0207639_101481372 290
321 3300026121 Ga0207683_10149871 Ga0207683_101498712 290
322 3300028380 Ga0268265_10047500 Ga0268265_100475004 290
323 3300028794 Ga0307515_10100716 Ga0307515_101007162 290
324 3300031548 Ga0307408_100000538 Ga0307408_10000053829 290
325 3300031731 Ga0307405_10014635 Ga0307405_100146352 290
326 3300031852 Ga0307410_10034468 Ga0307410_100344683 290
327 3300032004 Ga0307414_10688555 Ga0307414_106885551 290
328 3300032005 Ga0307411_10116115 Ga0307411_101161152 290
329 3300041413 Ga0439465_0053242 Ga0439465_0053242_235_1116 290
330 3300041997 Ga0439431_0024494 Ga0439431_0024494_383_1264 290
331 3300042123 Ga0450921_000108 Ga0450921_000108_613_1494 290
332 3300042184 Ga0450908_004793 Ga0450908_004793_1164_2045 290
333 3300042435 Ga0439434_0030409 Ga0439434_0030409_354_1235 290
334 3300044683 Ga0466965_0015551 Ga0466965_0015551_347_1234 290
335 3300044901 Ga0466960_0024357 Ga0466960_0024357_879_1766 290
336 3300046453 Ga0495627_003641 Ga0495627_003641_2974_3882 290
337 3300046460 Ga0495638_0013932 Ga0495638_0013932_1347_2219 290
338 3300046512 Ga0495610_0010983 Ga0495610_0010983_1842_2714 290
339 3300046513 Ga0495616_0020144 Ga0495616_0020144_1501_2373 290
340 3300046515 Ga0495620_0066267 Ga0495620_0066267_158_1030 290
341 3300046518 Ga0495631_0000135 Ga0495631_0000135_2764_3636 290
342 3300046520 Ga0495637_0002483 Ga0495637_0002483_1549_2463 290
343 3300046525 Ga0495663_0020409 Ga0495663_0020409_973_1863 290
344 3300046530 Ga0495654_0001160 Ga0495654_0001160_8062_8976 290
345 3300046530 Ga0495654_0103901 Ga0495654_0103901_118_1032 290
346 3300046558 Ga0495633_0095922 Ga0495633_0095922_353_1267 290
347 3300046615 Ga0495656_0000223 Ga0495656_0000223_14603_15493 290
348 3300046616 Ga0495668_0073620 Ga0495668_0073620_180_1052 290
349 3300046660 Ga0495625_0178601 Ga0495625_0178601_358_1230 290
350 3300046674 Ga0495588_0014173 Ga0495588_0014173_2255_3127 290
351 3300046674 Ga0495588_0016864 Ga0495588_0016864_1618_2499 290
352 3300046691 Ga0495670_0018110 Ga0495670_0018110_1977_2867 290
353 3300046692 Ga0495671_0008420 Ga0495671_0008420_1079_1993 290
354 3300048090 Ga0495615_0008010 Ga0495615_0008010_470_1360 290
355 3300048919 Ga0496116_0019603 Ga0496116_0019603_4244_5116 290
356 3300048919 Ga0496116_0062409 Ga0496116_0062409_262_1143 290
357 3300048920 Ga0496117_0058822 Ga0496117_0058822_1609_2490 290
358 3300048920 Ga0496117_0153589 Ga0496117_0153589_334_1215 290
359 3300048922 Ga0496119_0037665 Ga0496119_0037665_1127_1999 290
360 3300048924 Ga0496121_0226013 Ga0496121_0226013_206_1087 290
361 3300048925 Ga0496122_0085171 Ga0496122_0085171_1037_1909 290
362 3300048926 Ga0496123_0063178 Ga0496123_0063178_1344_2252 290
363 3300048927 Ga0496124_0217601 Ga0496124_0217601_365_1246 290
364 3300048928 Ga0496125_0025184 Ga0496125_0025184_3057_3938 290
365 3300048929 Ga0496126_0206866 Ga0496126_0206866_366_1238 290
366 3300050489 nmdc:mga03683_38407_c1 nmdc:mga03683_38407_c1_485_1366 290
367 3300050493 nmdc:mga0k408_218128_c1 nmdc:mga0k408_218128_c1_109_990 290
368 3300050496 nmdc:mga07m45_1140_c1 nmdc:mga07m45_1140_c1_7879_8760 290
369 3300050496 nmdc:mga07m45_159536_c1 nmdc:mga07m45_159536_c1_89_961 290
370 3300050496 nmdc:mga07m45_39504_c1 nmdc:mga07m45_39504_c1_656_1537 290
371 3300053079 Ga0500610_0002426 Ga0500610_0002426_265_1239 290
372 3300053079 Ga0500610_0005790 Ga0500610_0005790_325_1239 290
373 3300053087 Ga0500643_001968 Ga0500643_001968_7184_8056 290
374 3300053093 Ga0500651_0000042 Ga0500651_0000042_39657_40529 290
375 3300053111 Ga0500572_019065 Ga0500572_019065_95_967 290
376 3300053117 Ga0500593_001598 Ga0500593_001598_3814_4728 290
377 3300053120 Ga0500597_025706 Ga0500597_025706_1463_2335 290
378 3300053121 Ga0500607_000790 Ga0500607_000790_804_1718 290
379 3300053122 Ga0500608_002191 Ga0500608_002191_2551_3432 290
380 3300053133 Ga0500655_001319 Ga0500655_001319_2585_3457 290
381 3300053134 Ga0500658_0000641 Ga0500658_0000641_5217_6089 290
382 3300053134 Ga0500658_0001086 Ga0500658_0001086_8370_9242 290
383 3300053141 Ga0500574_000879 Ga0500574_000879_2928_3800 290
384 3300053153 Ga0500616_0048601 Ga0500616_0048601_42_914 290
385 3300053161 Ga0500634_0004711 Ga0500634_0004711_3157_4131 290
386 3300053161 Ga0500634_0032517 Ga0500634_0032517_330_1202 290
387 3300053162 Ga0500638_053830 Ga0500638_053830_774_1646 290
388 3300053177 Ga0500636_0036757 Ga0500636_0036757_1388_2260 290
389 iso_pu_bacteria 2511231002 2511243705 290
390 3300001979 JGI24740J21852_10006548 JGI24740J21852_100065486 291
391 3300001989 JGI24739J22299_10019132 JGI24739J22299_100191322 291
392 3300002987 JGI25159J45721_1000204 JGI25159J45721_100020428 291
393 3300003187 JGI25151J46595_10013259 JGI25151J46595_100132592 291
394 3300003316 rootH1_10044355 rootH1_100443551 291
395 3300003354 JGI25160J50197_1000277 JGI25160J50197_100027732 291
396 3300003354 JGI25160J50197_1024956 JGI25160J50197_10249562 291
397 3300003374 JGI25161J50226_1000018 JGI25161J50226_1000018126 291
398 3300003374 JGI25161J50226_1004682 JGI25161J50226_10046822 291
399 3300003578 Ga0006562J51391_1052559 Ga0006562J51391_10525592 291
400 3300003761 Ga0055535_1001577 Ga0055535_10015775 291
401 3300003762 Ga0055542_1000027 Ga0055542_100002741 291
402 3300003771 Ga0055526_1017518 Ga0055526_10175183 291
403 3300003771 Ga0055526_1017648 Ga0055526_10176481 291
404 3300003773 Ga0055537_1000246 Ga0055537_10002466 291
405 3300003775 Ga0055524_1000083 Ga0055524_100008385 291
406 3300003781 Ga0055536_1005755 Ga0055536_10057556 291
407 3300003784 Ga0055534_1004416 Ga0055534_10044166 291
408 3300003790 Ga0055528_1000450 Ga0055528_100045016 291
409 3300003791 Ga0055530_10001370 Ga0055530_100013706 291
410 3300003794 Ga0055531_10003025 Ga0055531_100030259 291
411 3300004625 Ga0055543_1000320 Ga0055543_100032024 291
412 3300005262 Ga0065165_1010448 Ga0065165_10104486 291
413 3300005262 Ga0065165_1011528 Ga0065165_10115282 291
414 3300005262 Ga0065165_1019350 Ga0065165_10193502 291
415 3300005456 Ga0070678_100051482 Ga0070678_1000514824 291
416 3300005539 Ga0068853_100115804 Ga0068853_1001158042 291
417 3300005548 Ga0070665_100050727 Ga0070665_1000507272 291
418 3300006353 Ga0075370_10168505 Ga0075370_101685052 291
419 3300009093 Ga0105240_10066952 Ga0105240_100669523 291
420 3300009176 Ga0105242_10014935 Ga0105242_100149352 291
421 3300025228 Ga0209672_101073 Ga0209672_10107312 291
422 3300025229 Ga0209147_101870 Ga0209147_1018704 291
423 3300025242 Ga0209258_100048 Ga0209258_100048334 291
424 3300025245 Ga0207425_1000187 Ga0207425_100018749 291
425 3300025245 Ga0207425_1009694 Ga0207425_10096942 291
426 3300025254 Ga0209148_1000040 Ga0209148_1000040334 291
427 3300025258 Ga0209129_1000007 Ga0209129_1000007223 291
428 3300025263 Ga0209565_1000004 Ga0209565_1000004669 291
429 3300025263 Ga0209565_1000105 Ga0209565_100010542 291
430 3300025263 Ga0209565_1000512 Ga0209565_10005124 291
431 3300025263 Ga0209565_1001851 Ga0209565_10018512 291
432 3300025273 Ga0209673_1000074 Ga0209673_1000074113 291
433 3300025273 Ga0209673_1008091 Ga0209673_10080915 291
434 3300025284 Ga0209130_1000050 Ga0209130_1000050126 291
435 3300025284 Ga0209130_1000172 Ga0209130_100017258 291
436 3300025291 Ga0209675_1000044 Ga0209675_100004492 291
437 3300025291 Ga0209675_1004165 Ga0209675_10041656 291
438 3300025291 Ga0209675_1006452 Ga0209675_10064522 291
439 3300025291 Ga0209675_1013155 Ga0209675_10131554 291
440 3300025292 Ga0209676_1000004 Ga0209676_1000004974 291
441 3300025292 Ga0209676_1007774 Ga0209676_10077743 291
442 3300025294 Ga0209025_1000111 Ga0209025_100011159 291
443 3300025294 Ga0209025_1009639 Ga0209025_10096397 291
444 3300025294 Ga0209025_1077758 Ga0209025_10777581 291
445 3300025295 Ga0209564_1000153 Ga0209564_1000153132 291
446 3300025295 Ga0209564_1000337 Ga0209564_100033760 291
447 3300025295 Ga0209564_1000824 Ga0209564_100082430 291
448 3300025295 Ga0209564_1004308 Ga0209564_10043089 291
449 3300025295 Ga0209564_1004513 Ga0209564_10045138 291
450 3300025297 Ga0209758_1000025 Ga0209758_1000025303 291
451 3300025297 Ga0209758_1009149 Ga0209758_10091492 291
452 3300025297 Ga0209758_1018098 Ga0209758_10180986 291
453 3300025298 Ga0209050_1000002 Ga0209050_10000021484 291
454 3300025298 Ga0209050_1004498 Ga0209050_100449813 291
455 3300025299 Ga0209256_1000001 Ga0209256_1000001298 291
456 3300025299 Ga0209256_1000425 Ga0209256_100042539 291
457 3300025299 Ga0209256_1003613 Ga0209256_10036132 291
458 3300025302 Ga0207426_1000001 Ga0207426_1000001275 291
459 3300025302 Ga0207426_1000028 Ga0207426_1000028166 291
460 3300025302 Ga0207426_1000071 Ga0207426_1000071130 291
461 3300025303 Ga0209051_1000002 Ga0209051_10000021254 291
462 3300025304 Ga0209257_1000002 Ga0209257_10000021395 291
463 3300025304 Ga0209257_1008683 Ga0209257_10086837 291
464 3300025304 Ga0209257_1010510 Ga0209257_10105101 291
465 3300025942 Ga0207689_10329938 Ga0207689_103299381 291
466 3300025981 Ga0207640_10236379 Ga0207640_102363792 291
467 3300026121 Ga0207683_10104325 Ga0207683_101043252 291
468 3300048904 Ga0496101_0054869 Ga0496101_0054869_398_1282 291
469 3300048927 Ga0496124_0316152 Ga0496124_0316152_49_924 291
470 3300048928 Ga0496125_0021185 Ga0496125_0021185_3846_4721 291
471 3300053098 Ga0500650_0052127 Ga0500650_0052127_490_1428 291
472 3300053117 Ga0500593_000922 Ga0500593_000922_5901_6839 291
473 3300053129 Ga0500628_001023 Ga0500628_001023_1995_2933 291
474 3300053730 Ga0500645_006249 Ga0500645_006249_3156_4094 291
475 3300053735 Ga0500596_005879 Ga0500596_005879_319_1218 291
476 3300055283 Ga0500661_007194 Ga0500661_007194_1081_2019 291
477 iso_pu_bacteria 2599185214 2599625050 291
478 iso_pu_bacteria 2599185226 2599673062 291
479 iso_pu_bacteria 2599185227 2599682488 291
480 iso_pu_bacteria 2599185229 2599694670 291
481 iso_pu_bacteria 2928070936 2928075087 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

43

324

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yim-assembly2.cif.gz_C the enolisation chemistry of a thioester-dependent racemase: the 1.4 a crystal structure of a complex with a planar reaction intermediate analogue 0.8655 11 291
2g04-assembly2.cif.gz_D crystal structure of fatty acid-coa racemase from mycobacterium tuberculosis h37rv 0.8615 11 291
2gd0-assembly1.cif.gz_A the 1,1-proton transfer reaction mechanism by alpha-methylacyl-coa racemase is catalyzed by an aspartate/histidine pair and involves a smooth, methionine-rich surface for binding the fatty acyl moiety 0.8608 11 291
1xvu-assembly1.cif.gz_A crystal structure of caib mutant d169a in complex with coenzyme a 0.8521 10 291
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.8495 11 291
ID Description Score Start End Superfamily
4ed9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9044 10 205 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9042 11 205 3.40.50.10540
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8963 16 45 3.50.50.60
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8721 36 221 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.869 11 249 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A7V9G173-F1-model_v4 CoA transferase 0.9795 10 199 GO:0016740
AF-A0A4V1TVA9-F1-model_v4 CoA transferase 0.9776 10 290 GO:0016740
AF-A0A4Q5VJT4-F1-model_v4 deleted 0.9758 10 189
AF-A0A2D0IAY7-F1-model_v4 CoA transferase 0.9754 10 291 GO:0016740
AF-A0A4V3YWV1-F1-model_v4 CoA transferase 0.9748 10 291 GO:0016740

Feature Viewer

pLDDT pTM Quality
91.58 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map