F452362

General Info

Members Datasets Scaffolds Average Seq Length
481 286 481 238

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100561769|Ga0070671_1005617691
Length 262
Sequence MPPFGRRPLGARQSMLIAMRLEGKRALVTGGASGIGAAIAARLAAEGAEVWVGDVYVAGAEKVAAEIAGHALELDVTDLAAAEAAIEAIGSPQILINNAGTAEFGFFTQTTPQQWQRVIAINLVGVLNCTYAALPGMQHAGYGRIVSISSEAGRVGSKGSAVYSAAKGGVVAFMKTIARENGRYGVTANSIAPGPIETPLLMGAKDLGEVGEKLIENMKGTTQLGRLGQPDEVAAAAAFLASDDATFVTGETLGVSGGLGMV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 9.36
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000071 3300001977 Bacteria 10770
2 JGI24742J22300_10001747 3300002244 Bacteria 3466
3 JGI24751J29686_10026938 3300002459 Bacteria 1193
4 JGI25404J52841_10015215 3300003659 Bacteria 1670
5 Ga0070683_100000411 3300005329 Bacteria 29635
6 Ga0070683_100005875 3300005329 Bacteria 10272
7 Ga0070683_100033949 3300005329 Bacteria 4656
8 Ga0070677_10000103 3300005333 Bacteria 27983
9 Ga0070666_10011653 3300005335 Bacteria 5526
10 Ga0070682_100000099 3300005337 Bacteria 77574
11 Ga0068868_100000450 3300005338 Bacteria 27515
12 Ga0070691_10000027 3300005341 Bacteria 40642
13 Ga0070661_100000102 3300005344 Bacteria 69941
14 Ga0070675_100000027 3300005354 Bacteria 106172
15 Ga0070671_100561769 3300005355 Bacteria 984
16 Ga0070674_100000017 3300005356 Bacteria 90884
17 Ga0070674_100000090 3300005356 Bacteria 42115
18 Ga0070673_100008824 3300005364 Bacteria 6732
19 Ga0070688_100000393 3300005365 Bacteria 22156
20 Ga0070659_100292007 3300005366 Bacteria 1358
21 Ga0070659_100390562 3300005366 Bacteria 1173
22 Ga0070667_100003553 3300005367 Bacteria 13289
23 Ga0070667_100008067 3300005367 Bacteria 8736
24 Ga0070667_100027060 3300005367 Bacteria 4770
25 Ga0070714_100135464 3300005435 Bacteria 2205
26 Ga0070714_100408890 3300005435 Bacteria 1284
27 Ga0070678_100070440 3300005456 Bacteria 2614
28 Ga0070662_100000004 3300005457 Bacteria 195534
29 Ga0070681_10411564 3300005458 Bacteria 1264
30 Ga0070681_10443439 3300005458 Bacteria 1210
31 Ga0068867_100000796 3300005459 Bacteria 21356
32 Ga0070685_10000141 3300005466 Bacteria 46333
33 Ga0070685_10000616 3300005466 Bacteria 19644
34 Ga0070679_100000243 3300005530 Bacteria 45435
35 Ga0070679_100005498 3300005530 Bacteria 11742
36 Ga0070684_100083112 3300005535 Bacteria 2837
37 Ga0070684_100153886 3300005535 Bacteria 2084
38 Ga0070684_100322996 3300005535 Bacteria 1418
39 Ga0068853_100327195 3300005539 Bacteria 1422
40 Ga0070672_100000087 3300005543 Bacteria 44462
41 Ga0070686_100182310 3300005544 Bacteria 1493
42 Ga0070693_100000847 3300005547 Bacteria 13634
43 Ga0070665_100000106 3300005548 Bacteria 157315
44 Ga0070665_100000950 3300005548 Bacteria 36935
45 Ga0070665_100004145 3300005548 Bacteria 15248
46 Ga0070665_100245776 3300005548 Bacteria 1790
47 Ga0070665_100322541 3300005548 Bacteria 1549
48 Ga0070704_100361845 3300005549 Bacteria 1228
49 Ga0070664_100181247 3300005564 Bacteria 1872
50 Ga0068854_100001172 3300005578 Bacteria 15711
51 Ga0068856_100000629 3300005614 Bacteria 38394
52 Ga0068856_100069173 3300005614 Bacteria 3491
53 Ga0068856_100074910 3300005614 Bacteria 3352
54 Ga0068852_100000006 3300005616 Bacteria 159569
55 Ga0068866_10000001 3300005718 Bacteria 519680
56 Ga0068866_10000685 3300005718 Bacteria 15430
57 Ga0068866_10029022 3300005718 Bacteria 2641
58 Ga0068851_10002310 3300005834 Bacteria 8395
59 Ga0068851_10010835 3300005834 Bacteria 4261
60 Ga0068863_100000342 3300005841 Bacteria 47536
61 Ga0068858_100000009 3300005842 Bacteria 237748
62 Ga0068860_100036483 3300005843 Bacteria 4710
63 Ga0068860_100310380 3300005843 Bacteria 1546
64 Ga0068862_100024549 3300005844 Bacteria 5059
65 Ga0081455_10017352 3300005937 Bacteria 6906
66 Ga0081455_10019749 3300005937 Bacteria 6365
67 Ga0081455_10091044 3300005937 Bacteria 2471
68 Ga0081455_10342797 3300005937 Bacteria 1057
69 Ga0081538_10030513 3300005981 Bacteria 3658
70 Ga0081540_1000163 3300005983 Bacteria 68955
71 Ga0081540_1019158 3300005983 Bacteria 4171
72 Ga0081539_10026881 3300005985 Bacteria 3658
73 Ga0070715_10000001 3300006163 Bacteria 693690
74 Ga0070712_100142519 3300006175 Bacteria 1831
75 Ga0068871_100480837 3300006358 Bacteria 1117
76 Ga0075428_100355918 3300006844 Bacteria 1571
77 Ga0075430_100009324 3300006846 Bacteria 8297
78 Ga0075430_100023451 3300006846 Bacteria 5253
79 Ga0075431_100000536 3300006847 Bacteria 31867
80 Ga0075431_100040061 3300006847 Bacteria 4828
81 Ga0075431_100042964 3300006847 Bacteria 4663
82 Ga0075431_100143555 3300006847 Bacteria 2460
83 Ga0075433_10000900 3300006852 Bacteria 20958
84 Ga0075433_10034271 3300006852 Bacteria 4359
85 Ga0075434_100013735 3300006871 Bacteria 7722
86 Ga0075429_100004332 3300006880 Bacteria 12189
87 Ga0068865_100000023 3300006881 Bacteria 100785
88 Ga0075435_100385473 3300007076 Bacteria 1204
89 Ga0111539_10004345 3300009094 Bacteria 18557
90 Ga0111539_10129291 3300009094 Bacteria 2957
91 Ga0111539_10169453 3300009094 Bacteria 2551
92 Ga0111539_10774614 3300009094 Bacteria 1117
93 Ga0105245_10000020 3300009098 Bacteria 181774
94 Ga0105245_10000254 3300009098 Bacteria 50918
95 Ga0105245_10015858 3300009098 Bacteria 6564
96 Ga0105247_10000316 3300009101 Bacteria 43374
97 Ga0114129_10051723 3300009147 Bacteria 5767
98 Ga0114129_10097421 3300009147 Bacteria 4072
99 Ga0114129_10526991 3300009147 Bacteria 1540
100 Ga0105242_10113913 3300009176 Bacteria 2310
101 Ga0105248_10000008 3300009177 Bacteria 403910
102 Ga0105237_10102097 3300009545 Bacteria 2860
103 Ga0105238_10000011 3300009551 Bacteria 261080
104 Ga0105249_10000080 3300009553 Bacteria 138080
105 Ga0105249_10002533 3300009553 Bacteria 15810
106 Ga0105249_10145323 3300009553 Bacteria 2278
107 Ga0105239_10364266 3300010375 Bacteria 1633
108 Ga0105246_10376168 3300011119 Bacteria 1172
109 Ga0157370_10004542 3300013104 Bacteria 15899
110 Ga0157370_10227189 3300013104 Bacteria 1728
111 Ga0157369_10000020 3300013105 Bacteria 241679
112 Ga0157369_10458545 3300013105 Bacteria 1320
113 Ga0157374_10001772 3300013296 Bacteria 18163
114 Ga0157374_10096749 3300013296 Bacteria 2824
115 Ga0157374_10185757 3300013296 Bacteria 2032
116 Ga0157378_10013002 3300013297 Bacteria 7282
117 Ga0157378_10140283 3300013297 Bacteria 2244
118 Ga0163162_10433860 3300013306 Bacteria 1446
119 Ga0157372_10689686 3300013307 Bacteria 1189
120 Ga0157375_10001213 3300013308 Bacteria 22205
121 Ga0157375_10001538 3300013308 Bacteria 19849
122 Ga0157375_10486598 3300013308 Bacteria 1399
123 Ga0163163_10227094 3300014325 Bacteria 1916
124 Ga0163163_10761582 3300014325 Bacteria 1031
125 Ga0157380_10007734 3300014326 Bacteria 7650
126 Ga0157379_10027346 3300014968 Bacteria 5078
127 Ga0157379_10032581 3300014968 Bacteria 4646
128 Ga0157376_10048384 3300014969 Bacteria 3515
129 Ga0163161_10000021 3300017792 Bacteria 208779
130 Ga0163161_10180860 3300017792 Bacteria 1617
131 Ga0206354_11214690 3300020081 Bacteria 957
132 Ga0207656_10002384 3300025321 Bacteria 6318
133 Ga0207656_10009236 3300025321 Bacteria 3658
134 Ga0207682_10000005 3300025893 Bacteria 95617
135 Ga0207692_10174815 3300025898 Bacteria 1247
136 Ga0207642_10000002 3300025899 Bacteria 658166
137 Ga0207642_10000281 3300025899 Bacteria 15233
138 Ga0207642_10055639 3300025899 Bacteria 1811
139 Ga0207710_10059383 3300025900 Bacteria 1731
140 Ga0207680_10091384 3300025903 Bacteria 1937
141 Ga0207680_10139551 3300025903 Bacteria 1606
142 Ga0207685_10000027 3300025905 Bacteria 102101
143 Ga0207705_10048298 3300025909 Bacteria 3061
144 Ga0207707_10222372 3300025912 Bacteria 1643
145 Ga0207707_10373437 3300025912 Bacteria 1227
146 Ga0207671_10374382 3300025914 Bacteria 1131
147 Ga0207693_10108715 3300025915 Bacteria 2175
148 Ga0207663_10000498 3300025916 Bacteria 17164
149 Ga0207649_10000009 3300025920 Bacteria 295544
150 Ga0207652_10001781 3300025921 Bacteria 18749
151 Ga0207652_10002027 3300025921 Bacteria 17455
152 Ga0207694_10000004 3300025924 Bacteria 967075
153 Ga0207659_10000010 3300025926 Bacteria 286639
154 Ga0207687_10000007 3300025927 Bacteria 604185
155 Ga0207687_10000013 3300025927 Bacteria 299826
156 Ga0207664_10361634 3300025929 Bacteria 1286
157 Ga0207690_10100446 3300025932 Bacteria 2065
158 Ga0207690_10212376 3300025932 Bacteria 1476
159 Ga0207706_10000012 3300025933 Bacteria 195475
160 Ga0207709_10137792 3300025935 Bacteria 1673
161 Ga0207670_10229170 3300025936 Bacteria 1426
162 Ga0207669_10000001 3300025937 Bacteria 377747
163 Ga0207669_10000096 3300025937 Bacteria 44213
164 Ga0207669_10222963 3300025937 Bacteria 1385
165 Ga0207704_10000159 3300025938 Bacteria 36005
166 Ga0207691_10000382 3300025940 Bacteria 44447
167 Ga0207711_10000006 3300025941 Bacteria 792692
168 Ga0207661_10000253 3300025944 Bacteria 34627
169 Ga0207661_10000347 3300025944 Bacteria 29715
170 Ga0207661_10096655 3300025944 Bacteria 2472
171 Ga0207661_10238729 3300025944 Bacteria 1612
172 Ga0207679_10011503 3300025945 Bacteria 5735
173 Ga0207667_10328477 3300025949 Bacteria 1562
174 Ga0207651_10118100 3300025960 Bacteria 2005
175 Ga0207712_10000007 3300025961 Bacteria 539589
176 Ga0207712_10008481 3300025961 Bacteria 6498
177 Ga0207640_10003326 3300025981 Bacteria 8658
178 Ga0207658_10006842 3300025986 Bacteria 7770
179 Ga0207658_10008055 3300025986 Bacteria 7179
180 Ga0207658_10116136 3300025986 Bacteria 2125
181 Ga0207677_10000200 3300026023 Bacteria 48320
182 Ga0207703_10000018 3300026035 Bacteria 271377
183 Ga0207703_10000023 3300026035 Bacteria 222018
184 Ga0207639_10010573 3300026041 Bacteria 6393
185 Ga0207678_10001753 3300026067 Bacteria 19870
186 Ga0207702_10000158 3300026078 Bacteria 79984
187 Ga0207702_10004125 3300026078 Bacteria 13025
188 Ga0207702_10016358 3300026078 Bacteria 6141
189 Ga0207641_10000238 3300026088 Bacteria 71152
190 Ga0207648_10004426 3300026089 Bacteria 14414
191 Ga0207676_10000195 3300026095 Bacteria 52951
192 Ga0207683_10065768 3300026121 Bacteria 3197
193 Ga0207683_10391523 3300026121 Bacteria 1278
194 Ga0207698_10000013 3300026142 Bacteria 255414
195 Ga0207428_10067434 3300027907 Bacteria 2817
196 Ga0268266_10000047 3300028379 Bacteria 310996
197 Ga0268266_10000595 3300028379 Bacteria 49517
198 Ga0268266_10000912 3300028379 Bacteria 38037
199 Ga0268266_10043596 3300028379 Bacteria 3835
200 Ga0268266_10715194 3300028379 Bacteria 966
201 Ga0268265_10079743 3300028380 Bacteria 2579
202 Ga0268264_10027150 3300028381 Bacteria 4676
203 Ga0265337_1000807 3300028556 Bacteria 16498
204 Ga0265326_10000063 3300028558 Bacteria 61665
205 Ga0265319_1000020 3300028563 Bacteria 153921
206 Ga0265322_10000001 3300028654 Bacteria 543854
207 Ga0265336_10012722 3300028666 Bacteria 2824
208 Ga0265338_10000222 3300028800 Bacteria 105765
209 Ga0265338_10277004 3300028800 Bacteria 1227
210 Ga0265324_10000755 3300029957 Bacteria 21443
211 Ga0265332_10007328 3300031238 Bacteria 4990
212 Ga0265328_10004755 3300031239 Bacteria 5865
213 Ga0265320_10000002 3300031240 Bacteria 542875
214 Ga0265325_10003811 3300031241 Bacteria 9722
215 Ga0265339_10018762 3300031249 Bacteria 4073
216 Ga0265331_10002295 3300031250 Bacteria 13036
217 Ga0265327_10000011 3300031251 Bacteria 543807
218 Ga0265316_10030052 3300031344 Bacteria 4460
219 Ga0307513_10444056 3300031456 Bacteria 1023
220 Ga0265314_10000062 3300031711 Bacteria 159496
221 Ga0307409_100791860 3300031995 Bacteria 955
222 Ga0307416_100860939 3300032002 Bacteria 1005
223 Ga0307415_100003131 3300032126 Bacteria 8381
224 Ga0373957_0048693 3300035120 Bacteria 1616
225 Ga0373955_0209037 3300035172 Bacteria 1163
226 Ga0373933_0205492 3300035724 Bacteria 1261
227 Ga0373937_0024047 3300036401 Bacteria 5493
228 Ga0373937_0162767 3300036401 Bacteria 2092
229 Ga0395899_0296856 3300037312 Bacteria 1095
230 Ga0395900_0010300 3300037418 Bacteria 9566
231 Ga0395900_0175051 3300037418 Bacteria 2183
232 Ga0395898_0001408 3300037466 Bacteria 34249
233 Ga0395898_0007911 3300037466 Bacteria 11280
234 Ga0395905_0003057 3300037471 Bacteria 18119
235 Ga0395901_0001723 3300038443 Bacteria 22589
236 Ga0395901_0044457 3300038443 Bacteria 4607
237 Ga0451800_0682346 3300041459 Bacteria 1024
238 Ga0466963_0000105 3300044694 Bacteria 30285
239 Ga0466963_0046051 3300044694 Bacteria 2875
240 Ga0466963_0394914 3300044694 Bacteria 975
241 Ga0466967_0000015 3300045976 Bacteria 99105
242 Ga0466967_0170005 3300045976 Bacteria 2050
243 Ga0495592_0021098 3300046454 Bacteria 4953
244 Ga0495592_0062726 3300046454 Bacteria 2728
245 Ga0495592_0220241 3300046454 Bacteria 1269
246 Ga0495592_0407217 3300046454 Bacteria 860
247 Ga0495603_0001389 3300046455 Bacteria 14063
248 Ga0495603_0001462 3300046455 Bacteria 13743
249 Ga0495603_0004794 3300046455 Bacteria 8082
250 Ga0495629_0435162 3300046459 Bacteria 889
251 Ga0495638_0026746 3300046460 Bacteria 3739
252 Ga0495641_0000228 3300046461 Bacteria 43671
253 Ga0495641_0054490 3300046461 Bacteria 1817
254 Ga0495641_0064403 3300046461 Bacteria 1651
255 Ga0495653_0019096 3300046463 Bacteria 5562
256 Ga0495653_0019236 3300046463 Bacteria 5538
257 Ga0495653_0282533 3300046463 Bacteria 1089
258 Ga0495582_0000726 3300046473 Bacteria 18153
259 Ga0495662_0004260 3300046476 Bacteria 7201
260 Ga0495594_0000029 3300046499 Bacteria 66789
261 Ga0495608_0000222 3300046511 Bacteria 41114
262 Ga0495618_0000008 3300046514 Bacteria 204578
263 Ga0495618_0260440 3300046514 Bacteria 1086
264 Ga0495620_0000995 3300046515 Bacteria 17517
265 Ga0495628_0008516 3300046516 Bacteria 8789
266 Ga0495628_0016259 3300046516 Bacteria 6208
267 Ga0495628_0192792 3300046516 Bacteria 1538
268 Ga0495630_0000121 3300046517 Bacteria 61852
269 Ga0495630_0020713 3300046517 Bacteria 4851
270 Ga0495630_0087917 3300046517 Bacteria 2347
271 Ga0495630_0548762 3300046517 Bacteria 886
272 Ga0495644_0000630 3300046523 Bacteria 14753
273 Ga0495644_0102543 3300046523 Bacteria 1083
274 Ga0495663_0029152 3300046525 Bacteria 1628
275 Ga0495652_0000407 3300046529 Bacteria 50232
276 Ga0495640_0020192 3300046533 Bacteria 4907
277 Ga0495586_0032410 3300046535 Bacteria 2801
278 Ga0495587_0028219 3300046536 Bacteria 3414
279 Ga0495587_0049993 3300046536 Bacteria 2474
280 Ga0495587_0327013 3300046536 Bacteria 856
281 Ga0495598_0007458 3300046537 Bacteria 2511
282 Ga0495621_0018311 3300046539 Bacteria 2273
283 Ga0495645_0095649 3300046543 Bacteria 2117
284 Ga0495622_0000789 3300046557 Bacteria 17646
285 Ga0495667_0000018 3300046559 Bacteria 188610
286 Ga0495656_0001289 3300046615 Bacteria 8153
287 Ga0495634_0000059 3300046642 Bacteria 88314
288 Ga0495634_0018299 3300046642 Bacteria 4990
289 Ga0495625_0000171 3300046660 Bacteria 101895
290 Ga0495635_0000062 3300046663 Bacteria 65631
291 Ga0495635_0254930 3300046663 Bacteria 1182
292 Ga0495588_0000134 3300046674 Bacteria 117581
293 Ga0495657_0255540 3300046675 Bacteria 1054
294 Ga0495599_0057672 3300046678 Bacteria 2430
295 Ga0495646_0125474 3300046680 Bacteria 1449
296 Ga0495647_0000017 3300046681 Bacteria 83387
297 Ga0495658_0000034 3300046683 Bacteria 69176
298 Ga0495669_0000310 3300046684 Bacteria 26921
299 Ga0495613_0000124 3300046689 Bacteria 75971
300 Ga0495613_0000674 3300046689 Bacteria 26995
301 Ga0495613_0175400 3300046689 Bacteria 1520
302 Ga0495613_0342476 3300046689 Bacteria 1028
303 Ga0495624_0001256 3300046690 Bacteria 20032
304 Ga0495670_0027781 3300046691 Bacteria 2805
305 Ga0495649_0004181 3300046694 Bacteria 9473
306 Ga0495600_0001066 3300046809 Bacteria 14880
307 Ga0495600_0009557 3300046809 Bacteria 5995
308 Ga0495581_0030089 3300047315 Bacteria 3148
309 Ga0495604_0000055 3300047317 Bacteria 100430
310 Ga0495604_0003861 3300047317 Bacteria 11937
311 Ga0495674_0000064 3300047319 Bacteria 71275
312 Ga0495672_0025151 3300047320 Bacteria 3818
313 Ga0495672_0169658 3300047320 Bacteria 1114
314 Ga0495676_0000130 3300047321 Bacteria 56693
315 Ga0495676_0025700 3300047321 Bacteria 5080
316 Ga0495676_0322193 3300047321 Bacteria 1038
317 Ga0495680_0002282 3300047322 Bacteria 19745
318 Ga0495680_0016125 3300047322 Bacteria 6424
319 Ga0495680_0402734 3300047322 Bacteria 944
320 Ga0495680_0453070 3300047322 Bacteria 878
321 Ga0495675_0172649 3300047444 Bacteria 1327
322 Ga0495679_012724 3300047446 Bacteria 3188
323 Ga0495686_0054323 3300047472 Bacteria 2508
324 Ga0495593_0122939 3300047673 Bacteria 1320
325 Ga0495602_0001349 3300048088 Bacteria 24226
326 Ga0495602_0071241 3300048088 Bacteria 2969
327 Ga0495614_0014178 3300048089 Bacteria 3493
328 Ga0496100_0000002 3300048903 Bacteria 489057
329 Ga0496100_0000005 3300048903 Bacteria 312112
330 Ga0496101_0000001 3300048904 Bacteria 489057
331 Ga0496101_0000101 3300048904 Bacteria 89424
332 Ga0496102_0003911 3300048905 Bacteria 12617
333 Ga0496103_0035998 3300048906 Bacteria 3031
334 Ga0496103_0057594 3300048906 Bacteria 2413
335 Ga0496103_0154501 3300048906 Bacteria 1470
336 Ga0496104_0000004 3300048907 Bacteria 641830
337 Ga0496104_0000009 3300048907 Bacteria 488055
338 Ga0496104_0000190 3300048907 Bacteria 55572
339 Ga0496105_0000001 3300048908 Bacteria 1328178
340 Ga0496105_0000007 3300048908 Bacteria 339658
341 Ga0496105_0054866 3300048908 Bacteria 3290
342 Ga0496105_0092816 3300048908 Bacteria 2492
343 Ga0496106_0000084 3300048909 Bacteria 74135
344 Ga0496106_0000151 3300048909 Bacteria 51430
345 Ga0496106_0119979 3300048909 Bacteria 2055
346 Ga0496106_0352840 3300048909 Bacteria 1182
347 Ga0496107_0000003 3300048910 Bacteria 304038
348 Ga0496107_0000011 3300048910 Bacteria 201631
349 Ga0496107_0092369 3300048910 Bacteria 2213
350 Ga0496107_0182721 3300048910 Bacteria 1557
351 Ga0496108_0000001 3300048911 Bacteria 919044
352 Ga0496108_0000587 3300048911 Bacteria 28462
353 Ga0496108_0006431 3300048911 Bacteria 9524
354 Ga0496109_0000003 3300048912 Bacteria 420862
355 Ga0496109_0001118 3300048912 Bacteria 22284
356 Ga0496110_0000021 3300048913 Bacteria 77064
357 Ga0496110_0016388 3300048913 Bacteria 6188
358 Ga0496110_0029190 3300048913 Bacteria 4744
359 Ga0496111_0000009 3300048914 Bacteria 93943
360 Ga0496111_0098241 3300048914 Bacteria 2150
361 Ga0496111_0113869 3300048914 Bacteria 1993
362 Ga0496112_0000006 3300048915 Bacteria 365227
363 Ga0496112_0198200 3300048915 Bacteria 1968
364 Ga0496112_0323340 3300048915 Bacteria 1487
365 Ga0496112_0399150 3300048915 Bacteria 1315
366 Ga0496113_0054719 3300048916 Bacteria 2988
367 Ga0496113_0240534 3300048916 Bacteria 1444
368 Ga0496114_0009597 3300048917 Bacteria 7688
369 Ga0496114_0234374 3300048917 Bacteria 1613
370 Ga0496115_0000003 3300048918 Bacteria 354994
371 Ga0496115_0028569 3300048918 Bacteria 4373
372 Ga0496116_0000735 3300048919 Bacteria 41771
373 Ga0496117_0016612 3300048920 Bacteria 6198
374 Ga0496118_0000833 3300048921 Bacteria 49030
375 Ga0496118_0095828 3300048921 Bacteria 2024
376 Ga0496119_0001290 3300048922 Bacteria 30949
377 Ga0496119_0033172 3300048922 Bacteria 3428
378 Ga0496119_0041797 3300048922 Bacteria 2914
379 Ga0496120_0014960 3300048923 Bacteria 5140
380 Ga0496120_0028190 3300048923 Bacteria 3443
381 Ga0496121_0252630 3300048924 Bacteria 1222
382 Ga0496124_0023648 3300048927 Bacteria 5606
383 Ga0496125_0044444 3300048928 Bacteria 3757
384 Ga0496126_0007040 3300048929 Bacteria 12406
385 Ga0496126_0048803 3300048929 Bacteria 3866
386 Ga0501031_0009252 3300049568 Bacteria 6401
387 Ga0501032_0000965 3300049569 Bacteria 23261
388 Ga0501033_0000900 3300049570 Bacteria 27183
389 Ga0501034_0080673 3300049571 Bacteria 3256
390 Ga0501036_0001844 3300049572 Bacteria 16440
391 Ga0501037_0002603 3300049573 Bacteria 13022
392 Ga0501038_0006062 3300049574 Bacteria 11182
393 Ga0501038_0132169 3300049574 Bacteria 2048
394 Ga0501039_0011207 3300049575 Bacteria 6832
395 Ga0501040_0066761 3300049576 Bacteria 2478
396 Ga0501040_0138465 3300049576 Bacteria 1714
397 Ga0501040_0215095 3300049576 Bacteria 1367
398 Ga0501042_0020286 3300049578 Bacteria 4625
399 Ga0501042_0051097 3300049578 Bacteria 2949
400 Ga0501042_0061140 3300049578 Bacteria 2691
401 Ga0501043_0004468 3300049579 Bacteria 11360
402 Ga0501046_0000702 3300049580 Bacteria 32344
403 Ga0501047_0009430 3300049581 Bacteria 9222
404 Ga0501047_0012322 3300049581 Bacteria 8094
405 Ga0501047_0146787 3300049581 Bacteria 2235
406 Ga0501047_0227146 3300049581 Bacteria 1721
407 Ga0501048_0000888 3300049582 Bacteria 22108
408 Ga0501048_0243478 3300049582 Bacteria 1276
409 Ga0501048_0398073 3300049582 Bacteria 984
410 Ga0501048_0469396 3300049582 Bacteria 902
411 Ga0501067_0047244 3300049583 Bacteria 2388
412 Ga0501068_0005996 3300049584 Bacteria 6674
413 Ga0501068_0171192 3300049584 Bacteria 1371
414 Ga0501069_0000880 3300049585 Bacteria 14316
415 Ga0501070_0000680 3300049586 Bacteria 31108
416 Ga0501070_0005582 3300049586 Bacteria 10731
417 Ga0501070_0046829 3300049586 Bacteria 3596
418 Ga0501070_0053684 3300049586 Bacteria 3342
419 Ga0501070_0065276 3300049586 Bacteria 3013
420 Ga0501070_0130458 3300049586 Bacteria 2076
421 Ga0501072_0008345 3300049588 Bacteria 7867
422 Ga0501072_0020950 3300049588 Bacteria 5068
423 Ga0501073_0006128 3300049589 Bacteria 8974
424 Ga0501074_0015768 3300049590 Bacteria 5493
425 Ga0501075_0001068 3300049591 Bacteria 17616
426 Ga0501075_0015147 3300049591 Bacteria 5530
427 Ga0501075_0033895 3300049591 Bacteria 3800
428 Ga0501075_0210589 3300049591 Bacteria 1483
429 Ga0501076_0053222 3300049592 Bacteria 3207
430 Ga0501077_0189215 3300049593 Bacteria 1307
431 Ga0501079_0051849 3300049741 Bacteria 3168
432 Ga0501080_0058430 3300049742 Bacteria 3590
433 Ga0501081_0041306 3300049743 Bacteria 3158
434 Ga0501081_0239196 3300049743 Bacteria 1324
435 Ga0501083_0001364 3300049744 Bacteria 16559
436 Ga0501035_0000887 3300049822 Bacteria 31755
437 Ga0501044_0002514 3300049823 Bacteria 20894
438 Ga0501044_0070857 3300049823 Bacteria 3545
439 Ga0501044_0082327 3300049823 Bacteria 3257
440 nmdc:mga0yw44_23848_c1 3300050492 Bacteria 3453
441 nmdc:mga09592_26920_c1 3300050508 Bacteria 4768
442 nmdc:mga0qj67_435142_c1 3300050509 Bacteria 1057
443 nmdc:mga0qj67_54467_c1 3300050509 Bacteria 3168
444 nmdc:mga06r32_11329_c1 3300050510 Bacteria 8031
445 nmdc:mga06r32_380412_c1 3300050510 Bacteria 1395
446 nmdc:mga06r32_622951_c1 3300050510 Bacteria 1049
447 nmdc:mga08y16_16065_c1 3300050511 Bacteria 7871
448 nmdc:mga08y16_168795_c1 3300050511 Bacteria 2273
449 nmdc:mga0n895_52385_c1 3300050512 Bacteria 4006
450 nmdc:mga0n895_866828_c1 3300050512 Bacteria 890
451 nmdc:mga08x19_180666_c1 3300050514 Bacteria 1440
452 nmdc:mga08x19_352625_c1 3300050514 Bacteria 1027
453 nmdc:mga0a205_68435_c1 3300050515 Bacteria 3429
454 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
455 Ga0495601_0000013 3300053077 Bacteria 226476
456 Ga0495601_0000035 3300053077 Bacteria 92903
457 Ga0495601_0014416 3300053077 Bacteria 4763
458 Ga0495601_0016138 3300053077 Bacteria 4522
459 Ga0495601_0037517 3300053077 Bacteria 3030
460 Ga0495601_0139593 3300053077 Bacteria 1580
461 Ga0495601_0292456 3300053077 Bacteria 1062
462 Ga0495612_0002477 3300053078 Bacteria 7606
463 Ga0495612_0003571 3300053078 Bacteria 6443
464 Ga0495595_0000456 3300053084 Bacteria 15475
465 Ga0495595_0074790 3300053084 Bacteria 1606
466 Ga0495595_0106605 3300053084 Bacteria 1356
467 Ga0495619_0000025 3300053085 Bacteria 167905
468 Ga0495619_0000131 3300053085 Bacteria 55500
469 Ga0495619_0000157 3300053085 Bacteria 49848
470 Ga0495619_0000438 3300053085 Bacteria 28186
471 Ga0495619_0028266 3300053085 Bacteria 3616
472 Ga0495619_0050588 3300053085 Bacteria 2743
473 Ga0495619_0274866 3300053085 Bacteria 1167
474 Ga0500566_0008680 3300053094 Bacteria 6011
475 Ga0500614_000486 3300053123 Bacteria 10332
476 Ga0500658_0103321 3300053134 Bacteria 1246
477 Ga0501084_0404615 3300054114 Bacteria 1154
478 Ga0501082_0006817 3300060353 Bacteria 9875
479 Ga0501082_0143281 3300060353 Bacteria 2074
480 Ga0530510_0010239 3300061734 Bacteria 6569
481 Ga0530510_0010817 3300061734 Bacteria 6401

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100005875 Ga0070683_1000058758 206
2 3300025944 Ga0207661_10000347 Ga0207661_1000034720 206
3 3300026121 Ga0207683_10391523 Ga0207683_103915231 206
4 3300005367 Ga0070667_100008067 Ga0070667_1000080677 210
5 3300005548 Ga0070665_100322541 Ga0070665_1003225412 210
6 3300005843 Ga0068860_100310380 Ga0068860_1003103802 210
7 3300005844 Ga0068862_100024549 Ga0068862_1000245492 210
8 3300009098 Ga0105245_10015858 Ga0105245_100158583 210
9 3300009553 Ga0105249_10002533 Ga0105249_1000253314 210
10 3300013306 Ga0163162_10433860 Ga0163162_104338602 210
11 3300014325 Ga0163163_10761582 Ga0163163_107615821 210
12 3300014968 Ga0157379_10032581 Ga0157379_100325814 210
13 3300025961 Ga0207712_10008481 Ga0207712_100084817 210
14 3300025986 Ga0207658_10006842 Ga0207658_100068427 210
15 3300028380 Ga0268265_10079743 Ga0268265_100797436 210
16 3300005366 Ga0070659_100390562 Ga0070659_1003905621 211
17 3300020081 Ga0206354_11214690 Ga0206354_112146901 211
18 3300025932 Ga0207690_10212376 Ga0207690_102123762 211
19 3300049582 Ga0501048_0469396 Ga0501048_0469396_232_885 211
20 3300053077 Ga0495601_0000013 Ga0495601_0000013_11653_12387 211
21 3300053085 Ga0495619_0000131 Ga0495619_0000131_10838_11572 211
22 3300005344 Ga0070661_100000102 Ga0070661_10000010233 212
23 3300005834 Ga0068851_10002310 Ga0068851_100023109 212
24 3300005981 Ga0081538_10030513 Ga0081538_100305135 212
25 3300025321 Ga0207656_10002384 Ga0207656_100023843 212
26 3300025920 Ga0207649_10000009 Ga0207649_10000009219 212
27 3300047320 Ga0495672_0025151 Ga0495672_0025151_1948_2682 212
28 3300049582 Ga0501048_0243478 Ga0501048_0243478_18_752 212
29 3300049582 Ga0501048_0398073 Ga0501048_0398073_12_650 212
30 3300049593 Ga0501077_0189215 Ga0501077_0189215_43_777 212
31 3300049743 Ga0501081_0239196 Ga0501081_0239196_273_1007 212
32 3300005435 Ga0070714_100408890 Ga0070714_1004088902 216
33 3300005614 Ga0068856_100069173 Ga0068856_1000691733 216
34 3300005616 Ga0068852_100000006 Ga0068852_100000006130 216
35 3300009177 Ga0105248_10000008 Ga0105248_10000008291 216
36 3300025929 Ga0207664_10361634 Ga0207664_103616342 216
37 3300025941 Ga0207711_10000006 Ga0207711_10000006685 216
38 3300026078 Ga0207702_10016358 Ga0207702_100163587 216
39 3300026142 Ga0207698_10000013 Ga0207698_1000001359 216
40 3300046523 Ga0495644_0102543 Ga0495644_0102543_272_1009 216
41 3300046525 Ga0495663_0029152 Ga0495663_0029152_823_1560 216
42 3300005367 Ga0070667_100003553 Ga0070667_10000355318 218
43 3300005548 Ga0070665_100004145 Ga0070665_10000414515 218
44 3300025903 Ga0207680_10139551 Ga0207680_101395512 218
45 3300025986 Ga0207658_10008055 Ga0207658_100080552 218
46 3300028379 Ga0268266_10000595 Ga0268266_1000059532 218
47 3300046536 Ga0495587_0327013 Ga0495587_0327013_14_685 218
48 3300005335 Ga0070666_10011653 Ga0070666_100116537 219
49 3300005365 Ga0070688_100000393 Ga0070688_10000039318 219
50 3300005466 Ga0070685_10000141 Ga0070685_1000014136 219
51 3300005937 Ga0081455_10017352 Ga0081455_100173525 219
52 3300013104 Ga0157370_10227189 Ga0157370_102271892 219
53 3300013296 Ga0157374_10185757 Ga0157374_101857571 219
54 3300013297 Ga0157378_10140283 Ga0157378_101402834 219
55 3300025903 Ga0207680_10091384 Ga0207680_100913842 219
56 3300045976 Ga0466967_0000015 Ga0466967_0000015_2950_3684 219
57 3300046461 Ga0495641_0064403 Ga0495641_0064403_75_809 219
58 3300048913 Ga0496110_0000021 Ga0496110_0000021_13837_14571 219
59 3300048914 Ga0496111_0000009 Ga0496111_0000009_62530_63264 219
60 3300005937 Ga0081455_10342797 Ga0081455_103427972 220
61 3300006844 Ga0075428_100355918 Ga0075428_1003559182 220
62 3300009094 Ga0111539_10129291 Ga0111539_101292913 220
63 3300046537 Ga0495598_0007458 Ga0495598_0007458_1810_2472 220
64 3300050511 nmdc:mga08y16_168795_c1 nmdc:mga08y16_168795_c1_775_1509 220
65 3300014326 Ga0157380_10007734 Ga0157380_100077343 221
66 3300046533 Ga0495640_0020192 Ga0495640_0020192_1138_1884 221
67 3300047319 Ga0495674_0000064 Ga0495674_0000064_52201_52947 221
68 3300005329 Ga0070683_100000411 Ga0070683_10000041129 222
69 3300005354 Ga0070675_100000027 Ga0070675_10000002753 222
70 3300005466 Ga0070685_10000616 Ga0070685_100006167 222
71 3300005543 Ga0070672_100000087 Ga0070672_10000008746 222
72 3300005548 Ga0070665_100000950 Ga0070665_10000095018 222
73 3300005983 Ga0081540_1019158 Ga0081540_10191583 222
74 3300025926 Ga0207659_10000010 Ga0207659_1000001046 222
75 3300025940 Ga0207691_10000382 Ga0207691_100003825 222
76 3300025944 Ga0207661_10000253 Ga0207661_1000025321 222
77 3300028379 Ga0268266_10000912 Ga0268266_1000091236 222
78 3300046674 Ga0495588_0000134 Ga0495588_0000134_33295_34029 222
79 3300046689 Ga0495613_0000674 Ga0495613_0000674_6200_6934 222
80 3300046517 Ga0495630_0548762 Ga0495630_0548762_34_720 223
81 3300005718 Ga0068866_10000001 Ga0068866_10000001433 224
82 3300025899 Ga0207642_10000002 Ga0207642_10000002152 224
83 3300025937 Ga0207669_10000001 Ga0207669_10000001390 224
84 3300049578 Ga0501042_0061140 Ga0501042_0061140_1941_2675 225
85 3300005937 Ga0081455_10019749 Ga0081455_100197496 226
86 3300044694 Ga0466963_0394914 Ga0466963_0394914_59_805 226
87 3300002459 JGI24751J29686_10026938 JGI24751J29686_100269382 227
88 3300005329 Ga0070683_100033949 Ga0070683_1000339496 227
89 3300005458 Ga0070681_10411564 Ga0070681_104115642 227
90 3300005834 Ga0068851_10010835 Ga0068851_100108351 227
91 3300011119 Ga0105246_10376168 Ga0105246_103761682 227
92 3300025321 Ga0207656_10009236 Ga0207656_100092361 227
93 3300025912 Ga0207707_10222372 Ga0207707_102223722 227
94 3300025936 Ga0207670_10229170 Ga0207670_102291702 227
95 3300048903 Ga0496100_0000002 Ga0496100_0000002_447613_448350 227
96 3300048904 Ga0496101_0000001 Ga0496101_0000001_447613_448350 227
97 3300048907 Ga0496104_0000009 Ga0496104_0000009_307481_308218 227
98 3300048908 Ga0496105_0000007 Ga0496105_0000007_179838_180575 227
99 3300048909 Ga0496106_0000084 Ga0496106_0000084_40680_41417 227
100 3300048910 Ga0496107_0000003 Ga0496107_0000003_96356_97093 227
101 3300048924 Ga0496121_0252630 Ga0496121_0252630_476_1210 227
102 3300048927 Ga0496124_0023648 Ga0496124_0023648_316_1050 227
103 3300049581 Ga0501047_0146787 Ga0501047_0146787_1420_2166 228
104 3300047321 Ga0495676_0322193 Ga0495676_0322193_80_814 229
105 3300005364 Ga0070673_100008824 Ga0070673_1000088246 230
106 3300025960 Ga0207651_10118100 Ga0207651_101181003 230
107 3300037312 Ga0395899_0296856 Ga0395899_0296856_141_875 230
108 3300037466 Ga0395898_0007911 Ga0395898_0007911_5620_6354 230
109 3300038443 Ga0395901_0044457 Ga0395901_0044457_1460_2194 230
110 3300047322 Ga0495680_0402734 Ga0495680_0402734_128_862 230
111 3300048909 Ga0496106_0352840 Ga0496106_0352840_131_877 230
112 3300049588 Ga0501072_0020950 Ga0501072_0020950_3059_3793 230
113 3300049741 Ga0501079_0051849 Ga0501079_0051849_460_1194 230
114 3300061734 Ga0530510_0010239 Ga0530510_0010239_2521_3255 230
115 3300005457 Ga0070662_100000004 Ga0070662_100000004169 231
116 3300025933 Ga0207706_10000012 Ga0207706_1000001249 231
117 3300047321 Ga0495676_0000130 Ga0495676_0000130_12441_13175 231
118 3300047446 Ga0495679_012724 Ga0495679_012724_849_1586 231
119 3300048089 Ga0495614_0014178 Ga0495614_0014178_2637_3371 231
120 3300048910 Ga0496107_0182721 Ga0496107_0182721_205_939 231
121 3300005356 Ga0070674_100000017 Ga0070674_1000000178 232
122 3300005530 Ga0070679_100005498 Ga0070679_10000549812 232
123 3300005549 Ga0070704_100361845 Ga0070704_1003618452 232
124 3300005937 Ga0081455_10091044 Ga0081455_100910442 232
125 3300009551 Ga0105238_10000011 Ga0105238_10000011229 232
126 3300025921 Ga0207652_10001781 Ga0207652_1000178122 232
127 3300025924 Ga0207694_10000004 Ga0207694_10000004393 232
128 3300026067 Ga0207678_10001753 Ga0207678_1000175315 232
129 3300048910 Ga0496107_0092369 Ga0496107_0092369_1205_1942 232
130 3300005333 Ga0070677_10000103 Ga0070677_100001032 233
131 3300005578 Ga0068854_100001172 Ga0068854_1000011727 233
132 3300013308 Ga0157375_10486598 Ga0157375_104865982 233
133 3300025893 Ga0207682_10000005 Ga0207682_1000000556 233
134 3300025981 Ga0207640_10003326 Ga0207640_100033268 233
135 3300031456 Ga0307513_10444056 Ga0307513_104440561 233
136 3300046691 Ga0495670_0027781 Ga0495670_0027781_1350_2084 233
137 3300046809 Ga0495600_0009557 Ga0495600_0009557_2520_3254 233
138 3300047317 Ga0495604_0003861 Ga0495604_0003861_6429_7163 233
139 3300048908 Ga0496105_0054866 Ga0496105_0054866_207_953 233
140 3300053085 Ga0495619_0000438 Ga0495619_0000438_23787_24521 233
141 3300005435 Ga0070714_100135464 Ga0070714_1001354642 234
142 3300005614 Ga0068856_100000629 Ga0068856_10000062919 234
143 3300006881 Ga0068865_100000023 Ga0068865_10000002377 234
144 3300009098 Ga0105245_10000254 Ga0105245_1000025424 234
145 3300013104 Ga0157370_10004542 Ga0157370_1000454219 234
146 3300013105 Ga0157369_10000020 Ga0157369_10000020171 234
147 3300014968 Ga0157379_10027346 Ga0157379_100273465 234
148 3300025927 Ga0207687_10000007 Ga0207687_10000007450 234
149 3300025938 Ga0207704_10000159 Ga0207704_1000015933 234
150 3300025944 Ga0207661_10096655 Ga0207661_100966553 234
151 3300026078 Ga0207702_10000158 Ga0207702_1000015859 234
152 3300044694 Ga0466963_0000105 Ga0466963_0000105_27394_28131 234
153 3300046476 Ga0495662_0004260 Ga0495662_0004260_6415_7149 234
154 3300046517 Ga0495630_0000121 Ga0495630_0000121_4979_5713 234
155 3300047673 Ga0495593_0122939 Ga0495593_0122939_253_987 234
156 3300053077 Ga0495601_0014416 Ga0495601_0014416_814_1548 234
157 3300005341 Ga0070691_10000027 Ga0070691_1000002745 235
158 3300005366 Ga0070659_100292007 Ga0070659_1002920072 235
159 3300005841 Ga0068863_100000342 Ga0068863_10000034230 235
160 3300005843 Ga0068860_100036483 Ga0068860_1000364832 235
161 3300006852 Ga0075433_10000900 Ga0075433_100009004 235
162 3300013308 Ga0157375_10001538 Ga0157375_1000153817 235
163 3300014969 Ga0157376_10048384 Ga0157376_100483843 235
164 3300025932 Ga0207690_10100446 Ga0207690_101004463 235
165 3300026088 Ga0207641_10000238 Ga0207641_1000023864 235
166 3300028381 Ga0268264_10027150 Ga0268264_100271502 235
167 3300028563 Ga0265319_1000020 Ga0265319_1000020128 235
168 3300028800 Ga0265338_10000222 Ga0265338_10000222118 235
169 3300031241 Ga0265325_10003811 Ga0265325_100038119 235
170 3300046463 Ga0495653_0019236 Ga0495653_0019236_1690_2424 235
171 3300046689 Ga0495613_0000124 Ga0495613_0000124_68655_69389 235
172 3300049591 Ga0501075_0210589 Ga0501075_0210589_542_1249 235
173 3300017792 Ga0163161_10000021 Ga0163161_10000021208 236
174 3300046517 Ga0495630_0087917 Ga0495630_0087917_101_838 236
175 3300047322 Ga0495680_0453070 Ga0495680_0453070_94_804 236
176 3300048917 Ga0496114_0009597 Ga0496114_0009597_4090_4824 236
177 3300049823 Ga0501044_0070857 Ga0501044_0070857_926_1672 236
178 3300053085 Ga0495619_0274866 Ga0495619_0274866_21_731 236
179 3300032126 Ga0307415_100003131 Ga0307415_1000031318 237
180 3300046455 Ga0495603_0001389 Ga0495603_0001389_3728_4462 237
181 3300046536 Ga0495587_0028219 Ga0495587_0028219_135_869 237
182 3300049574 Ga0501038_0132169 Ga0501038_0132169_739_1473 237
183 3300049576 Ga0501040_0215095 Ga0501040_0215095_389_1123 237
184 3300049588 Ga0501072_0008345 Ga0501072_0008345_1441_2175 237
185 3300049591 Ga0501075_0033895 Ga0501075_0033895_180_914 237
186 3300049592 Ga0501076_0053222 Ga0501076_0053222_1371_2105 237
187 3300049743 Ga0501081_0041306 Ga0501081_0041306_1193_1927 237
188 3300054114 Ga0501084_0404615 Ga0501084_0404615_285_1019 237
189 3300060353 Ga0501082_0143281 Ga0501082_0143281_718_1452 237
190 3300061734 Ga0530510_0010817 Ga0530510_0010817_1135_1869 237
191 3300046461 Ga0495641_0054490 Ga0495641_0054490_717_1454 239
192 3300046515 Ga0495620_0000995 Ga0495620_0000995_9068_9805 240
193 3300013297 Ga0157378_10013002 Ga0157378_100130027 242
194 3300046663 Ga0495635_0254930 Ga0495635_0254930_244_972 242
195 3300048908 Ga0496105_0092816 Ga0496105_0092816_224_952 242
196 3300053085 Ga0495619_0000157 Ga0495619_0000157_21884_22612 242
197 3300001977 JGI24746J21847_1000071 JGI24746J21847_10000713 244
198 3300002244 JGI24742J22300_10001747 JGI24742J22300_100017474 244
199 3300003659 JGI25404J52841_10015215 JGI25404J52841_100152152 244
200 3300005337 Ga0070682_100000099 Ga0070682_10000009976 244
201 3300005338 Ga0068868_100000450 Ga0068868_10000045026 244
202 3300005355 Ga0070671_100561769 Ga0070671_1005617691 244
203 3300005356 Ga0070674_100000090 Ga0070674_10000009012 244
204 3300005367 Ga0070667_100027060 Ga0070667_1000270604 244
205 3300005456 Ga0070678_100070440 Ga0070678_1000704402 244
206 3300005458 Ga0070681_10443439 Ga0070681_104434392 244
207 3300005459 Ga0068867_100000796 Ga0068867_10000079619 244
208 3300005530 Ga0070679_100000243 Ga0070679_10000024314 244
209 3300005535 Ga0070684_100083112 Ga0070684_1000831124 244
210 3300005535 Ga0070684_100153886 Ga0070684_1001538862 244
211 3300005535 Ga0070684_100322996 Ga0070684_1003229962 244
212 3300005539 Ga0068853_100327195 Ga0068853_1003271952 244
213 3300005544 Ga0070686_100182310 Ga0070686_1001823101 244
214 3300005547 Ga0070693_100000847 Ga0070693_1000008473 244
215 3300005548 Ga0070665_100000106 Ga0070665_1000001064 244
216 3300005548 Ga0070665_100245776 Ga0070665_1002457762 244
217 3300005564 Ga0070664_100181247 Ga0070664_1001812472 244
218 3300005614 Ga0068856_100074910 Ga0068856_1000749101 244
219 3300005718 Ga0068866_10000685 Ga0068866_1000068515 244
220 3300005718 Ga0068866_10029022 Ga0068866_100290224 244
221 3300005842 Ga0068858_100000009 Ga0068858_100000009159 244
222 3300005983 Ga0081540_1000163 Ga0081540_100016348 244
223 3300005985 Ga0081539_10026881 Ga0081539_100268813 244
224 3300006163 Ga0070715_10000001 Ga0070715_10000001401 244
225 3300006175 Ga0070712_100142519 Ga0070712_1001425193 244
226 3300006358 Ga0068871_100480837 Ga0068871_1004808372 244
227 3300006846 Ga0075430_100009324 Ga0075430_1000093246 244
228 3300006846 Ga0075430_100023451 Ga0075430_1000234516 244
229 3300006847 Ga0075431_100000536 Ga0075431_10000053617 244
230 3300006847 Ga0075431_100040061 Ga0075431_1000400615 244
231 3300006847 Ga0075431_100042964 Ga0075431_1000429643 244
232 3300006847 Ga0075431_100143555 Ga0075431_1001435552 244
233 3300006852 Ga0075433_10034271 Ga0075433_100342714 244
234 3300006871 Ga0075434_100013735 Ga0075434_1000137353 244
235 3300006880 Ga0075429_100004332 Ga0075429_1000043327 244
236 3300007076 Ga0075435_100385473 Ga0075435_1003854732 244
237 3300009094 Ga0111539_10004345 Ga0111539_100043456 244
238 3300009094 Ga0111539_10169453 Ga0111539_101694532 244
239 3300009094 Ga0111539_10774614 Ga0111539_107746142 244
240 3300009098 Ga0105245_10000020 Ga0105245_1000002027 244
241 3300009101 Ga0105247_10000316 Ga0105247_1000031617 244
242 3300009147 Ga0114129_10051723 Ga0114129_100517237 244
243 3300009147 Ga0114129_10097421 Ga0114129_100974215 244
244 3300009147 Ga0114129_10526991 Ga0114129_105269911 244
245 3300009176 Ga0105242_10113913 Ga0105242_101139133 244
246 3300009545 Ga0105237_10102097 Ga0105237_101020972 244
247 3300009553 Ga0105249_10000080 Ga0105249_1000008050 244
248 3300009553 Ga0105249_10145323 Ga0105249_101453232 244
249 3300010375 Ga0105239_10364266 Ga0105239_103642662 244
250 3300013105 Ga0157369_10458545 Ga0157369_104585452 244
251 3300013296 Ga0157374_10001772 Ga0157374_1000177219 244
252 3300013296 Ga0157374_10096749 Ga0157374_100967494 244
253 3300013307 Ga0157372_10689686 Ga0157372_106896862 244
254 3300013308 Ga0157375_10001213 Ga0157375_1000121318 244
255 3300014325 Ga0163163_10227094 Ga0163163_102270943 244
256 3300017792 Ga0163161_10180860 Ga0163161_101808602 244
257 3300025898 Ga0207692_10174815 Ga0207692_101748152 244
258 3300025899 Ga0207642_10000281 Ga0207642_100002815 244
259 3300025899 Ga0207642_10055639 Ga0207642_100556391 244
260 3300025900 Ga0207710_10059383 Ga0207710_100593832 244
261 3300025905 Ga0207685_10000027 Ga0207685_1000002794 244
262 3300025909 Ga0207705_10048298 Ga0207705_100482982 244
263 3300025912 Ga0207707_10373437 Ga0207707_103734371 244
264 3300025914 Ga0207671_10374382 Ga0207671_103743822 244
265 3300025915 Ga0207693_10108715 Ga0207693_101087153 244
266 3300025916 Ga0207663_10000498 Ga0207663_1000049816 244
267 3300025921 Ga0207652_10002027 Ga0207652_100020276 244
268 3300025927 Ga0207687_10000013 Ga0207687_1000001369 244
269 3300025935 Ga0207709_10137792 Ga0207709_101377923 244
270 3300025937 Ga0207669_10000096 Ga0207669_1000009613 244
271 3300025937 Ga0207669_10222963 Ga0207669_102229632 244
272 3300025944 Ga0207661_10238729 Ga0207661_102387292 244
273 3300025945 Ga0207679_10011503 Ga0207679_100115036 244
274 3300025949 Ga0207667_10328477 Ga0207667_103284772 244
275 3300025961 Ga0207712_10000007 Ga0207712_10000007443 244
276 3300025986 Ga0207658_10116136 Ga0207658_101161362 244
277 3300026023 Ga0207677_10000200 Ga0207677_1000020044 244
278 3300026035 Ga0207703_10000018 Ga0207703_1000001852 244
279 3300026035 Ga0207703_10000023 Ga0207703_1000002366 244
280 3300026041 Ga0207639_10010573 Ga0207639_100105732 244
281 3300026078 Ga0207702_10004125 Ga0207702_100041252 244
282 3300026089 Ga0207648_10004426 Ga0207648_1000442610 244
283 3300026095 Ga0207676_10000195 Ga0207676_1000019545 244
284 3300026121 Ga0207683_10065768 Ga0207683_100657684 244
285 3300027907 Ga0207428_10067434 Ga0207428_100674343 244
286 3300028379 Ga0268266_10000047 Ga0268266_10000047156 244
287 3300028379 Ga0268266_10043596 Ga0268266_100435963 244
288 3300028379 Ga0268266_10715194 Ga0268266_107151941 244
289 3300028556 Ga0265337_1000807 Ga0265337_100080717 244
290 3300028558 Ga0265326_10000063 Ga0265326_100000636 244
291 3300028654 Ga0265322_10000001 Ga0265322_10000001388 244
292 3300028666 Ga0265336_10012722 Ga0265336_100127223 244
293 3300028800 Ga0265338_10277004 Ga0265338_102770042 244
294 3300029957 Ga0265324_10000755 Ga0265324_1000075516 244
295 3300031238 Ga0265332_10007328 Ga0265332_100073284 244
296 3300031239 Ga0265328_10004755 Ga0265328_100047553 244
297 3300031240 Ga0265320_10000002 Ga0265320_10000002387 244
298 3300031249 Ga0265339_10018762 Ga0265339_100187625 244
299 3300031250 Ga0265331_10002295 Ga0265331_100022956 244
300 3300031251 Ga0265327_10000011 Ga0265327_10000011387 244
301 3300031344 Ga0265316_10030052 Ga0265316_100300523 244
302 3300031711 Ga0265314_10000062 Ga0265314_10000062121 244
303 3300031995 Ga0307409_100791860 Ga0307409_1007918601 244
304 3300032002 Ga0307416_100860939 Ga0307416_1008609392 244
305 3300035120 Ga0373957_0048693 Ga0373957_0048693_804_1541 244
306 3300035172 Ga0373955_0209037 Ga0373955_0209037_91_828 244
307 3300035724 Ga0373933_0205492 Ga0373933_0205492_191_928 244
308 3300036401 Ga0373937_0024047 Ga0373937_0024047_3095_3832 244
309 3300036401 Ga0373937_0162767 Ga0373937_0162767_396_1130 244
310 3300037418 Ga0395900_0010300 Ga0395900_0010300_8601_9350 244
311 3300037418 Ga0395900_0175051 Ga0395900_0175051_430_1170 244
312 3300037466 Ga0395898_0001408 Ga0395898_0001408_18708_19457 244
313 3300037471 Ga0395905_0003057 Ga0395905_0003057_12026_12775 244
314 3300038443 Ga0395901_0001723 Ga0395901_0001723_17342_18091 244
315 3300041459 Ga0451800_0682346 Ga0451800_0682346_108_845 244
316 3300044694 Ga0466963_0046051 Ga0466963_0046051_248_982 244
317 3300045976 Ga0466967_0170005 Ga0466967_0170005_659_1396 244
318 3300046454 Ga0495592_0021098 Ga0495592_0021098_3273_4007 244
319 3300046454 Ga0495592_0062726 Ga0495592_0062726_1208_1942 244
320 3300046454 Ga0495592_0220241 Ga0495592_0220241_20_754 244
321 3300046454 Ga0495592_0407217 Ga0495592_0407217_107_841 244
322 3300046455 Ga0495603_0001462 Ga0495603_0001462_12693_13427 244
323 3300046455 Ga0495603_0004794 Ga0495603_0004794_2809_3543 244
324 3300046459 Ga0495629_0435162 Ga0495629_0435162_68_802 244
325 3300046460 Ga0495638_0026746 Ga0495638_0026746_1738_2484 244
326 3300046461 Ga0495641_0000228 Ga0495641_0000228_24130_24864 244
327 3300046463 Ga0495653_0019096 Ga0495653_0019096_1729_2463 244
328 3300046463 Ga0495653_0282533 Ga0495653_0282533_31_765 244
329 3300046473 Ga0495582_0000726 Ga0495582_0000726_9743_10477 244
330 3300046499 Ga0495594_0000029 Ga0495594_0000029_22561_23295 244
331 3300046511 Ga0495608_0000222 Ga0495608_0000222_7340_8074 244
332 3300046514 Ga0495618_0000008 Ga0495618_0000008_19882_20616 244
333 3300046514 Ga0495618_0260440 Ga0495618_0260440_138_872 244
334 3300046516 Ga0495628_0008516 Ga0495628_0008516_2440_3174 244
335 3300046516 Ga0495628_0016259 Ga0495628_0016259_2648_3382 244
336 3300046516 Ga0495628_0192792 Ga0495628_0192792_49_783 244
337 3300046517 Ga0495630_0020713 Ga0495630_0020713_2334_3068 244
338 3300046523 Ga0495644_0000630 Ga0495644_0000630_7108_7842 244
339 3300046529 Ga0495652_0000407 Ga0495652_0000407_16096_16842 244
340 3300046535 Ga0495586_0032410 Ga0495586_0032410_47_781 244
341 3300046536 Ga0495587_0049993 Ga0495587_0049993_260_994 244
342 3300046539 Ga0495621_0018311 Ga0495621_0018311_1189_1923 244
343 3300046543 Ga0495645_0095649 Ga0495645_0095649_1048_1833 244
344 3300046557 Ga0495622_0000789 Ga0495622_0000789_8918_9652 244
345 3300046559 Ga0495667_0000018 Ga0495667_0000018_56838_57572 244
346 3300046615 Ga0495656_0001289 Ga0495656_0001289_6977_7711 244
347 3300046642 Ga0495634_0000059 Ga0495634_0000059_61560_62294 244
348 3300046642 Ga0495634_0018299 Ga0495634_0018299_3327_4061 244
349 3300046660 Ga0495625_0000171 Ga0495625_0000171_3440_4186 244
350 3300046663 Ga0495635_0000062 Ga0495635_0000062_62047_62781 244
351 3300046675 Ga0495657_0255540 Ga0495657_0255540_29_763 244
352 3300046678 Ga0495599_0057672 Ga0495599_0057672_199_936 244
353 3300046680 Ga0495646_0125474 Ga0495646_0125474_285_1022 244
354 3300046681 Ga0495647_0000017 Ga0495647_0000017_79804_80538 244
355 3300046683 Ga0495658_0000034 Ga0495658_0000034_60766_61500 244
356 3300046684 Ga0495669_0000310 Ga0495669_0000310_10117_10854 244
357 3300046689 Ga0495613_0175400 Ga0495613_0175400_196_933 244
358 3300046689 Ga0495613_0342476 Ga0495613_0342476_29_775 244
359 3300046690 Ga0495624_0001256 Ga0495624_0001256_2834_3568 244
360 3300046694 Ga0495649_0004181 Ga0495649_0004181_5127_5861 244
361 3300046809 Ga0495600_0001066 Ga0495600_0001066_2773_3507 244
362 3300047315 Ga0495581_0030089 Ga0495581_0030089_72_806 244
363 3300047317 Ga0495604_0000055 Ga0495604_0000055_72652_73386 244
364 3300047320 Ga0495672_0169658 Ga0495672_0169658_322_1056 244
365 3300047321 Ga0495676_0025700 Ga0495676_0025700_1400_2134 244
366 3300047322 Ga0495680_0002282 Ga0495680_0002282_13023_13757 244
367 3300047322 Ga0495680_0016125 Ga0495680_0016125_5535_6269 244
368 3300047444 Ga0495675_0172649 Ga0495675_0172649_148_894 244
369 3300047472 Ga0495686_0054323 Ga0495686_0054323_1039_1773 244
370 3300048088 Ga0495602_0001349 Ga0495602_0001349_5600_6334 244
371 3300048088 Ga0495602_0071241 Ga0495602_0071241_1520_2254 244
372 3300048903 Ga0496100_0000005 Ga0496100_0000005_261528_262262 244
373 3300048904 Ga0496101_0000101 Ga0496101_0000101_68792_69526 244
374 3300048905 Ga0496102_0003911 Ga0496102_0003911_6573_7307 244
375 3300048906 Ga0496103_0035998 Ga0496103_0035998_1183_1917 244
376 3300048906 Ga0496103_0057594 Ga0496103_0057594_1278_2012 244
377 3300048906 Ga0496103_0154501 Ga0496103_0154501_51_785 244
378 3300048907 Ga0496104_0000004 Ga0496104_0000004_365949_366686 244
379 3300048907 Ga0496104_0000190 Ga0496104_0000190_49086_49820 244
380 3300048908 Ga0496105_0000001 Ga0496105_0000001_275145_275882 244
381 3300048909 Ga0496106_0000151 Ga0496106_0000151_20073_20807 244
382 3300048909 Ga0496106_0119979 Ga0496106_0119979_871_1605 244
383 3300048910 Ga0496107_0000011 Ga0496107_0000011_49621_50355 244
384 3300048911 Ga0496108_0000001 Ga0496108_0000001_743045_743782 244
385 3300048911 Ga0496108_0000587 Ga0496108_0000587_10807_11541 244
386 3300048911 Ga0496108_0006431 Ga0496108_0006431_6533_7267 244
387 3300048912 Ga0496109_0000003 Ga0496109_0000003_417591_418328 244
388 3300048912 Ga0496109_0001118 Ga0496109_0001118_2504_3238 244
389 3300048913 Ga0496110_0016388 Ga0496110_0016388_1681_2415 244
390 3300048913 Ga0496110_0029190 Ga0496110_0029190_1031_1765 244
391 3300048914 Ga0496111_0098241 Ga0496111_0098241_214_948 244
392 3300048914 Ga0496111_0113869 Ga0496111_0113869_773_1507 244
393 3300048915 Ga0496112_0000006 Ga0496112_0000006_268316_269050 244
394 3300048915 Ga0496112_0198200 Ga0496112_0198200_754_1524 244
395 3300048915 Ga0496112_0323340 Ga0496112_0323340_318_1052 244
396 3300048915 Ga0496112_0399150 Ga0496112_0399150_382_1116 244
397 3300048916 Ga0496113_0054719 Ga0496113_0054719_1763_2497 244
398 3300048916 Ga0496113_0240534 Ga0496113_0240534_670_1404 244
399 3300048917 Ga0496114_0234374 Ga0496114_0234374_811_1545 244
400 3300048918 Ga0496115_0000003 Ga0496115_0000003_102011_102745 244
401 3300048918 Ga0496115_0028569 Ga0496115_0028569_2050_2784 244
402 3300048919 Ga0496116_0000735 Ga0496116_0000735_22638_23372 244
403 3300048920 Ga0496117_0016612 Ga0496117_0016612_2288_3022 244
404 3300048921 Ga0496118_0000833 Ga0496118_0000833_14358_15092 244
405 3300048921 Ga0496118_0095828 Ga0496118_0095828_153_887 244
406 3300048922 Ga0496119_0001290 Ga0496119_0001290_11861_12595 244
407 3300048922 Ga0496119_0033172 Ga0496119_0033172_1310_2044 244
408 3300048922 Ga0496119_0041797 Ga0496119_0041797_104_841 244
409 3300048923 Ga0496120_0014960 Ga0496120_0014960_3648_4385 244
410 3300048923 Ga0496120_0028190 Ga0496120_0028190_1331_2065 244
411 3300048928 Ga0496125_0044444 Ga0496125_0044444_2216_2953 244
412 3300048929 Ga0496126_0007040 Ga0496126_0007040_7249_7998 244
413 3300048929 Ga0496126_0048803 Ga0496126_0048803_1972_2721 244
414 3300049568 Ga0501031_0009252 Ga0501031_0009252_3192_3938 244
415 3300049569 Ga0501032_0000965 Ga0501032_0000965_7801_8547 244
416 3300049570 Ga0501033_0000900 Ga0501033_0000900_7977_8723 244
417 3300049571 Ga0501034_0080673 Ga0501034_0080673_346_1092 244
418 3300049572 Ga0501036_0001844 Ga0501036_0001844_7891_8637 244
419 3300049573 Ga0501037_0002603 Ga0501037_0002603_7914_8660 244
420 3300049574 Ga0501038_0006062 Ga0501038_0006062_7901_8647 244
421 3300049575 Ga0501039_0011207 Ga0501039_0011207_5508_6254 244
422 3300049576 Ga0501040_0066761 Ga0501040_0066761_1058_1804 244
423 3300049576 Ga0501040_0138465 Ga0501040_0138465_304_1056 244
424 3300049578 Ga0501042_0020286 Ga0501042_0020286_2141_2875 244
425 3300049578 Ga0501042_0051097 Ga0501042_0051097_1947_2681 244
426 3300049579 Ga0501043_0004468 Ga0501043_0004468_2645_3391 244
427 3300049580 Ga0501046_0000702 Ga0501046_0000702_7910_8656 244
428 3300049581 Ga0501047_0009430 Ga0501047_0009430_3994_4740 244
429 3300049581 Ga0501047_0012322 Ga0501047_0012322_2097_2846 244
430 3300049581 Ga0501047_0227146 Ga0501047_0227146_543_1277 244
431 3300049582 Ga0501048_0000888 Ga0501048_0000888_13506_14252 244
432 3300049583 Ga0501067_0047244 Ga0501067_0047244_915_1661 244
433 3300049584 Ga0501068_0005996 Ga0501068_0005996_1187_1933 244
434 3300049584 Ga0501068_0171192 Ga0501068_0171192_91_825 244
435 3300049585 Ga0501069_0000880 Ga0501069_0000880_10080_10826 244
436 3300049586 Ga0501070_0000680 Ga0501070_0000680_18421_19167 244
437 3300049586 Ga0501070_0005582 Ga0501070_0005582_3871_4605 244
438 3300049586 Ga0501070_0046829 Ga0501070_0046829_225_959 244
439 3300049586 Ga0501070_0053684 Ga0501070_0053684_2528_3277 244
440 3300049586 Ga0501070_0065276 Ga0501070_0065276_287_1033 244
441 3300049586 Ga0501070_0130458 Ga0501070_0130458_1193_1939 244
442 3300049589 Ga0501073_0006128 Ga0501073_0006128_7854_8600 244
443 3300049590 Ga0501074_0015768 Ga0501074_0015768_3360_4106 244
444 3300049591 Ga0501075_0001068 Ga0501075_0001068_7005_7739 244
445 3300049591 Ga0501075_0015147 Ga0501075_0015147_1591_2325 244
446 3300049742 Ga0501080_0058430 Ga0501080_0058430_1156_1902 244
447 3300049744 Ga0501083_0001364 Ga0501083_0001364_7934_8680 244
448 3300049822 Ga0501035_0000887 Ga0501035_0000887_11926_12672 244
449 3300049823 Ga0501044_0002514 Ga0501044_0002514_8174_8920 244
450 3300049823 Ga0501044_0082327 Ga0501044_0082327_436_1170 244
451 3300050492 nmdc:mga0yw44_23848_c1 nmdc:mga0yw44_23848_c1_458_1192 244
452 3300050508 nmdc:mga09592_26920_c1 nmdc:mga09592_26920_c1_1669_2421 244
453 3300050509 nmdc:mga0qj67_435142_c1 nmdc:mga0qj67_435142_c1_215_949 244
454 3300050509 nmdc:mga0qj67_54467_c1 nmdc:mga0qj67_54467_c1_1236_1988 244
455 3300050510 nmdc:mga06r32_11329_c1 nmdc:mga06r32_11329_c1_893_1642 244
456 3300050510 nmdc:mga06r32_380412_c1 nmdc:mga06r32_380412_c1_173_925 244
457 3300050510 nmdc:mga06r32_622951_c1 nmdc:mga06r32_622951_c1_131_865 244
458 3300050511 nmdc:mga08y16_16065_c1 nmdc:mga08y16_16065_c1_722_1471 244
459 3300050512 nmdc:mga0n895_52385_c1 nmdc:mga0n895_52385_c1_1711_2460 244
460 3300050512 nmdc:mga0n895_866828_c1 nmdc:mga0n895_866828_c1_98_835 244
461 3300050514 nmdc:mga08x19_180666_c1 nmdc:mga08x19_180666_c1_37_771 244
462 3300050514 nmdc:mga08x19_352625_c1 nmdc:mga08x19_352625_c1_222_956 244
463 3300050515 nmdc:mga0a205_68435_c1 nmdc:mga0a205_68435_c1_1974_2723 244
464 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_104417_105151 244
465 3300053077 Ga0495601_0000035 Ga0495601_0000035_82174_82911 244
466 3300053077 Ga0495601_0016138 Ga0495601_0016138_2213_2947 244
467 3300053077 Ga0495601_0037517 Ga0495601_0037517_1285_2031 244
468 3300053077 Ga0495601_0139593 Ga0495601_0139593_173_907 244
469 3300053077 Ga0495601_0292456 Ga0495601_0292456_281_1015 244
470 3300053078 Ga0495612_0002477 Ga0495612_0002477_3897_4631 244
471 3300053078 Ga0495612_0003571 Ga0495612_0003571_2404_3141 244
472 3300053084 Ga0495595_0000456 Ga0495595_0000456_9682_10416 244
473 3300053084 Ga0495595_0074790 Ga0495595_0074790_104_838 244
474 3300053084 Ga0495595_0106605 Ga0495595_0106605_134_868 244
475 3300053085 Ga0495619_0000025 Ga0495619_0000025_138520_139254 244
476 3300053085 Ga0495619_0028266 Ga0495619_0028266_40_774 244
477 3300053085 Ga0495619_0050588 Ga0495619_0050588_373_1107 244
478 3300053094 Ga0500566_0008680 Ga0500566_0008680_2512_3246 244
479 3300053123 Ga0500614_000486 Ga0500614_000486_6372_7106 244
480 3300053134 Ga0500658_0103321 Ga0500658_0103321_193_927 244
481 3300060353 Ga0501082_0006817 Ga0501082_0006817_7900_8646 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

24

207

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

260

0.95

PF08659

KR

KR domain

25

198

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

219

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9473 3 175
6zzs-assembly2.cif.gz_E-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9355 2 239
2ag5-assembly1.cif.gz_D crystal structure of human dhrs6 0.9317 1 240
4dqx-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9301 1 240
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9283 6 176
ID Description Score Start End Superfamily
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9473 3 175 3.40.50.720
2ag5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9317 1 240 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 6 176 3.40.50.720
af_P37440_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9255 2 240 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9255 1 241 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A838PKJ1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9556 1 215 GO:0016616
GO:0030497
AF-A0A4Q8QWH3-F1-model_v4 3-oxoacyl-ACP reductase 0.9547 2 242 GO:0016491
AF-H0E6S3-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) 0.9533 2 242 GO:0004316
AF-A0A3N5FV26-F1-model_v4 SDR family oxidoreductase 0.9527 4 162 GO:0016020
GO:0016491
AF-A0A7V9RIM1-F1-model_v4 SDR family oxidoreductase 0.9487 1 195 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.51 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map