F452396

General Info

Members Datasets Scaffolds Average Seq Length
481 228 962 125

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11466229|Ga0114129_114662292
Length 129
Sequence MTTHLAADLAVSLEEDRPGALAKAITCIAGAGINIDGYSEMNGVVHVLVLTTDLAAARQSLGKAGFHEVQEQDVVVVPVSNQPGAAAKVFQRIADAHINVRYSYMATGNRLVIASSHPQSVIDLIRMQD

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
155 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
156 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
157 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
158 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
162 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
207 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
211 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
212 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.46
Rhizosphere 98.34
Stem 0
Stem Tuber 0
Unclassified 26.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_11466229 3300009147 Unclassified 840
2 Ga0065712_10067780 3300005290 Bacteria 37076
3 Ga0065712_10229394 3300005290 Bacteria 1016
4 Ga0065715_10221750 3300005293 Unclassified 1269
5 Ga0065715_10256919 3300005293 Bacteria 1136
6 Ga0065715_10652198 3300005293 Bacteria 678
7 Ga0065707_10395110 3300005295 Bacteria 860
8 Ga0065707_10415650 3300005295 Bacteria 836
9 Ga0065707_10598323 3300005295 Bacteria 691
10 Ga0070676_10003147 3300005328 Bacteria 8536
11 Ga0070677_10003931 3300005333 Bacteria 4821
12 Ga0070677_10361228 3300005333 Bacteria 755
13 Ga0068869_100018367 3300005334 Bacteria 4758
14 Ga0070666_10065357 3300005335 Bacteria 2468
15 Ga0070680_100296401 3300005336 Bacteria 1371
16 Ga0070680_100545302 3300005336 Bacteria 994
17 Ga0068868_100099109 3300005338 Bacteria 2357
18 Ga0070660_100866517 3300005339 Bacteria 761
19 Ga0070689_100069231 3300005340 Bacteria 2753
20 Ga0070689_100076747 3300005340 Bacteria 2618
21 Ga0070691_10365162 3300005341 Unclassified 805
22 Ga0070687_100079537 3300005343 Bacteria 1785
23 Ga0070687_100610428 3300005343 Unclassified 751
24 Ga0070661_100301285 3300005344 Bacteria 1248
25 Ga0070692_10158222 3300005345 Bacteria 1296
26 Ga0070668_100651391 3300005347 Bacteria 925
27 Ga0070669_100007402 3300005353 Bacteria 7866
28 Ga0070669_100684037 3300005353 Bacteria 865
29 Ga0070675_100029940 3300005354 Unclassified 4392
30 Ga0070675_100077072 3300005354 Bacteria 2774
31 Ga0070675_100077097 3300005354 Bacteria 2774
32 Ga0070675_101925884 3300005354 Unclassified 545
33 Ga0070671_100744323 3300005355 Bacteria 852
34 Ga0070674_100071641 3300005356 Bacteria 2452
35 Ga0070674_101496129 3300005356 Unclassified 607
36 Ga0070673_100007315 3300005364 Bacteria 7270
37 Ga0070688_100314134 3300005365 Unclassified 1136
38 Ga0070659_100168499 3300005366 Bacteria 1793
39 Ga0070667_100055183 3300005367 Bacteria 3356
40 Ga0070703_10379078 3300005406 Unclassified 611
41 Ga0070701_10005870 3300005438 Bacteria 5120
42 Ga0070701_10019264 3300005438 Bacteria 3221
43 Ga0070705_100000360 3300005440 Bacteria 26718
44 Ga0070705_101184716 3300005440 Unclassified 629
45 Ga0070700_100020810 3300005441 Bacteria 3808
46 Ga0070700_100097799 3300005441 Bacteria 1928
47 Ga0070700_100099623 3300005441 Bacteria 1912
48 Ga0070700_100106185 3300005441 Bacteria 1858
49 Ga0070700_100731396 3300005441 Bacteria 790
50 Ga0070694_100000764 3300005444 Bacteria 17972
51 Ga0070694_100002502 3300005444 Bacteria 10848
52 Ga0070694_100223128 3300005444 Bacteria 1414
53 Ga0070694_100255608 3300005444 Bacteria 1327
54 Ga0070694_100464910 3300005444 Bacteria 1001
55 Ga0070694_100572287 3300005444 Bacteria 907
56 Ga0070708_100196588 3300005445 Unclassified 1887
57 Ga0070708_100358648 3300005445 Bacteria 1374
58 Ga0070708_100915444 3300005445 Unclassified 823
59 Ga0070678_100472511 3300005456 Bacteria 1102
60 Ga0070678_100761055 3300005456 Bacteria 877
61 Ga0070678_101804185 3300005456 Bacteria 577
62 Ga0070662_100101860 3300005457 Bacteria 2174
63 Ga0068867_100193385 3300005459 Bacteria 1625
64 Ga0070685_10029097 3300005466 Bacteria 3066
65 Ga0070706_100808475 3300005467 Unclassified 868
66 Ga0070707_100033423 3300005468 Unclassified 4904
67 Ga0070707_100074747 3300005468 Unclassified 3268
68 Ga0070698_100013909 3300005471 Bacteria 8512
69 Ga0070698_100050664 3300005471 Bacteria 4232
70 Ga0070698_100062138 3300005471 Bacteria 3768
71 Ga0070698_100366315 3300005471 Bacteria 1373
72 Ga0070698_101149862 3300005471 Bacteria 725
73 Ga0070699_100009087 3300005518 Bacteria 8616
74 Ga0070699_100013747 3300005518 Bacteria 6963
75 Ga0070699_100041658 3300005518 Unclassified 3974
76 Ga0070679_100588997 3300005530 Bacteria 1056
77 Ga0070697_101691354 3300005536 Bacteria 566
78 Ga0070672_100118040 3300005543 Bacteria 2169
79 Ga0070686_100010424 3300005544 Bacteria 5240
80 Ga0070695_100013607 3300005545 Bacteria 4890
81 Ga0070695_100121198 3300005545 Bacteria 1789
82 Ga0070695_100588252 3300005545 Bacteria 872
83 Ga0070695_101432345 3300005545 Bacteria 574
84 Ga0070696_100000285 3300005546 Bacteria 30505
85 Ga0070696_100013775 3300005546 Bacteria 5429
86 Ga0070696_100029783 3300005546 Unclassified 3734
87 Ga0070696_100215880 3300005546 Unclassified 1437
88 Ga0070696_101427398 3300005546 Unclassified 591
89 Ga0070665_101820805 3300005548 Bacteria 615
90 Ga0070704_100012341 3300005549 Bacteria 5275
91 Ga0070704_100060528 3300005549 Bacteria 2706
92 Ga0070704_100112717 3300005549 Bacteria 2073
93 Ga0070704_100326828 3300005549 Unclassified 1287
94 Ga0070704_100476590 3300005549 Bacteria 1079
95 Ga0070704_100960924 3300005549 Bacteria 771
96 Ga0070664_100003680 3300005564 Bacteria 12357
97 Ga0068854_100392892 3300005578 Bacteria 1146
98 Ga0068854_100712946 3300005578 Bacteria 867
99 Ga0070702_100145387 3300005615 Bacteria 1515
100 Ga0068852_100602088 3300005616 Bacteria 1103
101 Ga0068859_100032135 3300005617 Bacteria 5272
102 Ga0068859_100294705 3300005617 Unclassified 1715
103 Ga0068864_100061246 3300005618 Bacteria 3259
104 Ga0068864_102489559 3300005618 Bacteria 524
105 Ga0068861_100108863 3300005719 Bacteria 2217
106 Ga0068861_100511457 3300005719 Bacteria 1087
107 Ga0068870_10030172 3300005840 Unclassified 2739
108 Ga0068870_10095452 3300005840 Bacteria 1670
109 Ga0068870_11154479 3300005840 Unclassified 559
110 Ga0068863_100022807 3300005841 Bacteria 5980
111 Ga0068860_100179501 3300005843 Bacteria 2046
112 Ga0068862_100003259 3300005844 Bacteria 14040
113 Ga0068862_100573753 3300005844 Bacteria 1080
114 Ga0075432_10084988 3300006058 Bacteria 1152
115 Ga0075362_10690392 3300006177 Unclassified 532
116 Ga0097621_100930706 3300006237 Unclassified 811
117 Ga0068871_100164275 3300006358 Bacteria 1900
118 Ga0075428_100001700 3300006844 Bacteria 23477
119 Ga0075428_100004765 3300006844 Bacteria 15018
120 Ga0075428_100008711 3300006844 Bacteria 11253
121 Ga0075428_100169793 3300006844 Unclassified 2365
122 Ga0075428_100191272 3300006844 Unclassified 2213
123 Ga0075428_100655869 3300006844 Bacteria 1119
124 Ga0075428_101813619 3300006844 Bacteria 635
125 Ga0075428_101912123 3300006844 Unclassified 616
126 Ga0075430_100001904 3300006846 Bacteria 17110
127 Ga0075430_100005736 3300006846 Bacteria 10472
128 Ga0075430_100033868 3300006846 Bacteria 4335
129 Ga0075430_100275314 3300006846 Bacteria 1393
130 Ga0075430_101645751 3300006846 Unclassified 527
131 Ga0075431_100001226 3300006847 Bacteria 23249
132 Ga0075431_100033284 3300006847 Bacteria 5312
133 Ga0075431_100042488 3300006847 Bacteria 4689
134 Ga0075431_100130093 3300006847 Bacteria 2597
135 Ga0075433_10001598 3300006852 Bacteria 16786
136 Ga0075433_10005044 3300006852 Bacteria 10347
137 Ga0075433_10104756 3300006852 Unclassified 2506
138 Ga0075433_10194469 3300006852 Unclassified 1804
139 Ga0075433_10464375 3300006852 Bacteria 1115
140 Ga0075433_10464850 3300006852 Bacteria 1115
141 Ga0075433_10580187 3300006852 Bacteria 985
142 Ga0075433_10831981 3300006852 Bacteria 806
143 Ga0075433_11451705 3300006852 Unclassified 593
144 Ga0075434_100000681 3300006871 Bacteria 26437
145 Ga0075434_100001979 3300006871 Bacteria 17778
146 Ga0075434_100006072 3300006871 Bacteria 11050
147 Ga0075434_100013343 3300006871 Bacteria 7816
148 Ga0075434_100226649 3300006871 Bacteria 1888
149 Ga0075434_100836477 3300006871 Unclassified 936
150 Ga0075429_100003295 3300006880 Bacteria 13744
151 Ga0075429_100046664 3300006880 Bacteria 3769
152 Ga0075429_100146370 3300006880 Bacteria 2067
153 Ga0075429_100253499 3300006880 Bacteria 1541
154 Ga0075429_100426792 3300006880 Bacteria 1161
155 Ga0075429_100446046 3300006880 Bacteria 1134
156 Ga0075429_101312441 3300006880 Unclassified 631
157 Ga0075429_101669026 3300006880 Unclassified 554
158 Ga0068865_100296977 3300006881 Bacteria 1291
159 Ga0097620_100032135 3300006931 Bacteria 5272
160 Ga0097620_100294706 3300006931 Unclassified 1715
161 Ga0075435_100001134 3300007076 Bacteria 16971
162 Ga0075435_100097289 3300007076 Unclassified 2435
163 Ga0075435_100194139 3300007076 Unclassified 1719
164 Ga0075435_100271317 3300007076 Bacteria 1447
165 Ga0075435_100308706 3300007076 Unclassified 1353
166 Ga0075435_100530428 3300007076 Bacteria 1019
167 Ga0105240_12589040 3300009093 Unclassified 524
168 Ga0111539_10004096 3300009094 Bacteria 19126
169 Ga0111539_10005319 3300009094 Bacteria 16658
170 Ga0111539_10010135 3300009094 Bacteria 11876
171 Ga0111539_10054181 3300009094 Bacteria 4773
172 Ga0111539_10055049 3300009094 Bacteria 4730
173 Ga0111539_10133441 3300009094 Bacteria 2907
174 Ga0111539_10228282 3300009094 Unclassified 2168
175 Ga0111539_10248973 3300009094 Bacteria 2069
176 Ga0111539_10354175 3300009094 Bacteria 1708
177 Ga0111539_11317169 3300009094 Bacteria 838
178 Ga0111539_11437154 3300009094 Unclassified 800
179 Ga0105245_11107380 3300009098 Bacteria 838
180 Ga0114129_10005538 3300009147 Bacteria 17860
181 Ga0114129_10008652 3300009147 Bacteria 14513
182 Ga0114129_10020765 3300009147 Bacteria 9333
183 Ga0114129_10091040 3300009147 Bacteria 4227
184 Ga0114129_10179946 3300009147 Unclassified 2878
185 Ga0114129_10208714 3300009147 Bacteria 2642
186 Ga0114129_10368719 3300009147 Bacteria 1898
187 Ga0114129_10378426 3300009147 Unclassified 1870
188 Ga0114129_10780388 3300009147 Bacteria 1221
189 Ga0114129_11984344 3300009147 Unclassified 704
190 Ga0114129_12166301 3300009147 Bacteria 669
191 Ga0105243_10011587 3300009148 Bacteria 6671
192 Ga0105243_10163896 3300009148 Bacteria 1919
193 Ga0105243_12409696 3300009148 Unclassified 565
194 Ga0105242_10054636 3300009176 Unclassified 3265
195 Ga0105242_11444131 3300009176 Unclassified 717
196 Ga0105248_11326834 3300009177 Bacteria 814
197 Ga0105249_10034379 3300009553 Bacteria 4594
198 Ga0105239_11926545 3300010375 Unclassified 686
199 Ga0105246_11068322 3300011119 Unclassified 735
200 Ga0157327_1082386 3300012512 Unclassified 520
201 Ga0157371_10956279 3300013102 Unclassified 652
202 Ga0157378_10039349 3300013297 Bacteria 4194
203 Ga0163162_10383363 3300013306 Bacteria 1539
204 Ga0157375_10301355 3300013308 Bacteria 1766
205 Ga0157375_12626667 3300013308 Unclassified 602
206 Ga0163163_10980717 3300014325 Unclassified 908
207 Ga0163163_11818173 3300014325 Unclassified 669
208 Ga0157380_10029309 3300014326 Bacteria 4206
209 Ga0157380_10071145 3300014326 Unclassified 2814
210 Ga0157380_10087389 3300014326 Bacteria 2563
211 Ga0157380_10106165 3300014326 Bacteria 2350
212 Ga0157380_10269534 3300014326 Bacteria 1551
213 Ga0157380_10858139 3300014326 Unclassified 930
214 Ga0157380_10986656 3300014326 Bacteria 875
215 Ga0157380_11488721 3300014326 Bacteria 730
216 Ga0157377_10044922 3300014745 Bacteria 2465
217 Ga0157377_10273302 3300014745 Bacteria 1104
218 Ga0157379_10056825 3300014968 Bacteria 3497
219 Ga0157376_10796557 3300014969 Bacteria 957
220 Ga0207697_10010612 3300025315 Bacteria 3931
221 Ga0207682_10027811 3300025893 Bacteria 2253
222 Ga0207682_10486636 3300025893 Bacteria 584
223 Ga0207688_10011703 3300025901 Bacteria 4772
224 Ga0207688_10265442 3300025901 Bacteria 1043
225 Ga0207680_11247895 3300025903 Bacteria 529
226 Ga0207645_10041388 3300025907 Bacteria 2949
227 Ga0207643_10001140 3300025908 Bacteria 15778
228 Ga0207643_10045077 3300025908 Bacteria 2490
229 Ga0207684_10276450 3300025910 Unclassified 1449
230 Ga0207660_10164747 3300025917 Unclassified 1713
231 Ga0207660_10470032 3300025917 Bacteria 1018
232 Ga0207662_10093262 3300025918 Bacteria 1855
233 Ga0207657_10534838 3300025919 Bacteria 917
234 Ga0207649_10077966 3300025920 Bacteria 2137
235 Ga0207646_10054042 3300025922 Unclassified 3593
236 Ga0207646_10096188 3300025922 Bacteria 2653
237 Ga0207646_10154930 3300025922 Unclassified 2067
238 Ga0207681_10479263 3300025923 Bacteria 1016
239 Ga0207681_11710803 3300025923 Unclassified 525
240 Ga0207659_10013807 3300025926 Bacteria 5190
241 Ga0207659_10415544 3300025926 Unclassified 1127
242 Ga0207659_11894575 3300025926 Unclassified 505
243 Ga0207690_10428851 3300025932 Bacteria 1059
244 Ga0207706_10207333 3300025933 Bacteria 1718
245 Ga0207706_10336646 3300025933 Bacteria 1313
246 Ga0207709_10081641 3300025935 Unclassified 2085
247 Ga0207670_10054890 3300025936 Bacteria 2690
248 Ga0207670_10112738 3300025936 Bacteria 1963
249 Ga0207670_10379711 3300025936 Bacteria 1125
250 Ga0207669_10050649 3300025937 Bacteria 2484
251 Ga0207669_11367623 3300025937 Unclassified 602
252 Ga0207704_10403516 3300025938 Unclassified 1079
253 Ga0207691_10022894 3300025940 Bacteria 5889
254 Ga0207691_10122872 3300025940 Bacteria 2299
255 Ga0207689_10134089 3300025942 Bacteria 2039
256 Ga0207689_10482294 3300025942 Unclassified 1038
257 Ga0207679_10002776 3300025945 Bacteria 10846
258 Ga0207651_10370432 3300025960 Unclassified 1211
259 Ga0207712_10080700 3300025961 Bacteria 2367
260 Ga0207712_10969540 3300025961 Bacteria 753
261 Ga0207668_10151854 3300025972 Bacteria 1794
262 Ga0207640_10528146 3300025981 Bacteria 987
263 Ga0207640_11223759 3300025981 Bacteria 668
264 Ga0207640_12166026 3300025981 Unclassified 504
265 Ga0207658_10380373 3300025986 Bacteria 1236
266 Ga0207677_10997192 3300026023 Unclassified 759
267 Ga0207703_11937484 3300026035 Bacteria 565
268 Ga0207703_12194196 3300026035 Unclassified 528
269 Ga0207703_12264415 3300026035 Unclassified 519
270 Ga0207708_10015981 3300026075 Bacteria 5637
271 Ga0207708_10052382 3300026075 Bacteria 3109
272 Ga0207708_10168386 3300026075 Bacteria 1733
273 Ga0207708_10180968 3300026075 Bacteria 1674
274 Ga0207641_10558946 3300026088 Bacteria 1116
275 Ga0207648_10053548 3300026089 Bacteria 3527
276 Ga0207648_10775602 3300026089 Bacteria 891
277 Ga0207676_10753130 3300026095 Bacteria 947
278 Ga0207676_11137572 3300026095 Bacteria 772
279 Ga0207674_10553386 3300026116 Bacteria 1111
280 Ga0207675_100126296 3300026118 Bacteria 2423
281 Ga0207675_100275122 3300026118 Bacteria 1635
282 Ga0207675_102199990 3300026118 Bacteria 567
283 Ga0207683_10049194 3300026121 Unclassified 3690
284 Ga0207683_10129014 3300026121 Bacteria 2274
285 Ga0207683_11396463 3300026121 Bacteria 647
286 Ga0209996_1030632 3300027395 Bacteria 781
287 Ga0209999_1070868 3300027543 Unclassified 668
288 Ga0209970_1052305 3300027614 Bacteria 740
289 Ga0209971_1041944 3300027682 Bacteria 1101
290 Ga0209974_10132690 3300027876 Bacteria 889
291 Ga0207428_10001959 3300027907 Bacteria 20897
292 Ga0207428_10003767 3300027907 Bacteria 14558
293 Ga0207428_10035966 3300027907 Bacteria 4043
294 Ga0207428_10084458 3300027907 Bacteria 2474
295 Ga0207428_10433794 3300027907 Bacteria 959
296 Ga0207428_10703411 3300027907 Bacteria 723
297 Ga0268265_10037068 3300028380 Bacteria 3575
298 Ga0268264_10993850 3300028381 Bacteria 845
299 Ga0268264_11138269 3300028381 Bacteria 789
300 Ga0307408_100192968 3300031548 Bacteria 1642
301 Ga0307408_100487288 3300031548 Bacteria 1077
302 Ga0307408_102073071 3300031548 Unclassified 548
303 Ga0307405_10009701 3300031731 Bacteria 4949
304 Ga0307405_11179708 3300031731 Bacteria 661
305 Ga0307413_11128255 3300031824 Bacteria 678
306 Ga0307413_11985007 3300031824 Unclassified 524
307 Ga0307410_10037319 3300031852 Bacteria 3173
308 Ga0307410_10115386 3300031852 Bacteria 1950
309 Ga0307410_10218874 3300031852 Bacteria 1464
310 Ga0307410_10853584 3300031852 Bacteria 777
311 Ga0307406_10224831 3300031901 Bacteria 1397
312 Ga0307407_10000678 3300031903 Bacteria 10991
313 Ga0307407_10307011 3300031903 Bacteria 1108
314 Ga0307412_10883864 3300031911 Unclassified 782
315 Ga0307412_11387975 3300031911 Bacteria 635
316 Ga0307412_11412233 3300031911 Bacteria 630
317 Ga0307409_100007314 3300031995 Bacteria 6595
318 Ga0307409_100300678 3300031995 Bacteria 1492
319 Ga0307409_100317723 3300031995 Bacteria 1456
320 Ga0307409_100486299 3300031995 Unclassified 1199
321 Ga0307409_100733692 3300031995 Unclassified 990
322 Ga0307416_100021990 3300032002 Bacteria 4592
323 Ga0307416_100252385 3300032002 Bacteria 1718
324 Ga0307416_101715563 3300032002 Bacteria 733
325 Ga0307414_10323724 3300032004 Bacteria 1313
326 Ga0307414_11016334 3300032004 Bacteria 763
327 Ga0307414_11481660 3300032004 Unclassified 631
328 Ga0307411_10015731 3300032005 Unclassified 4260
329 Ga0307411_10043662 3300032005 Bacteria 2869
330 Ga0307411_12074786 3300032005 Bacteria 532
331 Ga0307415_102274411 3300032126 Bacteria 531
332 Ga0373929_0041770 3300035085 Bacteria 1021
333 Ga0373932_0143494 3300035112 Bacteria 814
334 Ga0242420_029202 3300038996 Bacteria 1017
335 Ga0439431_0137411 3300041997 Unclassified 689
336 Ga0439443_039456 3300042003 Bacteria 803
337 Ga0439449_0314291 3300042007 Bacteria 592
338 Ga0439450_009038 3300042008 Bacteria 1879
339 Ga0450920_036870 3300042122 Bacteria 971
340 Ga0450922_018764 3300042124 Unclassified 704
341 Ga0450923_186887 3300042125 Viruses 512
342 Ga0450896_027100 3300042133 Bacteria 856
343 Ga0439434_0207411 3300042435 Unclassified 662
344 Ga0439435_0026529 3300042436 Bacteria 1543
345 Ga0439444_0117353 3300042437 Bacteria 618
346 Ga0439464_0311167 3300042439 Unclassified 516
347 Ga0439460_0131325 3300042461 Unclassified 826
348 Ga0439460_0137873 3300042461 Unclassified 807
349 Ga0450916_077950 3300042530 Bacteria 562
350 Ga0439440_0139251 3300042993 Bacteria 688
351 Ga0451576_0006553 3300045051 Bacteria 14246
352 Ga0451576_0721106 3300045051 Bacteria 1047
353 Ga0451576_0946181 3300045051 Bacteria 903
354 Ga0451576_2035924 3300045051 Unclassified 591
355 Ga0495603_0022999 3300046455 Bacteria 3773
356 Ga0495629_0007689 3300046459 Bacteria 7929
357 Ga0495580_0850983 3300046472 Bacteria 589
358 Ga0495584_0028817 3300046491 Bacteria 2815
359 Ga0495594_0041898 3300046499 Bacteria 2507
360 Ga0495663_0137731 3300046525 Unclassified 827
361 Ga0495642_0324944 3300046528 Bacteria 675
362 Ga0495609_0114948 3300046538 Bacteria 1160
363 Ga0495621_0001896 3300046539 Bacteria 5497
364 Ga0495621_0043727 3300046539 Unclassified 1581
365 Ga0495622_0499750 3300046557 Bacteria 520
366 Ga0495659_0008206 3300046664 Bacteria 3321
367 Ga0495659_0014998 3300046664 Unclassified 2543
368 Ga0495670_0038574 3300046691 Unclassified 2382
369 Ga0495581_0203308 3300047315 Bacteria 1159
370 Ga0495636_0052703 3300047318 Unclassified 1707
371 Ga0495676_0070039 3300047321 Bacteria 2704
372 Ga0495685_062742 3300047447 Unclassified 1251
373 Ga0496104_1248907 3300048907 Unclassified 646
374 Ga0496108_0343108 3300048911 Bacteria 1303
375 Ga0496108_0589468 3300048911 Bacteria 969
376 Ga0496109_0104916 3300048912 Bacteria 2624
377 Ga0496109_0221107 3300048912 Bacteria 1781
378 Ga0496110_1353300 3300048913 Bacteria 621
379 Ga0496113_0029646 3300048916 Bacteria 3955
380 Ga0501031_1123648 3300049568 Unclassified 501
381 Ga0501032_1077459 3300049569 Bacteria 504
382 Ga0501033_1088453 3300049570 Unclassified 532
383 Ga0501036_1061995 3300049572 Unclassified 662
384 Ga0501039_0551244 3300049575 Bacteria 905
385 Ga0501039_0889760 3300049575 Unclassified 693
386 Ga0501039_1592873 3300049575 Bacteria 501
387 Ga0501040_0899630 3300049576 Bacteria 641
388 Ga0501041_0548056 3300049577 Unclassified 737
389 Ga0501042_1258655 3300049578 Unclassified 539
390 Ga0501048_0480298 3300049582 Bacteria 891
391 Ga0501071_0315378 3300049587 Bacteria 1187
392 Ga0501071_1572296 3300049587 Bacteria 508
393 Ga0501072_0207873 3300049588 Bacteria 1560
394 Ga0501073_0505341 3300049589 Bacteria 836
395 Ga0501074_0462172 3300049590 Unclassified 899
396 Ga0501075_0106851 3300049591 Viruses 2127
397 Ga0501075_1192174 3300049591 Unclassified 578
398 Ga0501076_0103325 3300049592 Unclassified 2299
399 Ga0501076_0444847 3300049592 Unclassified 1067
400 Ga0501202_111243 3300049652 Bacteria 678
401 Ga0501233_085108 3300049668 Bacteria 819
402 Ga0501257_034943 3300049686 Bacteria 1221
403 Ga0501260_054769 3300049689 Unclassified 509
404 Ga0501261_055803 3300049690 Bacteria 659
405 Ga0501079_1148783 3300049741 Bacteria 612
406 Ga0501081_0055939 3300049743 Viruses 2726
407 Ga0501081_0146671 3300049743 Bacteria 1694
408 Ga0501263_009570 3300049760 Bacteria 1176
409 Ga0501273_048510 3300049770 Bacteria 644
410 Ga0501283_065241 3300049779 Bacteria 663
411 Ga0501045_0407190 3300049824 Unclassified 1012
412 nmdc:mga05p37_111225_c1 3300050507 Bacteria 3369
413 nmdc:mga05p37_12839_c1 3300050507 Bacteria 10016
414 nmdc:mga05p37_148554_c2 3300050507 Bacteria 2534
415 nmdc:mga05p37_159386_c1 3300050507 Bacteria 2756
416 nmdc:mga05p37_1904282_c1 3300050507 Unclassified 568
417 nmdc:mga05p37_196960_c1 3300050507 Unclassified 2442
418 nmdc:mga05p37_277741_c1 3300050507 Bacteria 1999
419 nmdc:mga05p37_349597_c1 3300050507 Bacteria 1741
420 nmdc:mga05p37_37661_c1 3300050507 Bacteria 5931
421 nmdc:mga05p37_419601_c1 3300050507 Bacteria 1557
422 nmdc:mga05p37_7718_c2 3300050507 Bacteria 7178
423 nmdc:mga09592_1077163_c1 3300050508 Unclassified 669
424 nmdc:mga09592_110368_c1 3300050508 Bacteria 2360
425 nmdc:mga09592_1254608_c1 3300050508 Unclassified 611
426 nmdc:mga09592_1365_c1 3300050508 Bacteria 19537
427 nmdc:mga09592_1401818_c1 3300050508 Bacteria 571
428 nmdc:mga09592_272825_c1 3300050508 Bacteria 1467
429 nmdc:mga09592_39236_c1 3300050508 Bacteria 3977
430 nmdc:mga09592_42597_c1 3300050508 Bacteria 3819
431 nmdc:mga09592_472449_c1 3300050508 Bacteria 1081
432 nmdc:mga09592_796466_c1 3300050508 Unclassified 800
433 nmdc:mga09592_82800_c1 3300050508 Unclassified 2734
434 nmdc:mga0qj67_13721_c1 3300050509 Bacteria 6115
435 nmdc:mga0qj67_17818_c1 3300050509 Bacteria 5403
436 nmdc:mga0qj67_27262_c1 3300050509 Bacteria 4426
437 nmdc:mga06r32_1056210_c1 3300050510 Bacteria 763
438 nmdc:mga06r32_124222_c1 3300050510 Bacteria 2548
439 nmdc:mga06r32_13456_c1 3300050510 Bacteria 7411
440 nmdc:mga06r32_1619_c1 3300050510 Bacteria 20313
441 nmdc:mga06r32_244728_c1 3300050510 Bacteria 1781
442 nmdc:mga08y16_107324_c1 3300050511 Unclassified 2907
443 nmdc:mga08y16_1155882_c1 3300050511 Bacteria 747
444 nmdc:mga08y16_250217_c1 3300050511 Bacteria 1831
445 nmdc:mga08y16_314251_c1 3300050511 Unclassified 1613
446 nmdc:mga08y16_332332_c1 3300050511 Bacteria 1563
447 nmdc:mga08y16_3874_c1 3300050511 Bacteria 15565
448 nmdc:mga08y16_600_c1 3300050511 Bacteria 33622
449 nmdc:mga08y16_672382_c1 3300050511 Bacteria 1038
450 nmdc:mga0n895_1066114_c1 3300050512 Bacteria 787
451 nmdc:mga0n895_1364_c1 3300050512 Bacteria 18165
452 nmdc:mga0n895_208150_c1 3300050512 Bacteria 1987
453 nmdc:mga0n895_28194_c1 3300050512 Bacteria 5341
454 nmdc:mga0n895_313334_c1 3300050512 Bacteria 1590
455 nmdc:mga0n895_41036_c1 3300050512 Unclassified 4498
456 nmdc:mga0n895_6000_c1 3300050512 Bacteria 10234
457 nmdc:mga0n895_615847_c1 3300050512 Bacteria 1087
458 nmdc:mga0rr50_16367_c1 3300050513 Bacteria 4924
459 nmdc:mga0rr50_18695_c1 3300050513 Unclassified 4661
460 nmdc:mga0rr50_438518_c1 3300050513 Bacteria 1106
461 nmdc:mga0rr50_63536_c1 3300050513 Bacteria 2788
462 nmdc:mga0rr50_89346_c1 3300050513 Unclassified 2395
463 nmdc:mga0a205_110566_c1 3300050515 Bacteria 2647
464 nmdc:mga0a205_1166707_c1 3300050515 Unclassified 618
465 nmdc:mga0a205_123651_c1 3300050515 Unclassified 2487
466 nmdc:mga0a205_166_c1 3300050515 Bacteria 44087
467 nmdc:mga0a205_249542_c1 3300050515 Unclassified 1655
468 nmdc:mga0a205_6109_c1 3300050515 Bacteria 10863
469 nmdc:mga0a205_804542_c1 3300050515 Bacteria 788
470 nmdc:mga0a205_8809_c1 3300050515 Bacteria 9191
471 Ga0501084_0335427 3300054114 Unclassified 1277
472 Ga0590071_000190 3300059421 Bacteria 17901
473 Ga0590074_001212 3300059423 Bacteria 4081
474 Ga0590075_000310 3300059424 Bacteria 13561
475 Ga0590075_006730 3300059424 Unclassified 2723
476 Ga0590077_000268 3300059426 Bacteria 14815
477 Ga0590077_008577 3300059426 Unclassified 2093
478 Ga0501082_0155528 3300060353 Bacteria 1987
479 Ga0501082_0635697 3300060353 Unclassified 934
480 Ga0530510_0606189 3300061734 Unclassified 833
481 Ga0530510_0834987 3300061734 Bacteria 703
482 Ga0114129_11466229
483 Ga0065712_10067780
484 Ga0065712_10229394
485 Ga0065715_10221750
486 Ga0065715_10256919
487 Ga0065715_10652198
488 Ga0065707_10395110
489 Ga0065707_10415650
490 Ga0065707_10598323
491 Ga0070676_10003147
492 Ga0070677_10003931
493 Ga0070677_10361228
494 Ga0068869_100018367
495 Ga0070666_10065357
496 Ga0070680_100296401
497 Ga0070680_100545302
498 Ga0068868_100099109
499 Ga0070660_100866517
500 Ga0070689_100069231
501 Ga0070689_100076747
502 Ga0070691_10365162
503 Ga0070687_100079537
504 Ga0070687_100610428
505 Ga0070661_100301285
506 Ga0070692_10158222
507 Ga0070668_100651391
508 Ga0070669_100007402
509 Ga0070669_100684037
510 Ga0070675_100029940
511 Ga0070675_100077072
512 Ga0070675_100077097
513 Ga0070675_101925884
514 Ga0070671_100744323
515 Ga0070674_100071641
516 Ga0070674_101496129
517 Ga0070673_100007315
518 Ga0070688_100314134
519 Ga0070659_100168499
520 Ga0070667_100055183
521 Ga0070703_10379078
522 Ga0070701_10005870
523 Ga0070701_10019264
524 Ga0070705_100000360
525 Ga0070705_101184716
526 Ga0070700_100020810
527 Ga0070700_100097799
528 Ga0070700_100099623
529 Ga0070700_100106185
530 Ga0070700_100731396
531 Ga0070694_100000764
532 Ga0070694_100002502
533 Ga0070694_100223128
534 Ga0070694_100255608
535 Ga0070694_100464910
536 Ga0070694_100572287
537 Ga0070708_100196588
538 Ga0070708_100358648
539 Ga0070708_100915444
540 Ga0070678_100472511
541 Ga0070678_100761055
542 Ga0070678_101804185
543 Ga0070662_100101860
544 Ga0068867_100193385
545 Ga0070685_10029097
546 Ga0070706_100808475
547 Ga0070707_100033423
548 Ga0070707_100074747
549 Ga0070698_100013909
550 Ga0070698_100050664
551 Ga0070698_100062138
552 Ga0070698_100366315
553 Ga0070698_101149862
554 Ga0070699_100009087
555 Ga0070699_100013747
556 Ga0070699_100041658
557 Ga0070679_100588997
558 Ga0070697_101691354
559 Ga0070672_100118040
560 Ga0070686_100010424
561 Ga0070695_100013607
562 Ga0070695_100121198
563 Ga0070695_100588252
564 Ga0070695_101432345
565 Ga0070696_100000285
566 Ga0070696_100013775
567 Ga0070696_100029783
568 Ga0070696_100215880
569 Ga0070696_101427398
570 Ga0070665_101820805
571 Ga0070704_100012341
572 Ga0070704_100060528
573 Ga0070704_100112717
574 Ga0070704_100326828
575 Ga0070704_100476590
576 Ga0070704_100960924
577 Ga0070664_100003680
578 Ga0068854_100392892
579 Ga0068854_100712946
580 Ga0070702_100145387
581 Ga0068852_100602088
582 Ga0068859_100032135
583 Ga0068859_100294705
584 Ga0068864_100061246
585 Ga0068864_102489559
586 Ga0068861_100108863
587 Ga0068861_100511457
588 Ga0068870_10030172
589 Ga0068870_10095452
590 Ga0068870_11154479
591 Ga0068863_100022807
592 Ga0068860_100179501
593 Ga0068862_100003259
594 Ga0068862_100573753
595 Ga0075432_10084988
596 Ga0075362_10690392
597 Ga0097621_100930706
598 Ga0068871_100164275
599 Ga0075428_100001700
600 Ga0075428_100004765
601 Ga0075428_100008711
602 Ga0075428_100169793
603 Ga0075428_100191272
604 Ga0075428_100655869
605 Ga0075428_101813619
606 Ga0075428_101912123
607 Ga0075430_100001904
608 Ga0075430_100005736
609 Ga0075430_100033868
610 Ga0075430_100275314
611 Ga0075430_101645751
612 Ga0075431_100001226
613 Ga0075431_100033284
614 Ga0075431_100042488
615 Ga0075431_100130093
616 Ga0075433_10001598
617 Ga0075433_10005044
618 Ga0075433_10104756
619 Ga0075433_10194469
620 Ga0075433_10464375
621 Ga0075433_10464850
622 Ga0075433_10580187
623 Ga0075433_10831981
624 Ga0075433_11451705
625 Ga0075434_100000681
626 Ga0075434_100001979
627 Ga0075434_100006072
628 Ga0075434_100013343
629 Ga0075434_100226649
630 Ga0075434_100836477
631 Ga0075429_100003295
632 Ga0075429_100046664
633 Ga0075429_100146370
634 Ga0075429_100253499
635 Ga0075429_100426792
636 Ga0075429_100446046
637 Ga0075429_101312441
638 Ga0075429_101669026
639 Ga0068865_100296977
640 Ga0097620_100032135
641 Ga0097620_100294706
642 Ga0075435_100001134
643 Ga0075435_100097289
644 Ga0075435_100194139
645 Ga0075435_100271317
646 Ga0075435_100308706
647 Ga0075435_100530428
648 Ga0105240_12589040
649 Ga0111539_10004096
650 Ga0111539_10005319
651 Ga0111539_10010135
652 Ga0111539_10054181
653 Ga0111539_10055049
654 Ga0111539_10133441
655 Ga0111539_10228282
656 Ga0111539_10248973
657 Ga0111539_10354175
658 Ga0111539_11317169
659 Ga0111539_11437154
660 Ga0105245_11107380
661 Ga0114129_10005538
662 Ga0114129_10008652
663 Ga0114129_10020765
664 Ga0114129_10091040
665 Ga0114129_10179946
666 Ga0114129_10208714
667 Ga0114129_10368719
668 Ga0114129_10378426
669 Ga0114129_10780388
670 Ga0114129_11984344
671 Ga0114129_12166301
672 Ga0105243_10011587
673 Ga0105243_10163896
674 Ga0105243_12409696
675 Ga0105242_10054636
676 Ga0105242_11444131
677 Ga0105248_11326834
678 Ga0105249_10034379
679 Ga0105239_11926545
680 Ga0105246_11068322
681 Ga0157327_1082386
682 Ga0157371_10956279
683 Ga0157378_10039349
684 Ga0163162_10383363
685 Ga0157375_10301355
686 Ga0157375_12626667
687 Ga0163163_10980717
688 Ga0163163_11818173
689 Ga0157380_10029309
690 Ga0157380_10071145
691 Ga0157380_10087389
692 Ga0157380_10106165
693 Ga0157380_10269534
694 Ga0157380_10858139
695 Ga0157380_10986656
696 Ga0157380_11488721
697 Ga0157377_10044922
698 Ga0157377_10273302
699 Ga0157379_10056825
700 Ga0157376_10796557
701 Ga0207697_10010612
702 Ga0207682_10027811
703 Ga0207682_10486636
704 Ga0207688_10011703
705 Ga0207688_10265442
706 Ga0207680_11247895
707 Ga0207645_10041388
708 Ga0207643_10001140
709 Ga0207643_10045077
710 Ga0207684_10276450
711 Ga0207660_10164747
712 Ga0207660_10470032
713 Ga0207662_10093262
714 Ga0207657_10534838
715 Ga0207649_10077966
716 Ga0207646_10054042
717 Ga0207646_10096188
718 Ga0207646_10154930
719 Ga0207681_10479263
720 Ga0207681_11710803
721 Ga0207659_10013807
722 Ga0207659_10415544
723 Ga0207659_11894575
724 Ga0207690_10428851
725 Ga0207706_10207333
726 Ga0207706_10336646
727 Ga0207709_10081641
728 Ga0207670_10054890
729 Ga0207670_10112738
730 Ga0207670_10379711
731 Ga0207669_10050649
732 Ga0207669_11367623
733 Ga0207704_10403516
734 Ga0207691_10022894
735 Ga0207691_10122872
736 Ga0207689_10134089
737 Ga0207689_10482294
738 Ga0207679_10002776
739 Ga0207651_10370432
740 Ga0207712_10080700
741 Ga0207712_10969540
742 Ga0207668_10151854
743 Ga0207640_10528146
744 Ga0207640_11223759
745 Ga0207640_12166026
746 Ga0207658_10380373
747 Ga0207677_10997192
748 Ga0207703_11937484
749 Ga0207703_12194196
750 Ga0207703_12264415
751 Ga0207708_10015981
752 Ga0207708_10052382
753 Ga0207708_10168386
754 Ga0207708_10180968
755 Ga0207641_10558946
756 Ga0207648_10053548
757 Ga0207648_10775602
758 Ga0207676_10753130
759 Ga0207676_11137572
760 Ga0207674_10553386
761 Ga0207675_100126296
762 Ga0207675_100275122
763 Ga0207675_102199990
764 Ga0207683_10049194
765 Ga0207683_10129014
766 Ga0207683_11396463
767 Ga0209996_1030632
768 Ga0209999_1070868
769 Ga0209970_1052305
770 Ga0209971_1041944
771 Ga0209974_10132690
772 Ga0207428_10001959
773 Ga0207428_10003767
774 Ga0207428_10035966
775 Ga0207428_10084458
776 Ga0207428_10433794
777 Ga0207428_10703411
778 Ga0268265_10037068
779 Ga0268264_10993850
780 Ga0268264_11138269
781 Ga0307408_100192968
782 Ga0307408_100487288
783 Ga0307408_102073071
784 Ga0307405_10009701
785 Ga0307405_11179708
786 Ga0307413_11128255
787 Ga0307413_11985007
788 Ga0307410_10037319
789 Ga0307410_10115386
790 Ga0307410_10218874
791 Ga0307410_10853584
792 Ga0307406_10224831
793 Ga0307407_10000678
794 Ga0307407_10307011
795 Ga0307412_10883864
796 Ga0307412_11387975
797 Ga0307412_11412233
798 Ga0307409_100007314
799 Ga0307409_100300678
800 Ga0307409_100317723
801 Ga0307409_100486299
802 Ga0307409_100733692
803 Ga0307416_100021990
804 Ga0307416_100252385
805 Ga0307416_101715563
806 Ga0307414_10323724
807 Ga0307414_11016334
808 Ga0307414_11481660
809 Ga0307411_10015731
810 Ga0307411_10043662
811 Ga0307411_12074786
812 Ga0307415_102274411
813 Ga0373929_0041770
814 Ga0373932_0143494
815 Ga0242420_029202
816 Ga0439431_0137411
817 Ga0439443_039456
818 Ga0439449_0314291
819 Ga0439450_009038
820 Ga0450920_036870
821 Ga0450922_018764
822 Ga0450923_186887
823 Ga0450896_027100
824 Ga0439434_0207411
825 Ga0439435_0026529
826 Ga0439444_0117353
827 Ga0439464_0311167
828 Ga0439460_0131325
829 Ga0439460_0137873
830 Ga0450916_077950
831 Ga0439440_0139251
832 Ga0451576_0006553
833 Ga0451576_0721106
834 Ga0451576_0946181
835 Ga0451576_2035924
836 Ga0495603_0022999
837 Ga0495629_0007689
838 Ga0495580_0850983
839 Ga0495584_0028817
840 Ga0495594_0041898
841 Ga0495663_0137731
842 Ga0495642_0324944
843 Ga0495609_0114948
844 Ga0495621_0001896
845 Ga0495621_0043727
846 Ga0495622_0499750
847 Ga0495659_0008206
848 Ga0495659_0014998
849 Ga0495670_0038574
850 Ga0495581_0203308
851 Ga0495636_0052703
852 Ga0495676_0070039
853 Ga0495685_062742
854 Ga0496104_1248907
855 Ga0496108_0343108
856 Ga0496108_0589468
857 Ga0496109_0104916
858 Ga0496109_0221107
859 Ga0496110_1353300
860 Ga0496113_0029646
861 Ga0501031_1123648
862 Ga0501032_1077459
863 Ga0501033_1088453
864 Ga0501036_1061995
865 Ga0501039_0551244
866 Ga0501039_0889760
867 Ga0501039_1592873
868 Ga0501040_0899630
869 Ga0501041_0548056
870 Ga0501042_1258655
871 Ga0501048_0480298
872 Ga0501071_0315378
873 Ga0501071_1572296
874 Ga0501072_0207873
875 Ga0501073_0505341
876 Ga0501074_0462172
877 Ga0501075_0106851
878 Ga0501075_1192174
879 Ga0501076_0103325
880 Ga0501076_0444847
881 Ga0501202_111243
882 Ga0501233_085108
883 Ga0501257_034943
884 Ga0501260_054769
885 Ga0501261_055803
886 Ga0501079_1148783
887 Ga0501081_0055939
888 Ga0501081_0146671
889 Ga0501263_009570
890 Ga0501273_048510
891 Ga0501283_065241
892 Ga0501045_0407190
893 nmdc:mga05p37_111225_c1
894 nmdc:mga05p37_12839_c1
895 nmdc:mga05p37_148554_c2
896 nmdc:mga05p37_159386_c1
897 nmdc:mga05p37_1904282_c1
898 nmdc:mga05p37_196960_c1
899 nmdc:mga05p37_277741_c1
900 nmdc:mga05p37_349597_c1
901 nmdc:mga05p37_37661_c1
902 nmdc:mga05p37_419601_c1
903 nmdc:mga05p37_7718_c2
904 nmdc:mga09592_1077163_c1
905 nmdc:mga09592_110368_c1
906 nmdc:mga09592_1254608_c1
907 nmdc:mga09592_1365_c1
908 nmdc:mga09592_1401818_c1
909 nmdc:mga09592_272825_c1
910 nmdc:mga09592_39236_c1
911 nmdc:mga09592_42597_c1
912 nmdc:mga09592_472449_c1
913 nmdc:mga09592_796466_c1
914 nmdc:mga09592_82800_c1
915 nmdc:mga0qj67_13721_c1
916 nmdc:mga0qj67_17818_c1
917 nmdc:mga0qj67_27262_c1
918 nmdc:mga06r32_1056210_c1
919 nmdc:mga06r32_124222_c1
920 nmdc:mga06r32_13456_c1
921 nmdc:mga06r32_1619_c1
922 nmdc:mga06r32_244728_c1
923 nmdc:mga08y16_107324_c1
924 nmdc:mga08y16_1155882_c1
925 nmdc:mga08y16_250217_c1
926 nmdc:mga08y16_314251_c1
927 nmdc:mga08y16_332332_c1
928 nmdc:mga08y16_3874_c1
929 nmdc:mga08y16_600_c1
930 nmdc:mga08y16_672382_c1
931 nmdc:mga0n895_1066114_c1
932 nmdc:mga0n895_1364_c1
933 nmdc:mga0n895_208150_c1
934 nmdc:mga0n895_28194_c1
935 nmdc:mga0n895_313334_c1
936 nmdc:mga0n895_41036_c1
937 nmdc:mga0n895_6000_c1
938 nmdc:mga0n895_615847_c1
939 nmdc:mga0rr50_16367_c1
940 nmdc:mga0rr50_18695_c1
941 nmdc:mga0rr50_438518_c1
942 nmdc:mga0rr50_63536_c1
943 nmdc:mga0rr50_89346_c1
944 nmdc:mga0a205_110566_c1
945 nmdc:mga0a205_1166707_c1
946 nmdc:mga0a205_123651_c1
947 nmdc:mga0a205_166_c1
948 nmdc:mga0a205_249542_c1
949 nmdc:mga0a205_6109_c1
950 nmdc:mga0a205_804542_c1
951 nmdc:mga0a205_8809_c1
952 Ga0501084_0335427
953 Ga0590071_000190
954 Ga0590074_001212
955 Ga0590075_000310
956 Ga0590075_006730
957 Ga0590077_000268
958 Ga0590077_008577
959 Ga0501082_0155528
960 Ga0501082_0635697
961 Ga0530510_0606189
962 Ga0530510_0834987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.8052 3 123
5uyy-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine 0.783 8 68
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.7822 3 123
3lpe-assembly1.cif.gz_A crystal structure of spt4/5ngn heterodimer complex from methanococcus jannaschii 0.7328 6 66
4pwu-assembly2.cif.gz_C crystal structure of a modulator protein mzra (kpn_03524) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.45 a resolution 0.7126 4 71
ID Description Score Start End Superfamily
af_P0AG90_2_103_3.30.70.1530 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.7858 8 68 3.30.70.1530
2f06B00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.7622 5 123 3.30.2130.10
af_A0A1D6K384_16_63_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7483 8 50 3.30.70.260
2dtjA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7394 2 61 3.30.70.260
1vbkB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;THUMP domain-like 0.736 6 70 3.30.70.1510
ID Description Score Start End GO Terms
AF-A0A7K2BVU7-F1-model_v4 ACT domain-containing protein 0.93 70 123
AF-X7YQ07-F1-model_v4 ACT domain protein 0.9259 46 124
AF-A0A1Q7QJN7-F1-model_v4 ACT domain-containing protein 0.9219 2 123
AF-A0A7X5WUA1-F1-model_v4 Amino acid-binding protein 0.9202 66 123
AF-A0A1F2TEA2-F1-model_v4 ACT domain-containing protein 0.9196 7 123

Map