F452369

General Info

Members Datasets Scaffolds Average Seq Length
481 265 475 115

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100905798|Ga0070662_1009057981
Length 122
Sequence MARGERTAMSYQASCHCGAVTVEVDADPPSEAVSCNCSHCRRKGFLLSFVPRDKVRVSGEDALGEYRFNKHAIAHRFCRTCGVQPFAEGPGPDGPGAMINLRCVPDMDLDALKIIPFDGASR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
6 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
7 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
220 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
221 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
246 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
247 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
248 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
251 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
260 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
263 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
264 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.21
Nodule 0.21
Rhizoplane 2.08
Rhizosphere 67.98
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2441221 2162886007 Bacteria 2765
2 SwRhRL2b_contig_323084 2162886007 Bacteria 1176
3 JGI24741J21665_1000004 3300001915 Bacteria 51710
4 JGI24740J21852_10002677 3300001979 Bacteria 7993
5 JGI24739J22299_10002528 3300001989 Bacteria 7046
6 JGI24739J22299_10005156 3300001989 Bacteria 4974
7 JGI24737J22298_10011343 3300001990 Bacteria 2922
8 rootH2_10141837 3300003320 Bacteria 1345
9 Ga0055536_1003303 3300003781 Bacteria 8727
10 Ga0055536_1014285 3300003781 Bacteria 2802
11 Ga0055530_10000919 3300003791 Bacteria 24154
12 Ga0055530_10035121 3300003791 Bacteria 1274
13 Ga0055531_10002471 3300003794 Bacteria 12332
14 Ga0055531_10003687 3300003794 Bacteria 9647
15 Ga0055531_10019986 3300003794 Bacteria 2674
16 Ga0065704_10003246 3300005289 Bacteria 6094
17 Ga0065704_10094382 3300005289 Bacteria 2546
18 Ga0065704_10578218 3300005289 Bacteria 619
19 Ga0065712_10134050 3300005290 Bacteria 1517
20 Ga0065715_10936461 3300005293 Unclassified 563
21 Ga0065707_10426569 3300005295 Bacteria 825
22 Ga0070658_10133877 3300005327 Bacteria 2067
23 Ga0070676_10372175 3300005328 Bacteria 987
24 Ga0070670_100071415 3300005331 Bacteria 2981
25 Ga0070670_100099337 3300005331 Bacteria 2504
26 Ga0070666_10180138 3300005335 Bacteria 1482
27 Ga0070666_10563640 3300005335 Bacteria 829
28 Ga0070666_11010110 3300005335 Bacteria 617
29 Ga0070680_100167530 3300005336 Bacteria 1848
30 Ga0070682_100216188 3300005337 Bacteria 1361
31 Ga0070660_100175558 3300005339 Bacteria 1732
32 Ga0070689_101202905 3300005340 Bacteria 680
33 Ga0070661_100289961 3300005344 Bacteria 1271
34 Ga0070668_100015584 3300005347 Bacteria 5681
35 Ga0070668_100730992 3300005347 Bacteria 875
36 Ga0070669_100002141 3300005353 Bacteria 14283
37 Ga0070669_100098711 3300005353 Bacteria 2200
38 Ga0070669_100102016 3300005353 Bacteria 2166
39 Ga0070669_101289253 3300005353 Bacteria 632
40 Ga0070675_100055257 3300005354 Bacteria 3268
41 Ga0070671_100067482 3300005355 Bacteria 2982
42 Ga0070673_100246808 3300005364 Bacteria 1554
43 Ga0070688_100467930 3300005365 Bacteria 945
44 Ga0070688_101295010 3300005365 Bacteria 588
45 Ga0070659_100341101 3300005366 Bacteria 1255
46 Ga0070667_100006854 3300005367 Bacteria 9462
47 Ga0070667_100066344 3300005367 Bacteria 3066
48 Ga0070705_100308413 3300005440 Unclassified 1137
49 Ga0070705_100410831 3300005440 Bacteria 1005
50 Ga0070694_100704415 3300005444 Bacteria 821
51 Ga0070663_100081372 3300005455 Bacteria 2380
52 Ga0070662_100464143 3300005457 Bacteria 1052
53 Ga0070662_100905798 3300005457 Bacteria 752
54 Ga0070662_101702504 3300005457 Bacteria 544
55 Ga0070685_10101437 3300005466 Bacteria 1758
56 Ga0070706_100012176 3300005467 Bacteria 7973
57 Ga0070706_100625715 3300005467 Bacteria 1000
58 Ga0070707_100378639 3300005468 Bacteria 1375
59 Ga0070707_100424238 3300005468 Bacteria 1290
60 Ga0070698_100072113 3300005471 Bacteria 3462
61 Ga0070698_100794923 3300005471 Bacteria 890
62 Ga0070699_100246591 3300005518 Bacteria 1595
63 Ga0070697_100010641 3300005536 Bacteria 7177
64 Ga0070697_100466235 3300005536 Unclassified 1101
65 Ga0068853_100340412 3300005539 Bacteria 1393
66 Ga0070672_100141469 3300005543 Bacteria 1985
67 Ga0070672_100544036 3300005543 Bacteria 1008
68 Ga0070695_100121298 3300005545 Bacteria 1789
69 Ga0070696_100561679 3300005546 Unclassified 916
70 Ga0070665_100000319 3300005548 Bacteria 74295
71 Ga0070665_100428916 3300005548 Bacteria 1331
72 Ga0070665_100665860 3300005548 Bacteria 1054
73 Ga0070704_100037060 3300005549 Bacteria 3328
74 Ga0068857_100016822 3300005577 Bacteria 6407
75 Ga0068857_100100301 3300005577 Bacteria 2597
76 Ga0068857_100102377 3300005577 Bacteria 2570
77 Ga0068857_100569360 3300005577 Bacteria 1068
78 Ga0068854_100008216 3300005578 Bacteria 6698
79 Ga0068854_102166982 3300005578 Bacteria 514
80 Ga0068856_100035551 3300005614 Bacteria 4883
81 Ga0068859_100043467 3300005617 Bacteria 4515
82 Ga0068859_102368317 3300005617 Bacteria 585
83 Ga0068863_100025408 3300005841 Bacteria 5647
84 Ga0068858_100124395 3300005842 Bacteria 2414
85 Ga0068860_101722279 3300005843 Bacteria 649
86 Ga0068862_100126653 3300005844 Bacteria 2255
87 Ga0075368_10169452 3300006042 Bacteria 917
88 Ga0075363_100000964 3300006048 Bacteria 10229
89 Ga0075364_10006257 3300006051 Bacteria 6983
90 Ga0075364_10380975 3300006051 Bacteria 962
91 Ga0070716_100391432 3300006173 Unclassified 997
92 Ga0075362_10000316 3300006177 Bacteria 13703
93 Ga0075362_10245241 3300006177 Bacteria 880
94 Ga0075369_10000758 3300006186 Bacteria 10514
95 Ga0075369_10029953 3300006186 Bacteria 2290
96 Ga0075366_10001276 3300006195 Bacteria 12537
97 Ga0075366_10163137 3300006195 Bacteria 1351
98 Ga0075366_10314667 3300006195 Bacteria 958
99 Ga0075366_10403691 3300006195 Bacteria 841
100 Ga0075366_10868526 3300006195 Bacteria 562
101 Ga0075370_10000003 3300006353 Bacteria 133163
102 Ga0075370_10077872 3300006353 Bacteria 1903
103 Ga0075370_10185713 3300006353 Bacteria 1224
104 Ga0075370_10218261 3300006353 Bacteria 1127
105 Ga0075370_10377901 3300006353 Bacteria 849
106 Ga0075431_100074339 3300006847 Unclassified 3507
107 Ga0075433_10056567 3300006852 Bacteria 3426
108 Ga0075434_100029046 3300006871 Bacteria 5438
109 Ga0075429_100039753 3300006880 Unclassified 4094
110 Ga0075436_100025823 3300006914 Bacteria 4043
111 Ga0097620_100043468 3300006931 Bacteria 4515
112 Ga0097620_102366950 3300006931 Bacteria 585
113 Ga0075435_100068572 3300007076 Bacteria 2890
114 Ga0105251_10004323 3300009011 Bacteria 9730
115 Ga0105240_11870675 3300009093 Bacteria 625
116 Ga0111539_11410162 3300009094 Bacteria 808
117 Ga0114129_10510666 3300009147 Bacteria 1568
118 Ga0114129_11336000 3300009147 Bacteria 887
119 Ga0105241_10001135 3300009174 Bacteria 20278
120 Ga0105248_10030234 3300009177 Bacteria 6047
121 Ga0105248_10274707 3300009177 Bacteria 1897
122 Ga0105237_10252425 3300009545 Bacteria 1766
123 Ga0105238_10148885 3300009551 Bacteria 2317
124 Ga0105238_10295608 3300009551 Bacteria 1603
125 Ga0105238_10501231 3300009551 Bacteria 1215
126 Ga0105249_10030728 3300009553 Bacteria 4857
127 Ga0105249_10032143 3300009553 Bacteria 4747
128 Ga0105148_100098 3300009978 Bacteria 13718
129 Ga0105239_10033054 3300010375 Bacteria 5681
130 Ga0105239_10271857 3300010375 Bacteria 1906
131 Ga0157371_10296913 3300013102 Bacteria 1169
132 Ga0157370_10177525 3300013104 Bacteria 1980
133 Ga0157369_10758140 3300013105 Bacteria 998
134 Ga0157378_10005257 3300013297 Bacteria 11373
135 Ga0163162_10220636 3300013306 Bacteria 2026
136 Ga0157375_11931759 3300013308 Bacteria 701
137 Ga0163161_10014729 3300017792 Bacteria 5446
138 Ga0163161_10621331 3300017792 Bacteria 893
139 Ga0209675_1000169 3300025291 Bacteria 78355
140 Ga0209676_1000651 3300025292 Bacteria 49756
141 Ga0209676_1001585 3300025292 Bacteria 20263
142 Ga0209676_1037032 3300025292 Bacteria 1412
143 Ga0209025_1016458 3300025294 Bacteria 4361
144 Ga0209025_1035205 3300025294 Bacteria 2267
145 Ga0209050_1000310 3300025298 Bacteria 99292
146 Ga0209050_1008987 3300025298 Bacteria 5207
147 Ga0207426_1058904 3300025302 Bacteria 1113
148 Ga0209257_1000113 3300025304 Bacteria 233523
149 Ga0209257_1000379 3300025304 Bacteria 88845
150 Ga0209257_1002330 3300025304 Bacteria 19148
151 Ga0207697_10237070 3300025315 Bacteria 806
152 Ga0207656_10090623 3300025321 Bacteria 1387
153 Ga0207713_1004001 3300025735 Bacteria 9760
154 Ga0207710_10078712 3300025900 Bacteria 1525
155 Ga0207680_10327363 3300025903 Bacteria 1072
156 Ga0207680_10945417 3300025903 Bacteria 618
157 Ga0207647_10011216 3300025904 Bacteria 6293
158 Ga0207705_10087272 3300025909 Bacteria 2281
159 Ga0207684_10070097 3300025910 Bacteria 2979
160 Ga0207684_10183876 3300025910 Bacteria 1802
161 Ga0207684_10519467 3300025910 Bacteria 1020
162 Ga0207654_10043696 3300025911 Bacteria 2542
163 Ga0207671_10551565 3300025914 Bacteria 919
164 Ga0207657_10033667 3300025919 Bacteria 4616
165 Ga0207646_10007840 3300025922 Bacteria 10792
166 Ga0207646_10257277 3300025922 Bacteria 1578
167 Ga0207681_10003128 3300025923 Bacteria 10410
168 Ga0207681_10150347 3300025923 Bacteria 1744
169 Ga0207681_10717907 3300025923 Unclassified 832
170 Ga0207694_10050186 3300025924 Bacteria 3230
171 Ga0207694_11026349 3300025924 Bacteria 698
172 Ga0207650_10031851 3300025925 Bacteria 3811
173 Ga0207650_10271788 3300025925 Bacteria 1377
174 Ga0207650_10371771 3300025925 Bacteria 1179
175 Ga0207659_10017628 3300025926 Bacteria 4666
176 Ga0207644_10049183 3300025931 Bacteria 3017
177 Ga0207690_10137961 3300025932 Bacteria 1793
178 Ga0207706_10044495 3300025933 Bacteria 3935
179 Ga0207706_10111538 3300025933 Bacteria 2406
180 Ga0207706_10157607 3300025933 Bacteria 1996
181 Ga0207665_10110646 3300025939 Bacteria 1930
182 Ga0207691_10300897 3300025940 Bacteria 1378
183 Ga0207691_10696426 3300025940 Bacteria 857
184 Ga0207711_10016829 3300025941 Bacteria 6071
185 Ga0207711_10260035 3300025941 Bacteria 1595
186 Ga0207679_10153593 3300025945 Unclassified 1877
187 Ga0207667_10117347 3300025949 Bacteria 2743
188 Ga0207651_10238270 3300025960 Bacteria 1481
189 Ga0207651_10974793 3300025960 Bacteria 757
190 Ga0207712_10016235 3300025961 Bacteria 4817
191 Ga0207668_10006745 3300025972 Bacteria 6795
192 Ga0207668_10751497 3300025972 Bacteria 860
193 Ga0207640_10367676 3300025981 Bacteria 1161
194 Ga0207640_11200509 3300025981 Bacteria 674
195 Ga0207658_10000753 3300025986 Bacteria 27873
196 Ga0207658_10024591 3300025986 Bacteria 4214
197 Ga0207703_10102439 3300026035 Bacteria 2429
198 Ga0207639_10004953 3300026041 Bacteria 8969
199 Ga0207639_10387424 3300026041 Bacteria 1256
200 Ga0207678_10000072 3300026067 Bacteria 81033
201 Ga0207702_10007238 3300026078 Bacteria 9494
202 Ga0207641_10008340 3300026088 Bacteria 8566
203 Ga0207641_10033943 3300026088 Bacteria 4241
204 Ga0207648_11440076 3300026089 Bacteria 648
205 Ga0207674_10030576 3300026116 Bacteria 5660
206 Ga0207674_10030787 3300026116 Bacteria 5640
207 Ga0207674_10104617 3300026116 Bacteria 2809
208 Ga0207674_10185781 3300026116 Bacteria 2029
209 Ga0207698_10099047 3300026142 Bacteria 2410
210 Ga0209813_10222589 3300027866 Bacteria 707
211 Ga0268266_10010110 3300028379 Bacteria 8272
212 Ga0268266_10163693 3300028379 Bacteria 2014
213 Ga0268265_11183491 3300028380 Bacteria 761
214 Ga0268265_12254197 3300028380 Bacteria 551
215 Ga0268264_10007902 3300028381 Bacteria 8850
216 Ga0268264_10983174 3300028381 Bacteria 850
217 Ga0307513_10178527 3300031456 Bacteria 1990
218 Ga0307408_100068726 3300031548 Bacteria 2609
219 Ga0307408_100092730 3300031548 Bacteria 2283
220 Ga0307408_100229354 3300031548 Bacteria 1520
221 Ga0307408_100272537 3300031548 Bacteria 1406
222 Ga0307408_100391378 3300031548 Bacteria 1191
223 Ga0307408_101238082 3300031548 Bacteria 697
224 Ga0307405_10013914 3300031731 Bacteria 4308
225 Ga0307405_10022644 3300031731 Bacteria 3555
226 Ga0307405_10067986 3300031731 Bacteria 2278
227 Ga0307405_10165778 3300031731 Bacteria 1570
228 Ga0307405_10223713 3300031731 Bacteria 1382
229 Ga0307405_10382933 3300031731 Bacteria 1095
230 Ga0307405_11039887 3300031731 Bacteria 701
231 Ga0307405_11183131 3300031731 Bacteria 660
232 Ga0307413_10048521 3300031824 Bacteria 2538
233 Ga0307413_10212030 3300031824 Archaea 1407
234 Ga0307413_10230820 3300031824 Bacteria 1359
235 Ga0307413_10287137 3300031824 Bacteria 1240
236 Ga0307413_10388758 3300031824 Bacteria 1089
237 Ga0307410_10003860 3300031852 Bacteria 7619
238 Ga0307410_10005072 3300031852 Bacteria 6919
239 Ga0307410_10010978 3300031852 Bacteria 5158
240 Ga0307410_10170697 3300031852 Bacteria 1638
241 Ga0307410_11139273 3300031852 Bacteria 677
242 Ga0307406_10016687 3300031901 Bacteria 4273
243 Ga0307406_10109973 3300031901 Bacteria 1895
244 Ga0307406_10464606 3300031901 Bacteria 1018
245 Ga0307406_10893049 3300031901 Bacteria 756
246 Ga0307406_11051779 3300031901 Bacteria 701
247 Ga0307406_11916960 3300031901 Unclassified 528
248 Ga0307407_10012689 3300031903 Bacteria 4060
249 Ga0307407_10204201 3300031903 Bacteria 1326
250 Ga0307407_10215703 3300031903 Bacteria 1294
251 Ga0307412_10003412 3300031911 Bacteria 8827
252 Ga0307412_10029631 3300031911 Bacteria 3437
253 Ga0307412_10066230 3300031911 Bacteria 2447
254 Ga0307412_10076129 3300031911 Bacteria 2304
255 Ga0307412_10135056 3300031911 Bacteria 1798
256 Ga0307412_10150028 3300031911 Bacteria 1719
257 Ga0307412_10353309 3300031911 Bacteria 1181
258 Ga0307412_10458077 3300031911 Bacteria 1052
259 Ga0307412_10640627 3300031911 Bacteria 905
260 Ga0307412_10741074 3300031911 Bacteria 847
261 Ga0307412_11307183 3300031911 Bacteria 653
262 Ga0307409_100006805 3300031995 Bacteria 6764
263 Ga0307409_100040536 3300031995 Bacteria 3468
264 Ga0307416_100054028 3300032002 Bacteria 3227
265 Ga0307416_100102514 3300032002 Bacteria 2495
266 Ga0307416_101036733 3300032002 Bacteria 924
267 Ga0307416_102069742 3300032002 Bacteria 671
268 Ga0307414_10000371 3300032004 Bacteria 24637
269 Ga0307414_10024523 3300032004 Bacteria 3848
270 Ga0307414_10036286 3300032004 Bacteria 3290
271 Ga0307414_10101238 3300032004 Bacteria 2168
272 Ga0307414_10108351 3300032004 Bacteria 2107
273 Ga0307414_10121153 3300032004 Bacteria 2011
274 Ga0307414_10199442 3300032004 Bacteria 1626
275 Ga0307414_10738601 3300032004 Bacteria 894
276 Ga0307414_10851153 3300032004 Bacteria 834
277 Ga0307414_10890731 3300032004 Bacteria 815
278 Ga0307414_10893937 3300032004 Bacteria 814
279 Ga0307414_11133533 3300032004 Bacteria 723
280 Ga0307411_10017294 3300032005 Bacteria 4104
281 Ga0307411_10032194 3300032005 Bacteria 3237
282 Ga0307411_10079940 3300032005 Bacteria 2246
283 Ga0307411_10083043 3300032005 Bacteria 2211
284 Ga0307411_10225337 3300032005 Bacteria 1457
285 Ga0307411_10280310 3300032005 Bacteria 1326
286 Ga0307411_10313105 3300032005 Bacteria 1264
287 Ga0307415_100037229 3300032126 Bacteria 3195
288 Ga0307415_100108017 3300032126 Bacteria 2057
289 Ga0307415_100302789 3300032126 Bacteria 1325
290 Ga0451804_1104242 3300041463 Unclassified 602
291 Ga0451833_1126812 3300041491 Bacteria 937
292 Ga0451837_1227694 3300041494 Unclassified 503
293 Ga0451849_0996688 3300041505 Bacteria 574
294 Ga0451843_0447190 3300041509 Bacteria 992
295 Ga0451853_1536320 3300041512 Bacteria 1513
296 Ga0466973_0229625 3300044659 Bacteria 1335
297 Ga0466965_0561040 3300044683 Bacteria 646
298 Ga0466963_0357973 3300044694 Bacteria 1028
299 Ga0495629_0361826 3300046459 Bacteria 989
300 Ga0495638_0112500 3300046460 Bacteria 1616
301 Ga0495638_0122784 3300046460 Bacteria 1533
302 Ga0495607_0005396 3300046501 Bacteria 9166
303 Ga0495583_0241819 3300046506 Bacteria 725
304 Ga0495606_0521373 3300046507 Bacteria 596
305 Ga0495616_0083335 3300046513 Bacteria 1526
306 Ga0495632_0000382 3300046519 Bacteria 42287
307 Ga0495637_0033940 3300046520 Bacteria 2237
308 Ga0495637_0038386 3300046520 Bacteria 2074
309 Ga0495643_0000053 3300046522 Bacteria 202031
310 Ga0495643_0030674 3300046522 Bacteria 3000
311 Ga0495643_0095576 3300046522 Bacteria 1528
312 Ga0495648_0054519 3300046524 Bacteria 2415
313 Ga0495663_0000020 3300046525 Bacteria 124560
314 Ga0495663_0047226 3300046525 Bacteria 1325
315 Ga0495654_0000338 3300046530 Bacteria 40946
316 Ga0495654_0013119 3300046530 Bacteria 4438
317 Ga0495654_0026577 3300046530 Bacteria 2974
318 Ga0495654_0276212 3300046530 Bacteria 692
319 Ga0495609_0024585 3300046538 Bacteria 2763
320 Ga0495633_0002316 3300046558 Bacteria 13569
321 Ga0495633_0007042 3300046558 Bacteria 6549
322 Ga0495633_0260450 3300046558 Bacteria 790
323 Ga0495633_0442420 3300046558 Bacteria 587
324 Ga0495668_0002301 3300046616 Bacteria 16028
325 Ga0495668_0031752 3300046616 Bacteria 2976
326 Ga0495668_0060940 3300046616 Bacteria 2081
327 Ga0495668_0069154 3300046616 Bacteria 1942
328 Ga0495625_0000078 3300046660 Bacteria 161613
329 Ga0495625_0001182 3300046660 Bacteria 33512
330 Ga0495625_0020888 3300046660 Bacteria 5048
331 Ga0495625_0053072 3300046660 Bacteria 2901
332 Ga0495588_0769571 3300046674 Bacteria 503
333 Ga0495669_0018437 3300046684 Bacteria 3001
334 Ga0495624_0768419 3300046690 Unclassified 570
335 Ga0495670_0497435 3300046691 Unclassified 662
336 Ga0495671_0000031 3300046692 Bacteria 202030
337 Ga0495649_0390708 3300046694 Bacteria 699
338 Ga0495649_0570343 3300046694 Bacteria 559
339 Ga0495589_0313945 3300046794 Bacteria 725
340 Ga0495636_0500051 3300047318 Unclassified 588
341 Ga0495676_0662771 3300047321 Bacteria 677
342 Ga0495685_273651 3300047447 Bacteria 533
343 Ga0495681_0046916 3300047470 Bacteria 2057
344 Ga0495615_0000545 3300048090 Bacteria 5351
345 Ga0496103_0021927 3300048906 Bacteria 3844
346 Ga0496105_1175662 3300048908 Unclassified 566
347 Ga0496108_0003383 3300048911 Bacteria 12807
348 Ga0496110_0006266 3300048913 Bacteria 9387
349 Ga0496110_0033573 3300048913 Bacteria 4440
350 Ga0496110_0554569 3300048913 Bacteria 1044
351 Ga0496111_0097183 3300048914 Bacteria 2162
352 Ga0496111_1343791 3300048914 Unclassified 502
353 Ga0496113_0162419 3300048916 Bacteria 1766
354 Ga0496116_0048154 3300048919 Bacteria 2862
355 Ga0496116_0166456 3300048919 Bacteria 1201
356 Ga0496117_0105998 3300048920 Bacteria 1765
357 Ga0496117_0469529 3300048920 Bacteria 617
358 Ga0496118_0270473 3300048921 Bacteria 952
359 Ga0496118_0619149 3300048921 Bacteria 514
360 Ga0496119_0025296 3300048922 Bacteria 4150
361 Ga0496121_0001861 3300048924 Bacteria 33858
362 Ga0496121_0006621 3300048924 Bacteria 14278
363 Ga0496121_0141459 3300048924 Bacteria 1784
364 Ga0496122_0016810 3300048925 Bacteria 6889
365 Ga0496122_0035654 3300048925 Bacteria 4041
366 Ga0496122_0092215 3300048925 Bacteria 2060
367 Ga0496122_0146809 3300048925 Bacteria 1464
368 Ga0496122_0205647 3300048925 Bacteria 1146
369 Ga0496123_0000877 3300048926 Bacteria 47738
370 Ga0496123_0048931 3300048926 Bacteria 2840
371 Ga0496124_0016769 3300048927 Bacteria 6946
372 Ga0496124_0059849 3300048927 Bacteria 3197
373 Ga0496124_0284819 3300048927 Bacteria 1202
374 Ga0496125_0000335 3300048928 Bacteria 90043
375 Ga0496125_0009669 3300048928 Bacteria 9855
376 Ga0496125_0308009 3300048928 Bacteria 966
377 Ga0496125_0483072 3300048928 Bacteria 701
378 Ga0496125_0618932 3300048928 Bacteria 588
379 Ga0496125_0618941 3300048928 Bacteria 588
380 Ga0496126_0030384 3300048929 Bacteria 5118
381 Ga0496126_0094985 3300048929 Bacteria 2616
382 Ga0496126_0185685 3300048929 Bacteria 1763
383 Ga0496126_1023560 3300048929 Bacteria 618
384 Ga0495678_066260 3300049459 Bacteria 1338
385 Ga0501290_066228 3300049513 Bacteria 591
386 Ga0501033_0029119 3300049570 Bacteria 4150
387 Ga0501036_0028055 3300049572 Bacteria 4758
388 Ga0501036_0600062 3300049572 Bacteria 913
389 Ga0501037_0024598 3300049573 Bacteria 4453
390 Ga0501037_0498883 3300049573 Bacteria 826
391 Ga0501038_0118314 3300049574 Bacteria 2188
392 Ga0501047_0235122 3300049581 Bacteria 1684
393 Ga0501047_0408754 3300049581 Bacteria 1190
394 Ga0501069_0148394 3300049585 Bacteria 1347
395 Ga0501211_004172 3300049658 Bacteria 1479
396 Ga0501235_001424 3300049669 Bacteria 5101
397 Ga0501247_025249 3300049677 Bacteria 789
398 Ga0501225_0004445 3300049705 Bacteria 4175
399 Ga0501245_001360 3300049708 Bacteria 3149
400 Ga0501262_012680 3300049759 Bacteria 1080
401 Ga0501273_006131 3300049770 Bacteria 1382
402 Ga0501035_0231916 3300049822 Bacteria 1573
403 Ga0501035_0700531 3300049822 Bacteria 817
404 Ga0501044_0112215 3300049823 Bacteria 2733
405 Ga0501044_0186612 3300049823 Bacteria 2038
406 Ga0501044_0644196 3300049823 Bacteria 949
407 nmdc:mga03683_218253_c1 3300050489 Bacteria 879
408 nmdc:mga03683_30_c1 3300050489 Bacteria 71765
409 nmdc:mga03n38_7788_c1 3300050490 Bacteria 3803
410 nmdc:mga00v17_4911_c1 3300050491 Bacteria 7008
411 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
412 nmdc:mga07m45_29679_c1 3300050496 Bacteria 3026
413 nmdc:mga07m45_45093_c1 3300050496 Bacteria 2475
414 nmdc:mga07m45_622389_c1 3300050496 Bacteria 623
415 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
416 nmdc:mga05p37_413371_c1 3300050507 Bacteria 1572
417 nmdc:mga08y16_1004924_c1 3300050511 Bacteria 814
418 nmdc:mga0n895_21217_c1 3300050512 Bacteria 6069
419 nmdc:mga0rr50_16968_c1 3300050513 Bacteria 4850
420 nmdc:mga0a205_72938_c1 3300050515 Bacteria 3317
421 nmdc:mga0sz30_14081_c1 3300050516 Bacteria 1939
422 nmdc:mga0sz30_186_c1 3300050516 Bacteria 22840
423 Ga0500578_0223118 3300053086 Unclassified 1145
424 Ga0500643_001384 3300053087 Bacteria 14039
425 Ga0500643_003779 3300053087 Bacteria 7088
426 Ga0500643_006134 3300053087 Bacteria 5072
427 Ga0500644_0451831 3300053088 Bacteria 563
428 Ga0500647_0201854 3300053091 Bacteria 901
429 Ga0500583_0440190 3300053092 Bacteria 620
430 Ga0500651_0008800 3300053093 Bacteria 5966
431 Ga0500651_0017977 3300053093 Bacteria 4372
432 Ga0500566_0173146 3300053094 Bacteria 1114
433 Ga0500566_0406814 3300053094 Unclassified 607
434 Ga0500641_0037228 3300053096 Bacteria 1950
435 Ga0500555_037030 3300053103 Bacteria 1367
436 Ga0500556_0088273 3300053104 Unclassified 1181
437 Ga0500562_123811 3300053108 Bacteria 704
438 Ga0500592_000331 3300053116 Bacteria 8029
439 Ga0500592_001009 3300053116 Bacteria 4592
440 Ga0500592_001352 3300053116 Bacteria 3966
441 Ga0500592_011627 3300053116 Bacteria 1408
442 Ga0500592_038095 3300053116 Bacteria 777
443 Ga0500595_000936 3300053119 Bacteria 16529
444 Ga0500595_013079 3300053119 Bacteria 3187
445 Ga0500607_000354 3300053121 Bacteria 43487
446 Ga0500608_176842 3300053122 Bacteria 908
447 Ga0500614_119478 3300053123 Bacteria 775
448 Ga0500642_0001579 3300053130 Bacteria 6570
449 Ga0500658_0088052 3300053134 Bacteria 1338
450 Ga0500658_0297617 3300053134 Bacteria 742
451 Ga0500559_0002819 3300053136 Bacteria 8782
452 Ga0500559_0014454 3300053136 Bacteria 3336
453 Ga0500568_0286259 3300053139 Unclassified 598
454 Ga0500577_0043828 3300053142 Bacteria 1646
455 Ga0500590_000500 3300053148 Bacteria 13522
456 Ga0500590_018765 3300053148 Bacteria 3582
457 Ga0500604_0009641 3300053151 Bacteria 2574
458 Ga0500604_0011102 3300053151 Bacteria 2416
459 Ga0500604_0020381 3300053151 Bacteria 1866
460 Ga0500622_0000145 3300053156 Bacteria 75417
461 Ga0500622_0030530 3300053156 Bacteria 2830
462 Ga0500622_0109387 3300053156 Bacteria 1352
463 Ga0500627_0000009 3300053158 Bacteria 153203
464 Ga0500627_0000248 3300053158 Bacteria 15424
465 Ga0500627_0001815 3300053158 Bacteria 6084
466 Ga0500627_0035313 3300053158 Bacteria 2123
467 Ga0500627_0102411 3300053158 Bacteria 1286
468 Ga0500627_0128462 3300053158 Bacteria 1144
469 Ga0500639_028351 3300053163 Bacteria 2960
470 Ga0500636_0246809 3300053177 Bacteria 913
471 Ga0500637_0088932 3300053178 Bacteria 1787
472 Ga0500570_000502 3300053724 Bacteria 15237
473 Ga0500611_082447 3300053727 Bacteria 805
474 Ga0500611_180898 3300053727 Bacteria 591
475 Ga0500645_001907 3300053730 Bacteria 9922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053123 Ga0500614_119478 Ga0500614_119478_52_345 96
2 3300049570 Ga0501033_0029119 Ga0501033_0029119_3190_3504 103
3 3300049572 Ga0501036_0600062 Ga0501036_0600062_158_472 103
4 3300049573 Ga0501037_0024598 Ga0501037_0024598_4041_4355 103
5 3300049574 Ga0501038_0118314 Ga0501038_0118314_787_1101 103
6 3300049677 Ga0501247_025249 Ga0501247_025249_443_754 103
7 3300049770 Ga0501273_006131 Ga0501273_006131_821_1132 103
8 3300049822 Ga0501035_0231916 Ga0501035_0231916_542_856 103
9 3300049823 Ga0501044_0186612 Ga0501044_0186612_656_970 103
10 3300046507 Ga0495606_0521373 Ga0495606_0521373_257_574 104
11 3300048920 Ga0496117_0469529 Ga0496117_0469529_21_338 104
12 3300031824 Ga0307413_10388758 Ga0307413_103887582 105
13 3300031852 Ga0307410_10005072 Ga0307410_100050723 105
14 3300031995 Ga0307409_100006805 Ga0307409_1000068052 105
15 3300032004 Ga0307414_10893937 Ga0307414_108939372 105
16 3300031731 Ga0307405_10165778 Ga0307405_101657782 106
17 iso_pu_bacteria 2508501050 2508730531 111
18 iso_pu_bacteria 2643221563 2643835022 111
19 iso_pu_bacteria 2643221608 2644055949 111
20 iso_pu_bacteria 2739367655 2739609930 111
21 iso_pu_bacteria 2852653556 2852653615 111
22 iso_pu_bacteria 2852680915 2852683112 111
23 3300044683 Ga0466965_0561040 Ga0466965_0561040_166_510 113
24 3300001989 JGI24739J22299_10005156 JGI24739J22299_100051562 114
25 3300005290 Ga0065712_10134050 Ga0065712_101340502 114
26 3300005331 Ga0070670_100071415 Ga0070670_1000714152 114
27 3300005335 Ga0070666_10563640 Ga0070666_105636401 114
28 3300005336 Ga0070680_100167530 Ga0070680_1001675302 114
29 3300005340 Ga0070689_101202905 Ga0070689_1012029051 114
30 3300005354 Ga0070675_100055257 Ga0070675_1000552572 114
31 3300005364 Ga0070673_100246808 Ga0070673_1002468082 114
32 3300005365 Ga0070688_101295010 Ga0070688_1012950102 114
33 3300005366 Ga0070659_100341101 Ga0070659_1003411012 114
34 3300005440 Ga0070705_100308413 Ga0070705_1003084132 114
35 3300005440 Ga0070705_100410831 Ga0070705_1004108312 114
36 3300005444 Ga0070694_100704415 Ga0070694_1007044152 114
37 3300005457 Ga0070662_100464143 Ga0070662_1004641432 114
38 3300005457 Ga0070662_100905798 Ga0070662_1009057981 114
39 3300005457 Ga0070662_101702504 Ga0070662_1017025041 114
40 3300005467 Ga0070706_100012176 Ga0070706_1000121762 114
41 3300005467 Ga0070706_100625715 Ga0070706_1006257151 114
42 3300005468 Ga0070707_100378639 Ga0070707_1003786392 114
43 3300005468 Ga0070707_100424238 Ga0070707_1004242382 114
44 3300005471 Ga0070698_100072113 Ga0070698_1000721132 114
45 3300005471 Ga0070698_100794923 Ga0070698_1007949232 114
46 3300005518 Ga0070699_100246591 Ga0070699_1002465912 114
47 3300005536 Ga0070697_100010641 Ga0070697_1000106418 114
48 3300005536 Ga0070697_100466235 Ga0070697_1004662352 114
49 3300005539 Ga0068853_100340412 Ga0068853_1003404122 114
50 3300005543 Ga0070672_100141469 Ga0070672_1001414692 114
51 3300005545 Ga0070695_100121298 Ga0070695_1001212983 114
52 3300005546 Ga0070696_100561679 Ga0070696_1005616792 114
53 3300005549 Ga0070704_100037060 Ga0070704_1000370601 114
54 3300005577 Ga0068857_100569360 Ga0068857_1005693602 114
55 3300005578 Ga0068854_100008216 Ga0068854_1000082166 114
56 3300005617 Ga0068859_102368317 Ga0068859_1023683171 114
57 3300006051 Ga0075364_10006257 Ga0075364_100062574 114
58 3300006173 Ga0070716_100391432 Ga0070716_1003914322 114
59 3300006177 Ga0075362_10245241 Ga0075362_102452412 114
60 3300006186 Ga0075369_10029953 Ga0075369_100299532 114
61 3300006195 Ga0075366_10163137 Ga0075366_101631372 114
62 3300006195 Ga0075366_10403691 Ga0075366_104036911 114
63 3300006195 Ga0075366_10868526 Ga0075366_108685261 114
64 3300006353 Ga0075370_10077872 Ga0075370_100778723 114
65 3300006353 Ga0075370_10185713 Ga0075370_101857132 114
66 3300006353 Ga0075370_10218261 Ga0075370_102182613 114
67 3300006847 Ga0075431_100074339 Ga0075431_1000743392 114
68 3300006852 Ga0075433_10056567 Ga0075433_100565672 114
69 3300006871 Ga0075434_100029046 Ga0075434_1000290462 114
70 3300006880 Ga0075429_100039753 Ga0075429_1000397534 114
71 3300006914 Ga0075436_100025823 Ga0075436_1000258232 114
72 3300006931 Ga0097620_102366950 Ga0097620_1023669502 114
73 3300007076 Ga0075435_100068572 Ga0075435_1000685722 114
74 3300009147 Ga0114129_10510666 Ga0114129_105106662 114
75 3300009551 Ga0105238_10295608 Ga0105238_102956082 114
76 3300013102 Ga0157371_10296913 Ga0157371_102969132 114
77 3300013297 Ga0157378_10005257 Ga0157378_1000525712 114
78 3300013308 Ga0157375_11931759 Ga0157375_119317592 114
79 3300025910 Ga0207684_10070097 Ga0207684_100700972 114
80 3300025910 Ga0207684_10183876 Ga0207684_101838762 114
81 3300025910 Ga0207684_10519467 Ga0207684_105194672 114
82 3300025922 Ga0207646_10007840 Ga0207646_100078403 114
83 3300025922 Ga0207646_10257277 Ga0207646_102572772 114
84 3300025923 Ga0207681_10717907 Ga0207681_107179072 114
85 3300025924 Ga0207694_11026349 Ga0207694_110263492 114
86 3300025925 Ga0207650_10271788 Ga0207650_102717882 114
87 3300025926 Ga0207659_10017628 Ga0207659_100176282 114
88 3300025932 Ga0207690_10137961 Ga0207690_101379612 114
89 3300025933 Ga0207706_10044495 Ga0207706_100444952 114
90 3300025933 Ga0207706_10157607 Ga0207706_101576072 114
91 3300025939 Ga0207665_10110646 Ga0207665_101106463 114
92 3300025940 Ga0207691_10300897 Ga0207691_103008972 114
93 3300025940 Ga0207691_10696426 Ga0207691_106964262 114
94 3300025960 Ga0207651_10238270 Ga0207651_102382702 114
95 3300025960 Ga0207651_10974793 Ga0207651_109747931 114
96 3300025981 Ga0207640_10367676 Ga0207640_103676762 114
97 3300026041 Ga0207639_10387424 Ga0207639_103874242 114
98 3300026089 Ga0207648_11440076 Ga0207648_114400762 114
99 3300026116 Ga0207674_10185781 Ga0207674_101857812 114
100 3300031548 Ga0307408_100092730 Ga0307408_1000927302 114
101 3300031548 Ga0307408_100229354 Ga0307408_1002293542 114
102 3300031548 Ga0307408_100272537 Ga0307408_1002725372 114
103 3300031548 Ga0307408_100391378 Ga0307408_1003913781 114
104 3300031548 Ga0307408_101238082 Ga0307408_1012380822 114
105 3300031731 Ga0307405_10022644 Ga0307405_100226442 114
106 3300031731 Ga0307405_10067986 Ga0307405_100679862 114
107 3300031731 Ga0307405_10382933 Ga0307405_103829331 114
108 3300031731 Ga0307405_11039887 Ga0307405_110398871 114
109 3300031731 Ga0307405_11183131 Ga0307405_111831312 114
110 3300031824 Ga0307413_10048521 Ga0307413_100485212 114
111 3300031824 Ga0307413_10212030 Ga0307413_102120302 114
112 3300031824 Ga0307413_10287137 Ga0307413_102871372 114
113 3300031852 Ga0307410_10010978 Ga0307410_100109782 114
114 3300031852 Ga0307410_10170697 Ga0307410_101706972 114
115 3300031852 Ga0307410_11139273 Ga0307410_111392732 114
116 3300031901 Ga0307406_10016687 Ga0307406_100166872 114
117 3300031901 Ga0307406_10109973 Ga0307406_101099732 114
118 3300031901 Ga0307406_10893049 Ga0307406_108930492 114
119 3300031901 Ga0307406_11051779 Ga0307406_110517792 114
120 3300031901 Ga0307406_11916960 Ga0307406_119169601 114
121 3300031903 Ga0307407_10012689 Ga0307407_100126892 114
122 3300031903 Ga0307407_10215703 Ga0307407_102157032 114
123 3300031911 Ga0307412_10066230 Ga0307412_100662302 114
124 3300031911 Ga0307412_10076129 Ga0307412_100761292 114
125 3300031911 Ga0307412_10135056 Ga0307412_101350563 114
126 3300031911 Ga0307412_10150028 Ga0307412_101500282 114
127 3300031911 Ga0307412_10353309 Ga0307412_103533091 114
128 3300031911 Ga0307412_10640627 Ga0307412_106406272 114
129 3300031911 Ga0307412_10741074 Ga0307412_107410742 114
130 3300031995 Ga0307409_100040536 Ga0307409_1000405362 114
131 3300032002 Ga0307416_100054028 Ga0307416_1000540282 114
132 3300032002 Ga0307416_100102514 Ga0307416_1001025142 114
133 3300032002 Ga0307416_102069742 Ga0307416_1020697421 114
134 3300032004 Ga0307414_10101238 Ga0307414_101012383 114
135 3300032004 Ga0307414_10890731 Ga0307414_108907312 114
136 3300032005 Ga0307411_10017294 Ga0307411_100172942 114
137 3300032005 Ga0307411_10079940 Ga0307411_100799402 114
138 3300032005 Ga0307411_10083043 Ga0307411_100830432 114
139 3300032005 Ga0307411_10225337 Ga0307411_102253372 114
140 3300032005 Ga0307411_10313105 Ga0307411_103131052 114
141 3300032126 Ga0307415_100037229 Ga0307415_1000372292 114
142 3300032126 Ga0307415_100108017 Ga0307415_1001080172 114
143 3300032126 Ga0307415_100302789 Ga0307415_1003027892 114
144 3300041494 Ga0451837_1227694 Ga0451837_1227694_10_357 114
145 3300046460 Ga0495638_0122784 Ga0495638_0122784_32_379 114
146 3300046525 Ga0495663_0047226 Ga0495663_0047226_469_816 114
147 3300046530 Ga0495654_0000338 Ga0495654_0000338_4591_4938 114
148 3300046530 Ga0495654_0013119 Ga0495654_0013119_2911_3258 114
149 3300046558 Ga0495633_0442420 Ga0495633_0442420_42_389 114
150 3300046616 Ga0495668_0002301 Ga0495668_0002301_2978_3325 114
151 3300046616 Ga0495668_0069154 Ga0495668_0069154_856_1203 114
152 3300046660 Ga0495625_0053072 Ga0495625_0053072_1903_2250 114
153 3300046694 Ga0495649_0390708 Ga0495649_0390708_155_502 114
154 3300046694 Ga0495649_0570343 Ga0495649_0570343_185_532 114
155 3300046794 Ga0495589_0313945 Ga0495589_0313945_25_372 114
156 3300047318 Ga0495636_0500051 Ga0495636_0500051_129_476 114
157 3300047447 Ga0495685_273651 Ga0495685_273651_154_501 114
158 3300049459 Ga0495678_066260 Ga0495678_066260_95_442 114
159 3300050489 nmdc:mga03683_218253_c1 nmdc:mga03683_218253_c1_125_472 114
160 3300050491 nmdc:mga00v17_4911_c1 nmdc:mga00v17_4911_c1_2378_2725 114
161 3300050496 nmdc:mga07m45_29679_c1 nmdc:mga07m45_29679_c1_2575_2922 114
162 3300050496 nmdc:mga07m45_45093_c1 nmdc:mga07m45_45093_c1_1437_1784 114
163 3300050496 nmdc:mga07m45_622389_c1 nmdc:mga07m45_622389_c1_32_379 114
164 3300050507 nmdc:mga05p37_413371_c1 nmdc:mga05p37_413371_c1_52_399 114
165 3300050512 nmdc:mga0n895_21217_c1 nmdc:mga0n895_21217_c1_3813_4160 114
166 3300050513 nmdc:mga0rr50_16968_c1 nmdc:mga0rr50_16968_c1_990_1337 114
167 3300050515 nmdc:mga0a205_72938_c1 nmdc:mga0a205_72938_c1_1642_1989 114
168 3300050516 nmdc:mga0sz30_14081_c1 nmdc:mga0sz30_14081_c1_1366_1713 114
169 3300053087 Ga0500643_001384 Ga0500643_001384_5522_5881 114
170 3300053087 Ga0500643_006134 Ga0500643_006134_289_636 114
171 3300053094 Ga0500566_0173146 Ga0500566_0173146_574_921 114
172 3300053108 Ga0500562_123811 Ga0500562_123811_79_426 114
173 3300053116 Ga0500592_000331 Ga0500592_000331_5548_5895 114
174 3300053116 Ga0500592_001352 Ga0500592_001352_3220_3567 114
175 3300053116 Ga0500592_011627 Ga0500592_011627_717_1064 114
176 3300053116 Ga0500592_038095 Ga0500592_038095_289_636 114
177 3300053119 Ga0500595_013079 Ga0500595_013079_984_1331 114
178 3300053121 Ga0500607_000354 Ga0500607_000354_2357_2704 114
179 3300053122 Ga0500608_176842 Ga0500608_176842_55_402 114
180 3300053134 Ga0500658_0297617 Ga0500658_0297617_144_491 114
181 3300053136 Ga0500559_0002819 Ga0500559_0002819_2696_3043 114
182 3300053136 Ga0500559_0014454 Ga0500559_0014454_314_661 114
183 3300053139 Ga0500568_0286259 Ga0500568_0286259_26_373 114
184 3300053148 Ga0500590_018765 Ga0500590_018765_1253_1600 114
185 3300053151 Ga0500604_0009641 Ga0500604_0009641_2180_2527 114
186 3300053151 Ga0500604_0011102 Ga0500604_0011102_1862_2209 114
187 3300053151 Ga0500604_0020381 Ga0500604_0020381_1271_1618 114
188 3300053156 Ga0500622_0000145 Ga0500622_0000145_65763_66110 114
189 3300053158 Ga0500627_0000248 Ga0500627_0000248_9080_9427 114
190 3300053158 Ga0500627_0001815 Ga0500627_0001815_5461_5808 114
191 3300053158 Ga0500627_0035313 Ga0500627_0035313_241_588 114
192 3300053158 Ga0500627_0102411 Ga0500627_0102411_704_1051 114
193 3300053158 Ga0500627_0128462 Ga0500627_0128462_145_492 114
194 3300053178 Ga0500637_0088932 Ga0500637_0088932_1115_1462 114
195 3300053727 Ga0500611_082447 Ga0500611_082447_142_489 114
196 3300053727 Ga0500611_180898 Ga0500611_180898_34_381 114
197 3300053730 Ga0500645_001907 Ga0500645_001907_5665_6012 114
198 2162886007 SwRhRL2b_contig_2441221 SwRhRL2b_0324.00004260 115
199 2162886007 SwRhRL2b_contig_323084 SwRhRL2b_0808.00007400 115
200 3300001915 JGI24741J21665_1000004 JGI24741J21665_100000418 115
201 3300001979 JGI24740J21852_10002677 JGI24740J21852_100026776 115
202 3300001989 JGI24739J22299_10002528 JGI24739J22299_100025283 115
203 3300001990 JGI24737J22298_10011343 JGI24737J22298_100113432 115
204 3300003320 rootH2_10141837 rootH2_101418372 115
205 3300003781 Ga0055536_1003303 Ga0055536_100330310 115
206 3300003781 Ga0055536_1014285 Ga0055536_10142854 115
207 3300003791 Ga0055530_10000919 Ga0055530_1000091911 115
208 3300003791 Ga0055530_10035121 Ga0055530_100351212 115
209 3300003794 Ga0055531_10002471 Ga0055531_100024714 115
210 3300003794 Ga0055531_10003687 Ga0055531_1000368711 115
211 3300003794 Ga0055531_10019986 Ga0055531_100199862 115
212 3300005289 Ga0065704_10003246 Ga0065704_100032462 115
213 3300005289 Ga0065704_10094382 Ga0065704_100943823 115
214 3300005289 Ga0065704_10578218 Ga0065704_105782181 115
215 3300005293 Ga0065715_10936461 Ga0065715_109364611 115
216 3300005295 Ga0065707_10426569 Ga0065707_104265692 115
217 3300005327 Ga0070658_10133877 Ga0070658_101338772 115
218 3300005328 Ga0070676_10372175 Ga0070676_103721752 115
219 3300005331 Ga0070670_100099337 Ga0070670_1000993376 115
220 3300005335 Ga0070666_10180138 Ga0070666_101801382 115
221 3300005335 Ga0070666_11010110 Ga0070666_110101102 115
222 3300005337 Ga0070682_100216188 Ga0070682_1002161882 115
223 3300005339 Ga0070660_100175558 Ga0070660_1001755582 115
224 3300005344 Ga0070661_100289961 Ga0070661_1002899612 115
225 3300005347 Ga0070668_100015584 Ga0070668_1000155844 115
226 3300005347 Ga0070668_100730992 Ga0070668_1007309922 115
227 3300005353 Ga0070669_100002141 Ga0070669_10000214115 115
228 3300005353 Ga0070669_100098711 Ga0070669_1000987113 115
229 3300005353 Ga0070669_100102016 Ga0070669_1001020162 115
230 3300005353 Ga0070669_101289253 Ga0070669_1012892532 115
231 3300005355 Ga0070671_100067482 Ga0070671_1000674822 115
232 3300005365 Ga0070688_100467930 Ga0070688_1004679302 115
233 3300005367 Ga0070667_100006854 Ga0070667_1000068544 115
234 3300005367 Ga0070667_100066344 Ga0070667_1000663446 115
235 3300005455 Ga0070663_100081372 Ga0070663_1000813723 115
236 3300005466 Ga0070685_10101437 Ga0070685_101014372 115
237 3300005543 Ga0070672_100544036 Ga0070672_1005440361 115
238 3300005548 Ga0070665_100000319 Ga0070665_1000003194 115
239 3300005548 Ga0070665_100428916 Ga0070665_1004289163 115
240 3300005548 Ga0070665_100665860 Ga0070665_1006658602 115
241 3300005577 Ga0068857_100016822 Ga0068857_1000168222 115
242 3300005577 Ga0068857_100100301 Ga0068857_1001003013 115
243 3300005577 Ga0068857_100102377 Ga0068857_1001023772 115
244 3300005578 Ga0068854_102166982 Ga0068854_1021669821 115
245 3300005614 Ga0068856_100035551 Ga0068856_1000355512 115
246 3300005617 Ga0068859_100043467 Ga0068859_1000434678 115
247 3300005841 Ga0068863_100025408 Ga0068863_1000254084 115
248 3300005842 Ga0068858_100124395 Ga0068858_1001243952 115
249 3300005843 Ga0068860_101722279 Ga0068860_1017222792 115
250 3300005844 Ga0068862_100126653 Ga0068862_1001266535 115
251 3300006042 Ga0075368_10169452 Ga0075368_101694522 115
252 3300006048 Ga0075363_100000964 Ga0075363_1000009642 115
253 3300006051 Ga0075364_10380975 Ga0075364_103809751 115
254 3300006177 Ga0075362_10000316 Ga0075362_1000031616 115
255 3300006186 Ga0075369_10000758 Ga0075369_100007588 115
256 3300006195 Ga0075366_10001276 Ga0075366_100012765 115
257 3300006195 Ga0075366_10314667 Ga0075366_103146672 115
258 3300006353 Ga0075370_10000003 Ga0075370_1000000387 115
259 3300006353 Ga0075370_10377901 Ga0075370_103779011 115
260 3300006931 Ga0097620_100043468 Ga0097620_1000434688 115
261 3300009011 Ga0105251_10004323 Ga0105251_100043239 115
262 3300009093 Ga0105240_11870675 Ga0105240_118706751 115
263 3300009094 Ga0111539_11410162 Ga0111539_114101622 115
264 3300009147 Ga0114129_11336000 Ga0114129_113360002 115
265 3300009174 Ga0105241_10001135 Ga0105241_1000113518 115
266 3300009177 Ga0105248_10030234 Ga0105248_100302345 115
267 3300009177 Ga0105248_10274707 Ga0105248_102747073 115
268 3300009545 Ga0105237_10252425 Ga0105237_102524252 115
269 3300009551 Ga0105238_10148885 Ga0105238_101488853 115
270 3300009551 Ga0105238_10501231 Ga0105238_105012313 115
271 3300009553 Ga0105249_10030728 Ga0105249_100307285 115
272 3300009553 Ga0105249_10032143 Ga0105249_100321435 115
273 3300009978 Ga0105148_100098 Ga0105148_1000989 115
274 3300010375 Ga0105239_10033054 Ga0105239_100330544 115
275 3300010375 Ga0105239_10271857 Ga0105239_102718572 115
276 3300013104 Ga0157370_10177525 Ga0157370_101775253 115
277 3300013105 Ga0157369_10758140 Ga0157369_107581401 115
278 3300013306 Ga0163162_10220636 Ga0163162_102206362 115
279 3300017792 Ga0163161_10014729 Ga0163161_100147293 115
280 3300017792 Ga0163161_10621331 Ga0163161_106213312 115
281 3300025291 Ga0209675_1000169 Ga0209675_10001694 115
282 3300025292 Ga0209676_1000651 Ga0209676_100065132 115
283 3300025292 Ga0209676_1001585 Ga0209676_100158512 115
284 3300025292 Ga0209676_1037032 Ga0209676_10370321 115
285 3300025294 Ga0209025_1016458 Ga0209025_10164584 115
286 3300025294 Ga0209025_1035205 Ga0209025_10352053 115
287 3300025298 Ga0209050_1000310 Ga0209050_100031064 115
288 3300025298 Ga0209050_1008987 Ga0209050_10089877 115
289 3300025302 Ga0207426_1058904 Ga0207426_10589043 115
290 3300025304 Ga0209257_1000113 Ga0209257_1000113220 115
291 3300025304 Ga0209257_1000379 Ga0209257_100037953 115
292 3300025304 Ga0209257_1002330 Ga0209257_100233016 115
293 3300025315 Ga0207697_10237070 Ga0207697_102370701 115
294 3300025321 Ga0207656_10090623 Ga0207656_100906233 115
295 3300025735 Ga0207713_1004001 Ga0207713_10040014 115
296 3300025900 Ga0207710_10078712 Ga0207710_100787122 115
297 3300025903 Ga0207680_10327363 Ga0207680_103273632 115
298 3300025903 Ga0207680_10945417 Ga0207680_109454171 115
299 3300025904 Ga0207647_10011216 Ga0207647_100112166 115
300 3300025909 Ga0207705_10087272 Ga0207705_100872722 115
301 3300025911 Ga0207654_10043696 Ga0207654_100436963 115
302 3300025914 Ga0207671_10551565 Ga0207671_105515652 115
303 3300025919 Ga0207657_10033667 Ga0207657_100336674 115
304 3300025923 Ga0207681_10003128 Ga0207681_100031282 115
305 3300025923 Ga0207681_10150347 Ga0207681_101503472 115
306 3300025924 Ga0207694_10050186 Ga0207694_100501863 115
307 3300025925 Ga0207650_10031851 Ga0207650_100318512 115
308 3300025925 Ga0207650_10371771 Ga0207650_103717713 115
309 3300025931 Ga0207644_10049183 Ga0207644_100491834 115
310 3300025933 Ga0207706_10111538 Ga0207706_101115383 115
311 3300025941 Ga0207711_10016829 Ga0207711_100168294 115
312 3300025941 Ga0207711_10260035 Ga0207711_102600353 115
313 3300025945 Ga0207679_10153593 Ga0207679_101535932 115
314 3300025949 Ga0207667_10117347 Ga0207667_101173472 115
315 3300025961 Ga0207712_10016235 Ga0207712_100162355 115
316 3300025972 Ga0207668_10006745 Ga0207668_100067458 115
317 3300025972 Ga0207668_10751497 Ga0207668_107514972 115
318 3300025981 Ga0207640_11200509 Ga0207640_112005092 115
319 3300025986 Ga0207658_10000753 Ga0207658_100007532 115
320 3300025986 Ga0207658_10024591 Ga0207658_100245916 115
321 3300026035 Ga0207703_10102439 Ga0207703_101024392 115
322 3300026041 Ga0207639_10004953 Ga0207639_100049535 115
323 3300026067 Ga0207678_10000072 Ga0207678_1000007230 115
324 3300026078 Ga0207702_10007238 Ga0207702_100072388 115
325 3300026088 Ga0207641_10008340 Ga0207641_100083407 115
326 3300026088 Ga0207641_10033943 Ga0207641_100339432 115
327 3300026116 Ga0207674_10030576 Ga0207674_100305764 115
328 3300026116 Ga0207674_10030787 Ga0207674_100307871 115
329 3300026116 Ga0207674_10104617 Ga0207674_101046172 115
330 3300026142 Ga0207698_10099047 Ga0207698_100990472 115
331 3300027866 Ga0209813_10222589 Ga0209813_102225892 115
332 3300028379 Ga0268266_10010110 Ga0268266_100101104 115
333 3300028379 Ga0268266_10163693 Ga0268266_101636931 115
334 3300028380 Ga0268265_11183491 Ga0268265_111834911 115
335 3300028380 Ga0268265_12254197 Ga0268265_122541971 115
336 3300028381 Ga0268264_10007902 Ga0268264_100079027 115
337 3300028381 Ga0268264_10983174 Ga0268264_109831741 115
338 3300031456 Ga0307513_10178527 Ga0307513_101785273 115
339 3300031548 Ga0307408_100068726 Ga0307408_1000687261 115
340 3300031731 Ga0307405_10013914 Ga0307405_100139144 115
341 3300031731 Ga0307405_10223713 Ga0307405_102237131 115
342 3300031824 Ga0307413_10230820 Ga0307413_102308202 115
343 3300031852 Ga0307410_10003860 Ga0307410_100038605 115
344 3300031901 Ga0307406_10464606 Ga0307406_104646061 115
345 3300031903 Ga0307407_10204201 Ga0307407_102042012 115
346 3300031911 Ga0307412_10003412 Ga0307412_100034126 115
347 3300031911 Ga0307412_10029631 Ga0307412_100296313 115
348 3300031911 Ga0307412_10458077 Ga0307412_104580772 115
349 3300031911 Ga0307412_11307183 Ga0307412_113071831 115
350 3300032002 Ga0307416_101036733 Ga0307416_1010367332 115
351 3300032004 Ga0307414_10000371 Ga0307414_100003712 115
352 3300032004 Ga0307414_10024523 Ga0307414_100245235 115
353 3300032004 Ga0307414_10036286 Ga0307414_100362863 115
354 3300032004 Ga0307414_10108351 Ga0307414_101083513 115
355 3300032004 Ga0307414_10121153 Ga0307414_101211534 115
356 3300032004 Ga0307414_10199442 Ga0307414_101994422 115
357 3300032004 Ga0307414_10738601 Ga0307414_107386012 115
358 3300032004 Ga0307414_10851153 Ga0307414_108511532 115
359 3300032004 Ga0307414_11133533 Ga0307414_111335331 115
360 3300032005 Ga0307411_10032194 Ga0307411_100321942 115
361 3300032005 Ga0307411_10280310 Ga0307411_102803102 115
362 3300041463 Ga0451804_1104242 Ga0451804_1104242_47_397 115
363 3300041491 Ga0451833_1126812 Ga0451833_1126812_474_824 115
364 3300041505 Ga0451849_0996688 Ga0451849_0996688_103_453 115
365 3300041509 Ga0451843_0447190 Ga0451843_0447190_73_423 115
366 3300041512 Ga0451853_1536320 Ga0451853_1536320_933_1283 115
367 3300044659 Ga0466973_0229625 Ga0466973_0229625_485_835 115
368 3300044694 Ga0466963_0357973 Ga0466963_0357973_254_601 115
369 3300046459 Ga0495629_0361826 Ga0495629_0361826_114_464 115
370 3300046460 Ga0495638_0112500 Ga0495638_0112500_128_478 115
371 3300046501 Ga0495607_0005396 Ga0495607_0005396_294_644 115
372 3300046506 Ga0495583_0241819 Ga0495583_0241819_59_409 115
373 3300046513 Ga0495616_0083335 Ga0495616_0083335_683_1033 115
374 3300046519 Ga0495632_0000382 Ga0495632_0000382_12095_12442 115
375 3300046520 Ga0495637_0033940 Ga0495637_0033940_1842_2189 115
376 3300046520 Ga0495637_0038386 Ga0495637_0038386_742_1092 115
377 3300046522 Ga0495643_0000053 Ga0495643_0000053_190911_191258 115
378 3300046522 Ga0495643_0030674 Ga0495643_0030674_1213_1563 115
379 3300046522 Ga0495643_0095576 Ga0495643_0095576_966_1316 115
380 3300046524 Ga0495648_0054519 Ga0495648_0054519_1545_1892 115
381 3300046525 Ga0495663_0000020 Ga0495663_0000020_10618_10965 115
382 3300046530 Ga0495654_0026577 Ga0495654_0026577_1971_2321 115
383 3300046530 Ga0495654_0276212 Ga0495654_0276212_271_621 115
384 3300046538 Ga0495609_0024585 Ga0495609_0024585_1385_1735 115
385 3300046558 Ga0495633_0002316 Ga0495633_0002316_10261_10608 115
386 3300046558 Ga0495633_0007042 Ga0495633_0007042_2950_3297 115
387 3300046558 Ga0495633_0260450 Ga0495633_0260450_56_403 115
388 3300046616 Ga0495668_0031752 Ga0495668_0031752_1749_2099 115
389 3300046616 Ga0495668_0060940 Ga0495668_0060940_1064_1414 115
390 3300046660 Ga0495625_0000078 Ga0495625_0000078_24337_24687 115
391 3300046660 Ga0495625_0001182 Ga0495625_0001182_17944_18294 115
392 3300046660 Ga0495625_0020888 Ga0495625_0020888_942_1292 115
393 3300046674 Ga0495588_0769571 Ga0495588_0769571_49_399 115
394 3300046684 Ga0495669_0018437 Ga0495669_0018437_1512_1862 115
395 3300046690 Ga0495624_0768419 Ga0495624_0768419_186_536 115
396 3300046691 Ga0495670_0497435 Ga0495670_0497435_40_390 115
397 3300046692 Ga0495671_0000031 Ga0495671_0000031_10774_11121 115
398 3300047321 Ga0495676_0662771 Ga0495676_0662771_261_611 115
399 3300047470 Ga0495681_0046916 Ga0495681_0046916_1666_2013 115
400 3300048090 Ga0495615_0000545 Ga0495615_0000545_557_907 115
401 3300048906 Ga0496103_0021927 Ga0496103_0021927_2022_2372 115
402 3300048908 Ga0496105_1175662 Ga0496105_1175662_54_404 115
403 3300048911 Ga0496108_0003383 Ga0496108_0003383_11587_11934 115
404 3300048913 Ga0496110_0006266 Ga0496110_0006266_3383_3733 115
405 3300048913 Ga0496110_0033573 Ga0496110_0033573_2890_3237 115
406 3300048913 Ga0496110_0554569 Ga0496110_0554569_441_788 115
407 3300048914 Ga0496111_0097183 Ga0496111_0097183_1505_1852 115
408 3300048914 Ga0496111_1343791 Ga0496111_1343791_120_470 115
409 3300048916 Ga0496113_0162419 Ga0496113_0162419_20_367 115
410 3300048919 Ga0496116_0048154 Ga0496116_0048154_1591_1941 115
411 3300048919 Ga0496116_0166456 Ga0496116_0166456_674_1021 115
412 3300048920 Ga0496117_0105998 Ga0496117_0105998_807_1157 115
413 3300048921 Ga0496118_0270473 Ga0496118_0270473_518_868 115
414 3300048921 Ga0496118_0619149 Ga0496118_0619149_85_435 115
415 3300048922 Ga0496119_0025296 Ga0496119_0025296_2211_2561 115
416 3300048924 Ga0496121_0001861 Ga0496121_0001861_18124_18471 115
417 3300048924 Ga0496121_0006621 Ga0496121_0006621_4908_5258 115
418 3300048924 Ga0496121_0141459 Ga0496121_0141459_1233_1583 115
419 3300048925 Ga0496122_0016810 Ga0496122_0016810_5585_5935 115
420 3300048925 Ga0496122_0035654 Ga0496122_0035654_685_1035 115
421 3300048925 Ga0496122_0092215 Ga0496122_0092215_1536_1886 115
422 3300048925 Ga0496122_0146809 Ga0496122_0146809_62_409 115
423 3300048925 Ga0496122_0205647 Ga0496122_0205647_449_796 115
424 3300048926 Ga0496123_0000877 Ga0496123_0000877_4410_4760 115
425 3300048926 Ga0496123_0048931 Ga0496123_0048931_86_436 115
426 3300048927 Ga0496124_0016769 Ga0496124_0016769_63_413 115
427 3300048927 Ga0496124_0059849 Ga0496124_0059849_1813_2160 115
428 3300048927 Ga0496124_0284819 Ga0496124_0284819_151_501 115
429 3300048928 Ga0496125_0000335 Ga0496125_0000335_25128_25478 115
430 3300048928 Ga0496125_0009669 Ga0496125_0009669_708_1055 115
431 3300048928 Ga0496125_0308009 Ga0496125_0308009_494_844 115
432 3300048928 Ga0496125_0483072 Ga0496125_0483072_229_579 115
433 3300048928 Ga0496125_0618932 Ga0496125_0618932_169_519 115
434 3300048928 Ga0496125_0618941 Ga0496125_0618941_23_370 115
435 3300048929 Ga0496126_0030384 Ga0496126_0030384_1102_1452 115
436 3300048929 Ga0496126_0094985 Ga0496126_0094985_189_539 115
437 3300048929 Ga0496126_0185685 Ga0496126_0185685_648_995 115
438 3300048929 Ga0496126_1023560 Ga0496126_1023560_257_607 115
439 3300049513 Ga0501290_066228 Ga0501290_066228_162_512 115
440 3300049572 Ga0501036_0028055 Ga0501036_0028055_3718_4068 115
441 3300049573 Ga0501037_0498883 Ga0501037_0498883_239_589 115
442 3300049581 Ga0501047_0235122 Ga0501047_0235122_259_609 115
443 3300049581 Ga0501047_0408754 Ga0501047_0408754_183_533 115
444 3300049585 Ga0501069_0148394 Ga0501069_0148394_690_1037 115
445 3300049658 Ga0501211_004172 Ga0501211_004172_193_543 115
446 3300049669 Ga0501235_001424 Ga0501235_001424_1624_1974 115
447 3300049705 Ga0501225_0004445 Ga0501225_0004445_658_1008 115
448 3300049708 Ga0501245_001360 Ga0501245_001360_1952_2302 115
449 3300049759 Ga0501262_012680 Ga0501262_012680_289_639 115
450 3300049822 Ga0501035_0700531 Ga0501035_0700531_190_540 115
451 3300049823 Ga0501044_0112215 Ga0501044_0112215_301_651 115
452 3300049823 Ga0501044_0644196 Ga0501044_0644196_478_828 115
453 3300050489 nmdc:mga03683_30_c1 nmdc:mga03683_30_c1_40699_41049 115
454 3300050490 nmdc:mga03n38_7788_c1 nmdc:mga03n38_7788_c1_2106_2456 115
455 3300050493 nmdc:mga0k408_3_c1 nmdc:mga0k408_3_c1_191513_191863 115
456 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_55059_55409 115
457 3300050511 nmdc:mga08y16_1004924_c1 nmdc:mga08y16_1004924_c1_67_417 115
458 3300050516 nmdc:mga0sz30_186_c1 nmdc:mga0sz30_186_c1_5656_6006 115
459 3300053086 Ga0500578_0223118 Ga0500578_0223118_388_738 115
460 3300053087 Ga0500643_003779 Ga0500643_003779_6080_6430 115
461 3300053088 Ga0500644_0451831 Ga0500644_0451831_62_412 115
462 3300053091 Ga0500647_0201854 Ga0500647_0201854_43_393 115
463 3300053092 Ga0500583_0440190 Ga0500583_0440190_123_473 115
464 3300053093 Ga0500651_0008800 Ga0500651_0008800_5043_5393 115
465 3300053093 Ga0500651_0017977 Ga0500651_0017977_3953_4303 115
466 3300053094 Ga0500566_0406814 Ga0500566_0406814_41_391 115
467 3300053096 Ga0500641_0037228 Ga0500641_0037228_596_946 115
468 3300053103 Ga0500555_037030 Ga0500555_037030_149_499 115
469 3300053104 Ga0500556_0088273 Ga0500556_0088273_401_751 115
470 3300053116 Ga0500592_001009 Ga0500592_001009_4122_4472 115
471 3300053119 Ga0500595_000936 Ga0500595_000936_12534_12884 115
472 3300053130 Ga0500642_0001579 Ga0500642_0001579_4801_5151 115
473 3300053134 Ga0500658_0088052 Ga0500658_0088052_114_464 115
474 3300053142 Ga0500577_0043828 Ga0500577_0043828_719_1069 115
475 3300053148 Ga0500590_000500 Ga0500590_000500_7222_7572 115
476 3300053156 Ga0500622_0030530 Ga0500622_0030530_694_1044 115
477 3300053156 Ga0500622_0109387 Ga0500622_0109387_620_970 115
478 3300053158 Ga0500627_0000009 Ga0500627_0000009_121312_121662 115
479 3300053163 Ga0500639_028351 Ga0500639_028351_717_1067 115
480 3300053177 Ga0500636_0246809 Ga0500636_0246809_529_879 115
481 3300053724 Ga0500570_000502 Ga0500570_000502_7823_8173 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

33

113

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8314 4 108
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8036 4 108
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7591 2 106
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.75 1 102
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6941 2 106
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9117 5 114 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8825 4 113 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8734 5 113 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.867 5 114 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8483 3 103 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A2T4I0X0-F1-model_v4 Aldehyde-activating protein 0.9795 3 115 GO:0016846
GO:0046872
AF-A0A7T9ETF6-F1-model_v4 deleted 0.965 1 115
AF-A0A1I2IVM6-F1-model_v4 Uncharacterized conserved protein 0.964 3 115 GO:0016846
GO:0046872
AF-A0A2S0MFN4-F1-model_v4 Aldehyde-activating protein 0.9635 3 115 GO:0016846
GO:0046872
AF-A0A0K1Q3M0-F1-model_v4 Gfa-like protein 0.9627 1 115 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map