F452362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 481 | 286 | 481 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100561769|Ga0070671_1005617691 |
| Length | 262 |
| Sequence | MPPFGRRPLGARQSMLIAMRLEGKRALVTGGASGIGAAIAARLAAEGAEVWVGDVYVAGAEKVAAEIAGHALELDVTDLAAAEAAIEAIGSPQILINNAGTAEFGFFTQTTPQQWQRVIAINLVGVLNCTYAALPGMQHAGYGRIVSISSEAGRVGSKGSAVYSAAKGGVVAFMKTIARENGRYGVTANSIAPGPIETPLLMGAKDLGEVGEKLIENMKGTTQLGRLGQPDEVAAAAAFLASDDATFVTGETLGVSGGLGMV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 131 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 140 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 231 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 232 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 233 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 234 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 282 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 283 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.83 |
| Nodule | 0 |
| Rhizoplane | 9.36 |
| Rhizosphere | 86.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000071 | 3300001977 | Bacteria | 10770 |
| 2 | JGI24742J22300_10001747 | 3300002244 | Bacteria | 3466 |
| 3 | JGI24751J29686_10026938 | 3300002459 | Bacteria | 1193 |
| 4 | JGI25404J52841_10015215 | 3300003659 | Bacteria | 1670 |
| 5 | Ga0070683_100000411 | 3300005329 | Bacteria | 29635 |
| 6 | Ga0070683_100005875 | 3300005329 | Bacteria | 10272 |
| 7 | Ga0070683_100033949 | 3300005329 | Bacteria | 4656 |
| 8 | Ga0070677_10000103 | 3300005333 | Bacteria | 27983 |
| 9 | Ga0070666_10011653 | 3300005335 | Bacteria | 5526 |
| 10 | Ga0070682_100000099 | 3300005337 | Bacteria | 77574 |
| 11 | Ga0068868_100000450 | 3300005338 | Bacteria | 27515 |
| 12 | Ga0070691_10000027 | 3300005341 | Bacteria | 40642 |
| 13 | Ga0070661_100000102 | 3300005344 | Bacteria | 69941 |
| 14 | Ga0070675_100000027 | 3300005354 | Bacteria | 106172 |
| 15 | Ga0070671_100561769 | 3300005355 | Bacteria | 984 |
| 16 | Ga0070674_100000017 | 3300005356 | Bacteria | 90884 |
| 17 | Ga0070674_100000090 | 3300005356 | Bacteria | 42115 |
| 18 | Ga0070673_100008824 | 3300005364 | Bacteria | 6732 |
| 19 | Ga0070688_100000393 | 3300005365 | Bacteria | 22156 |
| 20 | Ga0070659_100292007 | 3300005366 | Bacteria | 1358 |
| 21 | Ga0070659_100390562 | 3300005366 | Bacteria | 1173 |
| 22 | Ga0070667_100003553 | 3300005367 | Bacteria | 13289 |
| 23 | Ga0070667_100008067 | 3300005367 | Bacteria | 8736 |
| 24 | Ga0070667_100027060 | 3300005367 | Bacteria | 4770 |
| 25 | Ga0070714_100135464 | 3300005435 | Bacteria | 2205 |
| 26 | Ga0070714_100408890 | 3300005435 | Bacteria | 1284 |
| 27 | Ga0070678_100070440 | 3300005456 | Bacteria | 2614 |
| 28 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 29 | Ga0070681_10411564 | 3300005458 | Bacteria | 1264 |
| 30 | Ga0070681_10443439 | 3300005458 | Bacteria | 1210 |
| 31 | Ga0068867_100000796 | 3300005459 | Bacteria | 21356 |
| 32 | Ga0070685_10000141 | 3300005466 | Bacteria | 46333 |
| 33 | Ga0070685_10000616 | 3300005466 | Bacteria | 19644 |
| 34 | Ga0070679_100000243 | 3300005530 | Bacteria | 45435 |
| 35 | Ga0070679_100005498 | 3300005530 | Bacteria | 11742 |
| 36 | Ga0070684_100083112 | 3300005535 | Bacteria | 2837 |
| 37 | Ga0070684_100153886 | 3300005535 | Bacteria | 2084 |
| 38 | Ga0070684_100322996 | 3300005535 | Bacteria | 1418 |
| 39 | Ga0068853_100327195 | 3300005539 | Bacteria | 1422 |
| 40 | Ga0070672_100000087 | 3300005543 | Bacteria | 44462 |
| 41 | Ga0070686_100182310 | 3300005544 | Bacteria | 1493 |
| 42 | Ga0070693_100000847 | 3300005547 | Bacteria | 13634 |
| 43 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 44 | Ga0070665_100000950 | 3300005548 | Bacteria | 36935 |
| 45 | Ga0070665_100004145 | 3300005548 | Bacteria | 15248 |
| 46 | Ga0070665_100245776 | 3300005548 | Bacteria | 1790 |
| 47 | Ga0070665_100322541 | 3300005548 | Bacteria | 1549 |
| 48 | Ga0070704_100361845 | 3300005549 | Bacteria | 1228 |
| 49 | Ga0070664_100181247 | 3300005564 | Bacteria | 1872 |
| 50 | Ga0068854_100001172 | 3300005578 | Bacteria | 15711 |
| 51 | Ga0068856_100000629 | 3300005614 | Bacteria | 38394 |
| 52 | Ga0068856_100069173 | 3300005614 | Bacteria | 3491 |
| 53 | Ga0068856_100074910 | 3300005614 | Bacteria | 3352 |
| 54 | Ga0068852_100000006 | 3300005616 | Bacteria | 159569 |
| 55 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 56 | Ga0068866_10000685 | 3300005718 | Bacteria | 15430 |
| 57 | Ga0068866_10029022 | 3300005718 | Bacteria | 2641 |
| 58 | Ga0068851_10002310 | 3300005834 | Bacteria | 8395 |
| 59 | Ga0068851_10010835 | 3300005834 | Bacteria | 4261 |
| 60 | Ga0068863_100000342 | 3300005841 | Bacteria | 47536 |
| 61 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 62 | Ga0068860_100036483 | 3300005843 | Bacteria | 4710 |
| 63 | Ga0068860_100310380 | 3300005843 | Bacteria | 1546 |
| 64 | Ga0068862_100024549 | 3300005844 | Bacteria | 5059 |
| 65 | Ga0081455_10017352 | 3300005937 | Bacteria | 6906 |
| 66 | Ga0081455_10019749 | 3300005937 | Bacteria | 6365 |
| 67 | Ga0081455_10091044 | 3300005937 | Bacteria | 2471 |
| 68 | Ga0081455_10342797 | 3300005937 | Bacteria | 1057 |
| 69 | Ga0081538_10030513 | 3300005981 | Bacteria | 3658 |
| 70 | Ga0081540_1000163 | 3300005983 | Bacteria | 68955 |
| 71 | Ga0081540_1019158 | 3300005983 | Bacteria | 4171 |
| 72 | Ga0081539_10026881 | 3300005985 | Bacteria | 3658 |
| 73 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 74 | Ga0070712_100142519 | 3300006175 | Bacteria | 1831 |
| 75 | Ga0068871_100480837 | 3300006358 | Bacteria | 1117 |
| 76 | Ga0075428_100355918 | 3300006844 | Bacteria | 1571 |
| 77 | Ga0075430_100009324 | 3300006846 | Bacteria | 8297 |
| 78 | Ga0075430_100023451 | 3300006846 | Bacteria | 5253 |
| 79 | Ga0075431_100000536 | 3300006847 | Bacteria | 31867 |
| 80 | Ga0075431_100040061 | 3300006847 | Bacteria | 4828 |
| 81 | Ga0075431_100042964 | 3300006847 | Bacteria | 4663 |
| 82 | Ga0075431_100143555 | 3300006847 | Bacteria | 2460 |
| 83 | Ga0075433_10000900 | 3300006852 | Bacteria | 20958 |
| 84 | Ga0075433_10034271 | 3300006852 | Bacteria | 4359 |
| 85 | Ga0075434_100013735 | 3300006871 | Bacteria | 7722 |
| 86 | Ga0075429_100004332 | 3300006880 | Bacteria | 12189 |
| 87 | Ga0068865_100000023 | 3300006881 | Bacteria | 100785 |
| 88 | Ga0075435_100385473 | 3300007076 | Bacteria | 1204 |
| 89 | Ga0111539_10004345 | 3300009094 | Bacteria | 18557 |
| 90 | Ga0111539_10129291 | 3300009094 | Bacteria | 2957 |
| 91 | Ga0111539_10169453 | 3300009094 | Bacteria | 2551 |
| 92 | Ga0111539_10774614 | 3300009094 | Bacteria | 1117 |
| 93 | Ga0105245_10000020 | 3300009098 | Bacteria | 181774 |
| 94 | Ga0105245_10000254 | 3300009098 | Bacteria | 50918 |
| 95 | Ga0105245_10015858 | 3300009098 | Bacteria | 6564 |
| 96 | Ga0105247_10000316 | 3300009101 | Bacteria | 43374 |
| 97 | Ga0114129_10051723 | 3300009147 | Bacteria | 5767 |
| 98 | Ga0114129_10097421 | 3300009147 | Bacteria | 4072 |
| 99 | Ga0114129_10526991 | 3300009147 | Bacteria | 1540 |
| 100 | Ga0105242_10113913 | 3300009176 | Bacteria | 2310 |
| 101 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 102 | Ga0105237_10102097 | 3300009545 | Bacteria | 2860 |
| 103 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 104 | Ga0105249_10000080 | 3300009553 | Bacteria | 138080 |
| 105 | Ga0105249_10002533 | 3300009553 | Bacteria | 15810 |
| 106 | Ga0105249_10145323 | 3300009553 | Bacteria | 2278 |
| 107 | Ga0105239_10364266 | 3300010375 | Bacteria | 1633 |
| 108 | Ga0105246_10376168 | 3300011119 | Bacteria | 1172 |
| 109 | Ga0157370_10004542 | 3300013104 | Bacteria | 15899 |
| 110 | Ga0157370_10227189 | 3300013104 | Bacteria | 1728 |
| 111 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 112 | Ga0157369_10458545 | 3300013105 | Bacteria | 1320 |
| 113 | Ga0157374_10001772 | 3300013296 | Bacteria | 18163 |
| 114 | Ga0157374_10096749 | 3300013296 | Bacteria | 2824 |
| 115 | Ga0157374_10185757 | 3300013296 | Bacteria | 2032 |
| 116 | Ga0157378_10013002 | 3300013297 | Bacteria | 7282 |
| 117 | Ga0157378_10140283 | 3300013297 | Bacteria | 2244 |
| 118 | Ga0163162_10433860 | 3300013306 | Bacteria | 1446 |
| 119 | Ga0157372_10689686 | 3300013307 | Bacteria | 1189 |
| 120 | Ga0157375_10001213 | 3300013308 | Bacteria | 22205 |
| 121 | Ga0157375_10001538 | 3300013308 | Bacteria | 19849 |
| 122 | Ga0157375_10486598 | 3300013308 | Bacteria | 1399 |
| 123 | Ga0163163_10227094 | 3300014325 | Bacteria | 1916 |
| 124 | Ga0163163_10761582 | 3300014325 | Bacteria | 1031 |
| 125 | Ga0157380_10007734 | 3300014326 | Bacteria | 7650 |
| 126 | Ga0157379_10027346 | 3300014968 | Bacteria | 5078 |
| 127 | Ga0157379_10032581 | 3300014968 | Bacteria | 4646 |
| 128 | Ga0157376_10048384 | 3300014969 | Bacteria | 3515 |
| 129 | Ga0163161_10000021 | 3300017792 | Bacteria | 208779 |
| 130 | Ga0163161_10180860 | 3300017792 | Bacteria | 1617 |
| 131 | Ga0206354_11214690 | 3300020081 | Bacteria | 957 |
| 132 | Ga0207656_10002384 | 3300025321 | Bacteria | 6318 |
| 133 | Ga0207656_10009236 | 3300025321 | Bacteria | 3658 |
| 134 | Ga0207682_10000005 | 3300025893 | Bacteria | 95617 |
| 135 | Ga0207692_10174815 | 3300025898 | Bacteria | 1247 |
| 136 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 137 | Ga0207642_10000281 | 3300025899 | Bacteria | 15233 |
| 138 | Ga0207642_10055639 | 3300025899 | Bacteria | 1811 |
| 139 | Ga0207710_10059383 | 3300025900 | Bacteria | 1731 |
| 140 | Ga0207680_10091384 | 3300025903 | Bacteria | 1937 |
| 141 | Ga0207680_10139551 | 3300025903 | Bacteria | 1606 |
| 142 | Ga0207685_10000027 | 3300025905 | Bacteria | 102101 |
| 143 | Ga0207705_10048298 | 3300025909 | Bacteria | 3061 |
| 144 | Ga0207707_10222372 | 3300025912 | Bacteria | 1643 |
| 145 | Ga0207707_10373437 | 3300025912 | Bacteria | 1227 |
| 146 | Ga0207671_10374382 | 3300025914 | Bacteria | 1131 |
| 147 | Ga0207693_10108715 | 3300025915 | Bacteria | 2175 |
| 148 | Ga0207663_10000498 | 3300025916 | Bacteria | 17164 |
| 149 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 150 | Ga0207652_10001781 | 3300025921 | Bacteria | 18749 |
| 151 | Ga0207652_10002027 | 3300025921 | Bacteria | 17455 |
| 152 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 153 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 154 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 155 | Ga0207687_10000013 | 3300025927 | Bacteria | 299826 |
| 156 | Ga0207664_10361634 | 3300025929 | Bacteria | 1286 |
| 157 | Ga0207690_10100446 | 3300025932 | Bacteria | 2065 |
| 158 | Ga0207690_10212376 | 3300025932 | Bacteria | 1476 |
| 159 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 160 | Ga0207709_10137792 | 3300025935 | Bacteria | 1673 |
| 161 | Ga0207670_10229170 | 3300025936 | Bacteria | 1426 |
| 162 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 163 | Ga0207669_10000096 | 3300025937 | Bacteria | 44213 |
| 164 | Ga0207669_10222963 | 3300025937 | Bacteria | 1385 |
| 165 | Ga0207704_10000159 | 3300025938 | Bacteria | 36005 |
| 166 | Ga0207691_10000382 | 3300025940 | Bacteria | 44447 |
| 167 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 168 | Ga0207661_10000253 | 3300025944 | Bacteria | 34627 |
| 169 | Ga0207661_10000347 | 3300025944 | Bacteria | 29715 |
| 170 | Ga0207661_10096655 | 3300025944 | Bacteria | 2472 |
| 171 | Ga0207661_10238729 | 3300025944 | Bacteria | 1612 |
| 172 | Ga0207679_10011503 | 3300025945 | Bacteria | 5735 |
| 173 | Ga0207667_10328477 | 3300025949 | Bacteria | 1562 |
| 174 | Ga0207651_10118100 | 3300025960 | Bacteria | 2005 |
| 175 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 176 | Ga0207712_10008481 | 3300025961 | Bacteria | 6498 |
| 177 | Ga0207640_10003326 | 3300025981 | Bacteria | 8658 |
| 178 | Ga0207658_10006842 | 3300025986 | Bacteria | 7770 |
| 179 | Ga0207658_10008055 | 3300025986 | Bacteria | 7179 |
| 180 | Ga0207658_10116136 | 3300025986 | Bacteria | 2125 |
| 181 | Ga0207677_10000200 | 3300026023 | Bacteria | 48320 |
| 182 | Ga0207703_10000018 | 3300026035 | Bacteria | 271377 |
| 183 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 184 | Ga0207639_10010573 | 3300026041 | Bacteria | 6393 |
| 185 | Ga0207678_10001753 | 3300026067 | Bacteria | 19870 |
| 186 | Ga0207702_10000158 | 3300026078 | Bacteria | 79984 |
| 187 | Ga0207702_10004125 | 3300026078 | Bacteria | 13025 |
| 188 | Ga0207702_10016358 | 3300026078 | Bacteria | 6141 |
| 189 | Ga0207641_10000238 | 3300026088 | Bacteria | 71152 |
| 190 | Ga0207648_10004426 | 3300026089 | Bacteria | 14414 |
| 191 | Ga0207676_10000195 | 3300026095 | Bacteria | 52951 |
| 192 | Ga0207683_10065768 | 3300026121 | Bacteria | 3197 |
| 193 | Ga0207683_10391523 | 3300026121 | Bacteria | 1278 |
| 194 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 195 | Ga0207428_10067434 | 3300027907 | Bacteria | 2817 |
| 196 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 197 | Ga0268266_10000595 | 3300028379 | Bacteria | 49517 |
| 198 | Ga0268266_10000912 | 3300028379 | Bacteria | 38037 |
| 199 | Ga0268266_10043596 | 3300028379 | Bacteria | 3835 |
| 200 | Ga0268266_10715194 | 3300028379 | Bacteria | 966 |
| 201 | Ga0268265_10079743 | 3300028380 | Bacteria | 2579 |
| 202 | Ga0268264_10027150 | 3300028381 | Bacteria | 4676 |
| 203 | Ga0265337_1000807 | 3300028556 | Bacteria | 16498 |
| 204 | Ga0265326_10000063 | 3300028558 | Bacteria | 61665 |
| 205 | Ga0265319_1000020 | 3300028563 | Bacteria | 153921 |
| 206 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 207 | Ga0265336_10012722 | 3300028666 | Bacteria | 2824 |
| 208 | Ga0265338_10000222 | 3300028800 | Bacteria | 105765 |
| 209 | Ga0265338_10277004 | 3300028800 | Bacteria | 1227 |
| 210 | Ga0265324_10000755 | 3300029957 | Bacteria | 21443 |
| 211 | Ga0265332_10007328 | 3300031238 | Bacteria | 4990 |
| 212 | Ga0265328_10004755 | 3300031239 | Bacteria | 5865 |
| 213 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 214 | Ga0265325_10003811 | 3300031241 | Bacteria | 9722 |
| 215 | Ga0265339_10018762 | 3300031249 | Bacteria | 4073 |
| 216 | Ga0265331_10002295 | 3300031250 | Bacteria | 13036 |
| 217 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 218 | Ga0265316_10030052 | 3300031344 | Bacteria | 4460 |
| 219 | Ga0307513_10444056 | 3300031456 | Bacteria | 1023 |
| 220 | Ga0265314_10000062 | 3300031711 | Bacteria | 159496 |
| 221 | Ga0307409_100791860 | 3300031995 | Bacteria | 955 |
| 222 | Ga0307416_100860939 | 3300032002 | Bacteria | 1005 |
| 223 | Ga0307415_100003131 | 3300032126 | Bacteria | 8381 |
| 224 | Ga0373957_0048693 | 3300035120 | Bacteria | 1616 |
| 225 | Ga0373955_0209037 | 3300035172 | Bacteria | 1163 |
| 226 | Ga0373933_0205492 | 3300035724 | Bacteria | 1261 |
| 227 | Ga0373937_0024047 | 3300036401 | Bacteria | 5493 |
| 228 | Ga0373937_0162767 | 3300036401 | Bacteria | 2092 |
| 229 | Ga0395899_0296856 | 3300037312 | Bacteria | 1095 |
| 230 | Ga0395900_0010300 | 3300037418 | Bacteria | 9566 |
| 231 | Ga0395900_0175051 | 3300037418 | Bacteria | 2183 |
| 232 | Ga0395898_0001408 | 3300037466 | Bacteria | 34249 |
| 233 | Ga0395898_0007911 | 3300037466 | Bacteria | 11280 |
| 234 | Ga0395905_0003057 | 3300037471 | Bacteria | 18119 |
| 235 | Ga0395901_0001723 | 3300038443 | Bacteria | 22589 |
| 236 | Ga0395901_0044457 | 3300038443 | Bacteria | 4607 |
| 237 | Ga0451800_0682346 | 3300041459 | Bacteria | 1024 |
| 238 | Ga0466963_0000105 | 3300044694 | Bacteria | 30285 |
| 239 | Ga0466963_0046051 | 3300044694 | Bacteria | 2875 |
| 240 | Ga0466963_0394914 | 3300044694 | Bacteria | 975 |
| 241 | Ga0466967_0000015 | 3300045976 | Bacteria | 99105 |
| 242 | Ga0466967_0170005 | 3300045976 | Bacteria | 2050 |
| 243 | Ga0495592_0021098 | 3300046454 | Bacteria | 4953 |
| 244 | Ga0495592_0062726 | 3300046454 | Bacteria | 2728 |
| 245 | Ga0495592_0220241 | 3300046454 | Bacteria | 1269 |
| 246 | Ga0495592_0407217 | 3300046454 | Bacteria | 860 |
| 247 | Ga0495603_0001389 | 3300046455 | Bacteria | 14063 |
| 248 | Ga0495603_0001462 | 3300046455 | Bacteria | 13743 |
| 249 | Ga0495603_0004794 | 3300046455 | Bacteria | 8082 |
| 250 | Ga0495629_0435162 | 3300046459 | Bacteria | 889 |
| 251 | Ga0495638_0026746 | 3300046460 | Bacteria | 3739 |
| 252 | Ga0495641_0000228 | 3300046461 | Bacteria | 43671 |
| 253 | Ga0495641_0054490 | 3300046461 | Bacteria | 1817 |
| 254 | Ga0495641_0064403 | 3300046461 | Bacteria | 1651 |
| 255 | Ga0495653_0019096 | 3300046463 | Bacteria | 5562 |
| 256 | Ga0495653_0019236 | 3300046463 | Bacteria | 5538 |
| 257 | Ga0495653_0282533 | 3300046463 | Bacteria | 1089 |
| 258 | Ga0495582_0000726 | 3300046473 | Bacteria | 18153 |
| 259 | Ga0495662_0004260 | 3300046476 | Bacteria | 7201 |
| 260 | Ga0495594_0000029 | 3300046499 | Bacteria | 66789 |
| 261 | Ga0495608_0000222 | 3300046511 | Bacteria | 41114 |
| 262 | Ga0495618_0000008 | 3300046514 | Bacteria | 204578 |
| 263 | Ga0495618_0260440 | 3300046514 | Bacteria | 1086 |
| 264 | Ga0495620_0000995 | 3300046515 | Bacteria | 17517 |
| 265 | Ga0495628_0008516 | 3300046516 | Bacteria | 8789 |
| 266 | Ga0495628_0016259 | 3300046516 | Bacteria | 6208 |
| 267 | Ga0495628_0192792 | 3300046516 | Bacteria | 1538 |
| 268 | Ga0495630_0000121 | 3300046517 | Bacteria | 61852 |
| 269 | Ga0495630_0020713 | 3300046517 | Bacteria | 4851 |
| 270 | Ga0495630_0087917 | 3300046517 | Bacteria | 2347 |
| 271 | Ga0495630_0548762 | 3300046517 | Bacteria | 886 |
| 272 | Ga0495644_0000630 | 3300046523 | Bacteria | 14753 |
| 273 | Ga0495644_0102543 | 3300046523 | Bacteria | 1083 |
| 274 | Ga0495663_0029152 | 3300046525 | Bacteria | 1628 |
| 275 | Ga0495652_0000407 | 3300046529 | Bacteria | 50232 |
| 276 | Ga0495640_0020192 | 3300046533 | Bacteria | 4907 |
| 277 | Ga0495586_0032410 | 3300046535 | Bacteria | 2801 |
| 278 | Ga0495587_0028219 | 3300046536 | Bacteria | 3414 |
| 279 | Ga0495587_0049993 | 3300046536 | Bacteria | 2474 |
| 280 | Ga0495587_0327013 | 3300046536 | Bacteria | 856 |
| 281 | Ga0495598_0007458 | 3300046537 | Bacteria | 2511 |
| 282 | Ga0495621_0018311 | 3300046539 | Bacteria | 2273 |
| 283 | Ga0495645_0095649 | 3300046543 | Bacteria | 2117 |
| 284 | Ga0495622_0000789 | 3300046557 | Bacteria | 17646 |
| 285 | Ga0495667_0000018 | 3300046559 | Bacteria | 188610 |
| 286 | Ga0495656_0001289 | 3300046615 | Bacteria | 8153 |
| 287 | Ga0495634_0000059 | 3300046642 | Bacteria | 88314 |
| 288 | Ga0495634_0018299 | 3300046642 | Bacteria | 4990 |
| 289 | Ga0495625_0000171 | 3300046660 | Bacteria | 101895 |
| 290 | Ga0495635_0000062 | 3300046663 | Bacteria | 65631 |
| 291 | Ga0495635_0254930 | 3300046663 | Bacteria | 1182 |
| 292 | Ga0495588_0000134 | 3300046674 | Bacteria | 117581 |
| 293 | Ga0495657_0255540 | 3300046675 | Bacteria | 1054 |
| 294 | Ga0495599_0057672 | 3300046678 | Bacteria | 2430 |
| 295 | Ga0495646_0125474 | 3300046680 | Bacteria | 1449 |
| 296 | Ga0495647_0000017 | 3300046681 | Bacteria | 83387 |
| 297 | Ga0495658_0000034 | 3300046683 | Bacteria | 69176 |
| 298 | Ga0495669_0000310 | 3300046684 | Bacteria | 26921 |
| 299 | Ga0495613_0000124 | 3300046689 | Bacteria | 75971 |
| 300 | Ga0495613_0000674 | 3300046689 | Bacteria | 26995 |
| 301 | Ga0495613_0175400 | 3300046689 | Bacteria | 1520 |
| 302 | Ga0495613_0342476 | 3300046689 | Bacteria | 1028 |
| 303 | Ga0495624_0001256 | 3300046690 | Bacteria | 20032 |
| 304 | Ga0495670_0027781 | 3300046691 | Bacteria | 2805 |
| 305 | Ga0495649_0004181 | 3300046694 | Bacteria | 9473 |
| 306 | Ga0495600_0001066 | 3300046809 | Bacteria | 14880 |
| 307 | Ga0495600_0009557 | 3300046809 | Bacteria | 5995 |
| 308 | Ga0495581_0030089 | 3300047315 | Bacteria | 3148 |
| 309 | Ga0495604_0000055 | 3300047317 | Bacteria | 100430 |
| 310 | Ga0495604_0003861 | 3300047317 | Bacteria | 11937 |
| 311 | Ga0495674_0000064 | 3300047319 | Bacteria | 71275 |
| 312 | Ga0495672_0025151 | 3300047320 | Bacteria | 3818 |
| 313 | Ga0495672_0169658 | 3300047320 | Bacteria | 1114 |
| 314 | Ga0495676_0000130 | 3300047321 | Bacteria | 56693 |
| 315 | Ga0495676_0025700 | 3300047321 | Bacteria | 5080 |
| 316 | Ga0495676_0322193 | 3300047321 | Bacteria | 1038 |
| 317 | Ga0495680_0002282 | 3300047322 | Bacteria | 19745 |
| 318 | Ga0495680_0016125 | 3300047322 | Bacteria | 6424 |
| 319 | Ga0495680_0402734 | 3300047322 | Bacteria | 944 |
| 320 | Ga0495680_0453070 | 3300047322 | Bacteria | 878 |
| 321 | Ga0495675_0172649 | 3300047444 | Bacteria | 1327 |
| 322 | Ga0495679_012724 | 3300047446 | Bacteria | 3188 |
| 323 | Ga0495686_0054323 | 3300047472 | Bacteria | 2508 |
| 324 | Ga0495593_0122939 | 3300047673 | Bacteria | 1320 |
| 325 | Ga0495602_0001349 | 3300048088 | Bacteria | 24226 |
| 326 | Ga0495602_0071241 | 3300048088 | Bacteria | 2969 |
| 327 | Ga0495614_0014178 | 3300048089 | Bacteria | 3493 |
| 328 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 329 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 330 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 331 | Ga0496101_0000101 | 3300048904 | Bacteria | 89424 |
| 332 | Ga0496102_0003911 | 3300048905 | Bacteria | 12617 |
| 333 | Ga0496103_0035998 | 3300048906 | Bacteria | 3031 |
| 334 | Ga0496103_0057594 | 3300048906 | Bacteria | 2413 |
| 335 | Ga0496103_0154501 | 3300048906 | Bacteria | 1470 |
| 336 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 337 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 338 | Ga0496104_0000190 | 3300048907 | Bacteria | 55572 |
| 339 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 340 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 341 | Ga0496105_0054866 | 3300048908 | Bacteria | 3290 |
| 342 | Ga0496105_0092816 | 3300048908 | Bacteria | 2492 |
| 343 | Ga0496106_0000084 | 3300048909 | Bacteria | 74135 |
| 344 | Ga0496106_0000151 | 3300048909 | Bacteria | 51430 |
| 345 | Ga0496106_0119979 | 3300048909 | Bacteria | 2055 |
| 346 | Ga0496106_0352840 | 3300048909 | Bacteria | 1182 |
| 347 | Ga0496107_0000003 | 3300048910 | Bacteria | 304038 |
| 348 | Ga0496107_0000011 | 3300048910 | Bacteria | 201631 |
| 349 | Ga0496107_0092369 | 3300048910 | Bacteria | 2213 |
| 350 | Ga0496107_0182721 | 3300048910 | Bacteria | 1557 |
| 351 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 352 | Ga0496108_0000587 | 3300048911 | Bacteria | 28462 |
| 353 | Ga0496108_0006431 | 3300048911 | Bacteria | 9524 |
| 354 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 355 | Ga0496109_0001118 | 3300048912 | Bacteria | 22284 |
| 356 | Ga0496110_0000021 | 3300048913 | Bacteria | 77064 |
| 357 | Ga0496110_0016388 | 3300048913 | Bacteria | 6188 |
| 358 | Ga0496110_0029190 | 3300048913 | Bacteria | 4744 |
| 359 | Ga0496111_0000009 | 3300048914 | Bacteria | 93943 |
| 360 | Ga0496111_0098241 | 3300048914 | Bacteria | 2150 |
| 361 | Ga0496111_0113869 | 3300048914 | Bacteria | 1993 |
| 362 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 363 | Ga0496112_0198200 | 3300048915 | Bacteria | 1968 |
| 364 | Ga0496112_0323340 | 3300048915 | Bacteria | 1487 |
| 365 | Ga0496112_0399150 | 3300048915 | Bacteria | 1315 |
| 366 | Ga0496113_0054719 | 3300048916 | Bacteria | 2988 |
| 367 | Ga0496113_0240534 | 3300048916 | Bacteria | 1444 |
| 368 | Ga0496114_0009597 | 3300048917 | Bacteria | 7688 |
| 369 | Ga0496114_0234374 | 3300048917 | Bacteria | 1613 |
| 370 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 371 | Ga0496115_0028569 | 3300048918 | Bacteria | 4373 |
| 372 | Ga0496116_0000735 | 3300048919 | Bacteria | 41771 |
| 373 | Ga0496117_0016612 | 3300048920 | Bacteria | 6198 |
| 374 | Ga0496118_0000833 | 3300048921 | Bacteria | 49030 |
| 375 | Ga0496118_0095828 | 3300048921 | Bacteria | 2024 |
| 376 | Ga0496119_0001290 | 3300048922 | Bacteria | 30949 |
| 377 | Ga0496119_0033172 | 3300048922 | Bacteria | 3428 |
| 378 | Ga0496119_0041797 | 3300048922 | Bacteria | 2914 |
| 379 | Ga0496120_0014960 | 3300048923 | Bacteria | 5140 |
| 380 | Ga0496120_0028190 | 3300048923 | Bacteria | 3443 |
| 381 | Ga0496121_0252630 | 3300048924 | Bacteria | 1222 |
| 382 | Ga0496124_0023648 | 3300048927 | Bacteria | 5606 |
| 383 | Ga0496125_0044444 | 3300048928 | Bacteria | 3757 |
| 384 | Ga0496126_0007040 | 3300048929 | Bacteria | 12406 |
| 385 | Ga0496126_0048803 | 3300048929 | Bacteria | 3866 |
| 386 | Ga0501031_0009252 | 3300049568 | Bacteria | 6401 |
| 387 | Ga0501032_0000965 | 3300049569 | Bacteria | 23261 |
| 388 | Ga0501033_0000900 | 3300049570 | Bacteria | 27183 |
| 389 | Ga0501034_0080673 | 3300049571 | Bacteria | 3256 |
| 390 | Ga0501036_0001844 | 3300049572 | Bacteria | 16440 |
| 391 | Ga0501037_0002603 | 3300049573 | Bacteria | 13022 |
| 392 | Ga0501038_0006062 | 3300049574 | Bacteria | 11182 |
| 393 | Ga0501038_0132169 | 3300049574 | Bacteria | 2048 |
| 394 | Ga0501039_0011207 | 3300049575 | Bacteria | 6832 |
| 395 | Ga0501040_0066761 | 3300049576 | Bacteria | 2478 |
| 396 | Ga0501040_0138465 | 3300049576 | Bacteria | 1714 |
| 397 | Ga0501040_0215095 | 3300049576 | Bacteria | 1367 |
| 398 | Ga0501042_0020286 | 3300049578 | Bacteria | 4625 |
| 399 | Ga0501042_0051097 | 3300049578 | Bacteria | 2949 |
| 400 | Ga0501042_0061140 | 3300049578 | Bacteria | 2691 |
| 401 | Ga0501043_0004468 | 3300049579 | Bacteria | 11360 |
| 402 | Ga0501046_0000702 | 3300049580 | Bacteria | 32344 |
| 403 | Ga0501047_0009430 | 3300049581 | Bacteria | 9222 |
| 404 | Ga0501047_0012322 | 3300049581 | Bacteria | 8094 |
| 405 | Ga0501047_0146787 | 3300049581 | Bacteria | 2235 |
| 406 | Ga0501047_0227146 | 3300049581 | Bacteria | 1721 |
| 407 | Ga0501048_0000888 | 3300049582 | Bacteria | 22108 |
| 408 | Ga0501048_0243478 | 3300049582 | Bacteria | 1276 |
| 409 | Ga0501048_0398073 | 3300049582 | Bacteria | 984 |
| 410 | Ga0501048_0469396 | 3300049582 | Bacteria | 902 |
| 411 | Ga0501067_0047244 | 3300049583 | Bacteria | 2388 |
| 412 | Ga0501068_0005996 | 3300049584 | Bacteria | 6674 |
| 413 | Ga0501068_0171192 | 3300049584 | Bacteria | 1371 |
| 414 | Ga0501069_0000880 | 3300049585 | Bacteria | 14316 |
| 415 | Ga0501070_0000680 | 3300049586 | Bacteria | 31108 |
| 416 | Ga0501070_0005582 | 3300049586 | Bacteria | 10731 |
| 417 | Ga0501070_0046829 | 3300049586 | Bacteria | 3596 |
| 418 | Ga0501070_0053684 | 3300049586 | Bacteria | 3342 |
| 419 | Ga0501070_0065276 | 3300049586 | Bacteria | 3013 |
| 420 | Ga0501070_0130458 | 3300049586 | Bacteria | 2076 |
| 421 | Ga0501072_0008345 | 3300049588 | Bacteria | 7867 |
| 422 | Ga0501072_0020950 | 3300049588 | Bacteria | 5068 |
| 423 | Ga0501073_0006128 | 3300049589 | Bacteria | 8974 |
| 424 | Ga0501074_0015768 | 3300049590 | Bacteria | 5493 |
| 425 | Ga0501075_0001068 | 3300049591 | Bacteria | 17616 |
| 426 | Ga0501075_0015147 | 3300049591 | Bacteria | 5530 |
| 427 | Ga0501075_0033895 | 3300049591 | Bacteria | 3800 |
| 428 | Ga0501075_0210589 | 3300049591 | Bacteria | 1483 |
| 429 | Ga0501076_0053222 | 3300049592 | Bacteria | 3207 |
| 430 | Ga0501077_0189215 | 3300049593 | Bacteria | 1307 |
| 431 | Ga0501079_0051849 | 3300049741 | Bacteria | 3168 |
| 432 | Ga0501080_0058430 | 3300049742 | Bacteria | 3590 |
| 433 | Ga0501081_0041306 | 3300049743 | Bacteria | 3158 |
| 434 | Ga0501081_0239196 | 3300049743 | Bacteria | 1324 |
| 435 | Ga0501083_0001364 | 3300049744 | Bacteria | 16559 |
| 436 | Ga0501035_0000887 | 3300049822 | Bacteria | 31755 |
| 437 | Ga0501044_0002514 | 3300049823 | Bacteria | 20894 |
| 438 | Ga0501044_0070857 | 3300049823 | Bacteria | 3545 |
| 439 | Ga0501044_0082327 | 3300049823 | Bacteria | 3257 |
| 440 | nmdc:mga0yw44_23848_c1 | 3300050492 | Bacteria | 3453 |
| 441 | nmdc:mga09592_26920_c1 | 3300050508 | Bacteria | 4768 |
| 442 | nmdc:mga0qj67_435142_c1 | 3300050509 | Bacteria | 1057 |
| 443 | nmdc:mga0qj67_54467_c1 | 3300050509 | Bacteria | 3168 |
| 444 | nmdc:mga06r32_11329_c1 | 3300050510 | Bacteria | 8031 |
| 445 | nmdc:mga06r32_380412_c1 | 3300050510 | Bacteria | 1395 |
| 446 | nmdc:mga06r32_622951_c1 | 3300050510 | Bacteria | 1049 |
| 447 | nmdc:mga08y16_16065_c1 | 3300050511 | Bacteria | 7871 |
| 448 | nmdc:mga08y16_168795_c1 | 3300050511 | Bacteria | 2273 |
| 449 | nmdc:mga0n895_52385_c1 | 3300050512 | Bacteria | 4006 |
| 450 | nmdc:mga0n895_866828_c1 | 3300050512 | Bacteria | 890 |
| 451 | nmdc:mga08x19_180666_c1 | 3300050514 | Bacteria | 1440 |
| 452 | nmdc:mga08x19_352625_c1 | 3300050514 | Bacteria | 1027 |
| 453 | nmdc:mga0a205_68435_c1 | 3300050515 | Bacteria | 3429 |
| 454 | nmdc:mga0a205_6_c1 | 3300050515 | Bacteria | 129758 |
| 455 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 456 | Ga0495601_0000035 | 3300053077 | Bacteria | 92903 |
| 457 | Ga0495601_0014416 | 3300053077 | Bacteria | 4763 |
| 458 | Ga0495601_0016138 | 3300053077 | Bacteria | 4522 |
| 459 | Ga0495601_0037517 | 3300053077 | Bacteria | 3030 |
| 460 | Ga0495601_0139593 | 3300053077 | Bacteria | 1580 |
| 461 | Ga0495601_0292456 | 3300053077 | Bacteria | 1062 |
| 462 | Ga0495612_0002477 | 3300053078 | Bacteria | 7606 |
| 463 | Ga0495612_0003571 | 3300053078 | Bacteria | 6443 |
| 464 | Ga0495595_0000456 | 3300053084 | Bacteria | 15475 |
| 465 | Ga0495595_0074790 | 3300053084 | Bacteria | 1606 |
| 466 | Ga0495595_0106605 | 3300053084 | Bacteria | 1356 |
| 467 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 468 | Ga0495619_0000131 | 3300053085 | Bacteria | 55500 |
| 469 | Ga0495619_0000157 | 3300053085 | Bacteria | 49848 |
| 470 | Ga0495619_0000438 | 3300053085 | Bacteria | 28186 |
| 471 | Ga0495619_0028266 | 3300053085 | Bacteria | 3616 |
| 472 | Ga0495619_0050588 | 3300053085 | Bacteria | 2743 |
| 473 | Ga0495619_0274866 | 3300053085 | Bacteria | 1167 |
| 474 | Ga0500566_0008680 | 3300053094 | Bacteria | 6011 |
| 475 | Ga0500614_000486 | 3300053123 | Bacteria | 10332 |
| 476 | Ga0500658_0103321 | 3300053134 | Bacteria | 1246 |
| 477 | Ga0501084_0404615 | 3300054114 | Bacteria | 1154 |
| 478 | Ga0501082_0006817 | 3300060353 | Bacteria | 9875 |
| 479 | Ga0501082_0143281 | 3300060353 | Bacteria | 2074 |
| 480 | Ga0530510_0010239 | 3300061734 | Bacteria | 6569 |
| 481 | Ga0530510_0010817 | 3300061734 | Bacteria | 6401 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100005875 | Ga0070683_1000058758 | 206 |
| 2 | 3300025944 | Ga0207661_10000347 | Ga0207661_1000034720 | 206 |
| 3 | 3300026121 | Ga0207683_10391523 | Ga0207683_103915231 | 206 |
| 4 | 3300005367 | Ga0070667_100008067 | Ga0070667_1000080677 | 210 |
| 5 | 3300005548 | Ga0070665_100322541 | Ga0070665_1003225412 | 210 |
| 6 | 3300005843 | Ga0068860_100310380 | Ga0068860_1003103802 | 210 |
| 7 | 3300005844 | Ga0068862_100024549 | Ga0068862_1000245492 | 210 |
| 8 | 3300009098 | Ga0105245_10015858 | Ga0105245_100158583 | 210 |
| 9 | 3300009553 | Ga0105249_10002533 | Ga0105249_1000253314 | 210 |
| 10 | 3300013306 | Ga0163162_10433860 | Ga0163162_104338602 | 210 |
| 11 | 3300014325 | Ga0163163_10761582 | Ga0163163_107615821 | 210 |
| 12 | 3300014968 | Ga0157379_10032581 | Ga0157379_100325814 | 210 |
| 13 | 3300025961 | Ga0207712_10008481 | Ga0207712_100084817 | 210 |
| 14 | 3300025986 | Ga0207658_10006842 | Ga0207658_100068427 | 210 |
| 15 | 3300028380 | Ga0268265_10079743 | Ga0268265_100797436 | 210 |
| 16 | 3300005366 | Ga0070659_100390562 | Ga0070659_1003905621 | 211 |
| 17 | 3300020081 | Ga0206354_11214690 | Ga0206354_112146901 | 211 |
| 18 | 3300025932 | Ga0207690_10212376 | Ga0207690_102123762 | 211 |
| 19 | 3300049582 | Ga0501048_0469396 | Ga0501048_0469396_232_885 | 211 |
| 20 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_11653_12387 | 211 |
| 21 | 3300053085 | Ga0495619_0000131 | Ga0495619_0000131_10838_11572 | 211 |
| 22 | 3300005344 | Ga0070661_100000102 | Ga0070661_10000010233 | 212 |
| 23 | 3300005834 | Ga0068851_10002310 | Ga0068851_100023109 | 212 |
| 24 | 3300005981 | Ga0081538_10030513 | Ga0081538_100305135 | 212 |
| 25 | 3300025321 | Ga0207656_10002384 | Ga0207656_100023843 | 212 |
| 26 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009219 | 212 |
| 27 | 3300047320 | Ga0495672_0025151 | Ga0495672_0025151_1948_2682 | 212 |
| 28 | 3300049582 | Ga0501048_0243478 | Ga0501048_0243478_18_752 | 212 |
| 29 | 3300049582 | Ga0501048_0398073 | Ga0501048_0398073_12_650 | 212 |
| 30 | 3300049593 | Ga0501077_0189215 | Ga0501077_0189215_43_777 | 212 |
| 31 | 3300049743 | Ga0501081_0239196 | Ga0501081_0239196_273_1007 | 212 |
| 32 | 3300005435 | Ga0070714_100408890 | Ga0070714_1004088902 | 216 |
| 33 | 3300005614 | Ga0068856_100069173 | Ga0068856_1000691733 | 216 |
| 34 | 3300005616 | Ga0068852_100000006 | Ga0068852_100000006130 | 216 |
| 35 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008291 | 216 |
| 36 | 3300025929 | Ga0207664_10361634 | Ga0207664_103616342 | 216 |
| 37 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006685 | 216 |
| 38 | 3300026078 | Ga0207702_10016358 | Ga0207702_100163587 | 216 |
| 39 | 3300026142 | Ga0207698_10000013 | Ga0207698_1000001359 | 216 |
| 40 | 3300046523 | Ga0495644_0102543 | Ga0495644_0102543_272_1009 | 216 |
| 41 | 3300046525 | Ga0495663_0029152 | Ga0495663_0029152_823_1560 | 216 |
| 42 | 3300005367 | Ga0070667_100003553 | Ga0070667_10000355318 | 218 |
| 43 | 3300005548 | Ga0070665_100004145 | Ga0070665_10000414515 | 218 |
| 44 | 3300025903 | Ga0207680_10139551 | Ga0207680_101395512 | 218 |
| 45 | 3300025986 | Ga0207658_10008055 | Ga0207658_100080552 | 218 |
| 46 | 3300028379 | Ga0268266_10000595 | Ga0268266_1000059532 | 218 |
| 47 | 3300046536 | Ga0495587_0327013 | Ga0495587_0327013_14_685 | 218 |
| 48 | 3300005335 | Ga0070666_10011653 | Ga0070666_100116537 | 219 |
| 49 | 3300005365 | Ga0070688_100000393 | Ga0070688_10000039318 | 219 |
| 50 | 3300005466 | Ga0070685_10000141 | Ga0070685_1000014136 | 219 |
| 51 | 3300005937 | Ga0081455_10017352 | Ga0081455_100173525 | 219 |
| 52 | 3300013104 | Ga0157370_10227189 | Ga0157370_102271892 | 219 |
| 53 | 3300013296 | Ga0157374_10185757 | Ga0157374_101857571 | 219 |
| 54 | 3300013297 | Ga0157378_10140283 | Ga0157378_101402834 | 219 |
| 55 | 3300025903 | Ga0207680_10091384 | Ga0207680_100913842 | 219 |
| 56 | 3300045976 | Ga0466967_0000015 | Ga0466967_0000015_2950_3684 | 219 |
| 57 | 3300046461 | Ga0495641_0064403 | Ga0495641_0064403_75_809 | 219 |
| 58 | 3300048913 | Ga0496110_0000021 | Ga0496110_0000021_13837_14571 | 219 |
| 59 | 3300048914 | Ga0496111_0000009 | Ga0496111_0000009_62530_63264 | 219 |
| 60 | 3300005937 | Ga0081455_10342797 | Ga0081455_103427972 | 220 |
| 61 | 3300006844 | Ga0075428_100355918 | Ga0075428_1003559182 | 220 |
| 62 | 3300009094 | Ga0111539_10129291 | Ga0111539_101292913 | 220 |
| 63 | 3300046537 | Ga0495598_0007458 | Ga0495598_0007458_1810_2472 | 220 |
| 64 | 3300050511 | nmdc:mga08y16_168795_c1 | nmdc:mga08y16_168795_c1_775_1509 | 220 |
| 65 | 3300014326 | Ga0157380_10007734 | Ga0157380_100077343 | 221 |
| 66 | 3300046533 | Ga0495640_0020192 | Ga0495640_0020192_1138_1884 | 221 |
| 67 | 3300047319 | Ga0495674_0000064 | Ga0495674_0000064_52201_52947 | 221 |
| 68 | 3300005329 | Ga0070683_100000411 | Ga0070683_10000041129 | 222 |
| 69 | 3300005354 | Ga0070675_100000027 | Ga0070675_10000002753 | 222 |
| 70 | 3300005466 | Ga0070685_10000616 | Ga0070685_100006167 | 222 |
| 71 | 3300005543 | Ga0070672_100000087 | Ga0070672_10000008746 | 222 |
| 72 | 3300005548 | Ga0070665_100000950 | Ga0070665_10000095018 | 222 |
| 73 | 3300005983 | Ga0081540_1019158 | Ga0081540_10191583 | 222 |
| 74 | 3300025926 | Ga0207659_10000010 | Ga0207659_1000001046 | 222 |
| 75 | 3300025940 | Ga0207691_10000382 | Ga0207691_100003825 | 222 |
| 76 | 3300025944 | Ga0207661_10000253 | Ga0207661_1000025321 | 222 |
| 77 | 3300028379 | Ga0268266_10000912 | Ga0268266_1000091236 | 222 |
| 78 | 3300046674 | Ga0495588_0000134 | Ga0495588_0000134_33295_34029 | 222 |
| 79 | 3300046689 | Ga0495613_0000674 | Ga0495613_0000674_6200_6934 | 222 |
| 80 | 3300046517 | Ga0495630_0548762 | Ga0495630_0548762_34_720 | 223 |
| 81 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001433 | 224 |
| 82 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002152 | 224 |
| 83 | 3300025937 | Ga0207669_10000001 | Ga0207669_10000001390 | 224 |
| 84 | 3300049578 | Ga0501042_0061140 | Ga0501042_0061140_1941_2675 | 225 |
| 85 | 3300005937 | Ga0081455_10019749 | Ga0081455_100197496 | 226 |
| 86 | 3300044694 | Ga0466963_0394914 | Ga0466963_0394914_59_805 | 226 |
| 87 | 3300002459 | JGI24751J29686_10026938 | JGI24751J29686_100269382 | 227 |
| 88 | 3300005329 | Ga0070683_100033949 | Ga0070683_1000339496 | 227 |
| 89 | 3300005458 | Ga0070681_10411564 | Ga0070681_104115642 | 227 |
| 90 | 3300005834 | Ga0068851_10010835 | Ga0068851_100108351 | 227 |
| 91 | 3300011119 | Ga0105246_10376168 | Ga0105246_103761682 | 227 |
| 92 | 3300025321 | Ga0207656_10009236 | Ga0207656_100092361 | 227 |
| 93 | 3300025912 | Ga0207707_10222372 | Ga0207707_102223722 | 227 |
| 94 | 3300025936 | Ga0207670_10229170 | Ga0207670_102291702 | 227 |
| 95 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_447613_448350 | 227 |
| 96 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_447613_448350 | 227 |
| 97 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_307481_308218 | 227 |
| 98 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_179838_180575 | 227 |
| 99 | 3300048909 | Ga0496106_0000084 | Ga0496106_0000084_40680_41417 | 227 |
| 100 | 3300048910 | Ga0496107_0000003 | Ga0496107_0000003_96356_97093 | 227 |
| 101 | 3300048924 | Ga0496121_0252630 | Ga0496121_0252630_476_1210 | 227 |
| 102 | 3300048927 | Ga0496124_0023648 | Ga0496124_0023648_316_1050 | 227 |
| 103 | 3300049581 | Ga0501047_0146787 | Ga0501047_0146787_1420_2166 | 228 |
| 104 | 3300047321 | Ga0495676_0322193 | Ga0495676_0322193_80_814 | 229 |
| 105 | 3300005364 | Ga0070673_100008824 | Ga0070673_1000088246 | 230 |
| 106 | 3300025960 | Ga0207651_10118100 | Ga0207651_101181003 | 230 |
| 107 | 3300037312 | Ga0395899_0296856 | Ga0395899_0296856_141_875 | 230 |
| 108 | 3300037466 | Ga0395898_0007911 | Ga0395898_0007911_5620_6354 | 230 |
| 109 | 3300038443 | Ga0395901_0044457 | Ga0395901_0044457_1460_2194 | 230 |
| 110 | 3300047322 | Ga0495680_0402734 | Ga0495680_0402734_128_862 | 230 |
| 111 | 3300048909 | Ga0496106_0352840 | Ga0496106_0352840_131_877 | 230 |
| 112 | 3300049588 | Ga0501072_0020950 | Ga0501072_0020950_3059_3793 | 230 |
| 113 | 3300049741 | Ga0501079_0051849 | Ga0501079_0051849_460_1194 | 230 |
| 114 | 3300061734 | Ga0530510_0010239 | Ga0530510_0010239_2521_3255 | 230 |
| 115 | 3300005457 | Ga0070662_100000004 | Ga0070662_100000004169 | 231 |
| 116 | 3300025933 | Ga0207706_10000012 | Ga0207706_1000001249 | 231 |
| 117 | 3300047321 | Ga0495676_0000130 | Ga0495676_0000130_12441_13175 | 231 |
| 118 | 3300047446 | Ga0495679_012724 | Ga0495679_012724_849_1586 | 231 |
| 119 | 3300048089 | Ga0495614_0014178 | Ga0495614_0014178_2637_3371 | 231 |
| 120 | 3300048910 | Ga0496107_0182721 | Ga0496107_0182721_205_939 | 231 |
| 121 | 3300005356 | Ga0070674_100000017 | Ga0070674_1000000178 | 232 |
| 122 | 3300005530 | Ga0070679_100005498 | Ga0070679_10000549812 | 232 |
| 123 | 3300005549 | Ga0070704_100361845 | Ga0070704_1003618452 | 232 |
| 124 | 3300005937 | Ga0081455_10091044 | Ga0081455_100910442 | 232 |
| 125 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011229 | 232 |
| 126 | 3300025921 | Ga0207652_10001781 | Ga0207652_1000178122 | 232 |
| 127 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004393 | 232 |
| 128 | 3300026067 | Ga0207678_10001753 | Ga0207678_1000175315 | 232 |
| 129 | 3300048910 | Ga0496107_0092369 | Ga0496107_0092369_1205_1942 | 232 |
| 130 | 3300005333 | Ga0070677_10000103 | Ga0070677_100001032 | 233 |
| 131 | 3300005578 | Ga0068854_100001172 | Ga0068854_1000011727 | 233 |
| 132 | 3300013308 | Ga0157375_10486598 | Ga0157375_104865982 | 233 |
| 133 | 3300025893 | Ga0207682_10000005 | Ga0207682_1000000556 | 233 |
| 134 | 3300025981 | Ga0207640_10003326 | Ga0207640_100033268 | 233 |
| 135 | 3300031456 | Ga0307513_10444056 | Ga0307513_104440561 | 233 |
| 136 | 3300046691 | Ga0495670_0027781 | Ga0495670_0027781_1350_2084 | 233 |
| 137 | 3300046809 | Ga0495600_0009557 | Ga0495600_0009557_2520_3254 | 233 |
| 138 | 3300047317 | Ga0495604_0003861 | Ga0495604_0003861_6429_7163 | 233 |
| 139 | 3300048908 | Ga0496105_0054866 | Ga0496105_0054866_207_953 | 233 |
| 140 | 3300053085 | Ga0495619_0000438 | Ga0495619_0000438_23787_24521 | 233 |
| 141 | 3300005435 | Ga0070714_100135464 | Ga0070714_1001354642 | 234 |
| 142 | 3300005614 | Ga0068856_100000629 | Ga0068856_10000062919 | 234 |
| 143 | 3300006881 | Ga0068865_100000023 | Ga0068865_10000002377 | 234 |
| 144 | 3300009098 | Ga0105245_10000254 | Ga0105245_1000025424 | 234 |
| 145 | 3300013104 | Ga0157370_10004542 | Ga0157370_1000454219 | 234 |
| 146 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020171 | 234 |
| 147 | 3300014968 | Ga0157379_10027346 | Ga0157379_100273465 | 234 |
| 148 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007450 | 234 |
| 149 | 3300025938 | Ga0207704_10000159 | Ga0207704_1000015933 | 234 |
| 150 | 3300025944 | Ga0207661_10096655 | Ga0207661_100966553 | 234 |
| 151 | 3300026078 | Ga0207702_10000158 | Ga0207702_1000015859 | 234 |
| 152 | 3300044694 | Ga0466963_0000105 | Ga0466963_0000105_27394_28131 | 234 |
| 153 | 3300046476 | Ga0495662_0004260 | Ga0495662_0004260_6415_7149 | 234 |
| 154 | 3300046517 | Ga0495630_0000121 | Ga0495630_0000121_4979_5713 | 234 |
| 155 | 3300047673 | Ga0495593_0122939 | Ga0495593_0122939_253_987 | 234 |
| 156 | 3300053077 | Ga0495601_0014416 | Ga0495601_0014416_814_1548 | 234 |
| 157 | 3300005341 | Ga0070691_10000027 | Ga0070691_1000002745 | 235 |
| 158 | 3300005366 | Ga0070659_100292007 | Ga0070659_1002920072 | 235 |
| 159 | 3300005841 | Ga0068863_100000342 | Ga0068863_10000034230 | 235 |
| 160 | 3300005843 | Ga0068860_100036483 | Ga0068860_1000364832 | 235 |
| 161 | 3300006852 | Ga0075433_10000900 | Ga0075433_100009004 | 235 |
| 162 | 3300013308 | Ga0157375_10001538 | Ga0157375_1000153817 | 235 |
| 163 | 3300014969 | Ga0157376_10048384 | Ga0157376_100483843 | 235 |
| 164 | 3300025932 | Ga0207690_10100446 | Ga0207690_101004463 | 235 |
| 165 | 3300026088 | Ga0207641_10000238 | Ga0207641_1000023864 | 235 |
| 166 | 3300028381 | Ga0268264_10027150 | Ga0268264_100271502 | 235 |
| 167 | 3300028563 | Ga0265319_1000020 | Ga0265319_1000020128 | 235 |
| 168 | 3300028800 | Ga0265338_10000222 | Ga0265338_10000222118 | 235 |
| 169 | 3300031241 | Ga0265325_10003811 | Ga0265325_100038119 | 235 |
| 170 | 3300046463 | Ga0495653_0019236 | Ga0495653_0019236_1690_2424 | 235 |
| 171 | 3300046689 | Ga0495613_0000124 | Ga0495613_0000124_68655_69389 | 235 |
| 172 | 3300049591 | Ga0501075_0210589 | Ga0501075_0210589_542_1249 | 235 |
| 173 | 3300017792 | Ga0163161_10000021 | Ga0163161_10000021208 | 236 |
| 174 | 3300046517 | Ga0495630_0087917 | Ga0495630_0087917_101_838 | 236 |
| 175 | 3300047322 | Ga0495680_0453070 | Ga0495680_0453070_94_804 | 236 |
| 176 | 3300048917 | Ga0496114_0009597 | Ga0496114_0009597_4090_4824 | 236 |
| 177 | 3300049823 | Ga0501044_0070857 | Ga0501044_0070857_926_1672 | 236 |
| 178 | 3300053085 | Ga0495619_0274866 | Ga0495619_0274866_21_731 | 236 |
| 179 | 3300032126 | Ga0307415_100003131 | Ga0307415_1000031318 | 237 |
| 180 | 3300046455 | Ga0495603_0001389 | Ga0495603_0001389_3728_4462 | 237 |
| 181 | 3300046536 | Ga0495587_0028219 | Ga0495587_0028219_135_869 | 237 |
| 182 | 3300049574 | Ga0501038_0132169 | Ga0501038_0132169_739_1473 | 237 |
| 183 | 3300049576 | Ga0501040_0215095 | Ga0501040_0215095_389_1123 | 237 |
| 184 | 3300049588 | Ga0501072_0008345 | Ga0501072_0008345_1441_2175 | 237 |
| 185 | 3300049591 | Ga0501075_0033895 | Ga0501075_0033895_180_914 | 237 |
| 186 | 3300049592 | Ga0501076_0053222 | Ga0501076_0053222_1371_2105 | 237 |
| 187 | 3300049743 | Ga0501081_0041306 | Ga0501081_0041306_1193_1927 | 237 |
| 188 | 3300054114 | Ga0501084_0404615 | Ga0501084_0404615_285_1019 | 237 |
| 189 | 3300060353 | Ga0501082_0143281 | Ga0501082_0143281_718_1452 | 237 |
| 190 | 3300061734 | Ga0530510_0010817 | Ga0530510_0010817_1135_1869 | 237 |
| 191 | 3300046461 | Ga0495641_0054490 | Ga0495641_0054490_717_1454 | 239 |
| 192 | 3300046515 | Ga0495620_0000995 | Ga0495620_0000995_9068_9805 | 240 |
| 193 | 3300013297 | Ga0157378_10013002 | Ga0157378_100130027 | 242 |
| 194 | 3300046663 | Ga0495635_0254930 | Ga0495635_0254930_244_972 | 242 |
| 195 | 3300048908 | Ga0496105_0092816 | Ga0496105_0092816_224_952 | 242 |
| 196 | 3300053085 | Ga0495619_0000157 | Ga0495619_0000157_21884_22612 | 242 |
| 197 | 3300001977 | JGI24746J21847_1000071 | JGI24746J21847_10000713 | 244 |
| 198 | 3300002244 | JGI24742J22300_10001747 | JGI24742J22300_100017474 | 244 |
| 199 | 3300003659 | JGI25404J52841_10015215 | JGI25404J52841_100152152 | 244 |
| 200 | 3300005337 | Ga0070682_100000099 | Ga0070682_10000009976 | 244 |
| 201 | 3300005338 | Ga0068868_100000450 | Ga0068868_10000045026 | 244 |
| 202 | 3300005355 | Ga0070671_100561769 | Ga0070671_1005617691 | 244 |
| 203 | 3300005356 | Ga0070674_100000090 | Ga0070674_10000009012 | 244 |
| 204 | 3300005367 | Ga0070667_100027060 | Ga0070667_1000270604 | 244 |
| 205 | 3300005456 | Ga0070678_100070440 | Ga0070678_1000704402 | 244 |
| 206 | 3300005458 | Ga0070681_10443439 | Ga0070681_104434392 | 244 |
| 207 | 3300005459 | Ga0068867_100000796 | Ga0068867_10000079619 | 244 |
| 208 | 3300005530 | Ga0070679_100000243 | Ga0070679_10000024314 | 244 |
| 209 | 3300005535 | Ga0070684_100083112 | Ga0070684_1000831124 | 244 |
| 210 | 3300005535 | Ga0070684_100153886 | Ga0070684_1001538862 | 244 |
| 211 | 3300005535 | Ga0070684_100322996 | Ga0070684_1003229962 | 244 |
| 212 | 3300005539 | Ga0068853_100327195 | Ga0068853_1003271952 | 244 |
| 213 | 3300005544 | Ga0070686_100182310 | Ga0070686_1001823101 | 244 |
| 214 | 3300005547 | Ga0070693_100000847 | Ga0070693_1000008473 | 244 |
| 215 | 3300005548 | Ga0070665_100000106 | Ga0070665_1000001064 | 244 |
| 216 | 3300005548 | Ga0070665_100245776 | Ga0070665_1002457762 | 244 |
| 217 | 3300005564 | Ga0070664_100181247 | Ga0070664_1001812472 | 244 |
| 218 | 3300005614 | Ga0068856_100074910 | Ga0068856_1000749101 | 244 |
| 219 | 3300005718 | Ga0068866_10000685 | Ga0068866_1000068515 | 244 |
| 220 | 3300005718 | Ga0068866_10029022 | Ga0068866_100290224 | 244 |
| 221 | 3300005842 | Ga0068858_100000009 | Ga0068858_100000009159 | 244 |
| 222 | 3300005983 | Ga0081540_1000163 | Ga0081540_100016348 | 244 |
| 223 | 3300005985 | Ga0081539_10026881 | Ga0081539_100268813 | 244 |
| 224 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001401 | 244 |
| 225 | 3300006175 | Ga0070712_100142519 | Ga0070712_1001425193 | 244 |
| 226 | 3300006358 | Ga0068871_100480837 | Ga0068871_1004808372 | 244 |
| 227 | 3300006846 | Ga0075430_100009324 | Ga0075430_1000093246 | 244 |
| 228 | 3300006846 | Ga0075430_100023451 | Ga0075430_1000234516 | 244 |
| 229 | 3300006847 | Ga0075431_100000536 | Ga0075431_10000053617 | 244 |
| 230 | 3300006847 | Ga0075431_100040061 | Ga0075431_1000400615 | 244 |
| 231 | 3300006847 | Ga0075431_100042964 | Ga0075431_1000429643 | 244 |
| 232 | 3300006847 | Ga0075431_100143555 | Ga0075431_1001435552 | 244 |
| 233 | 3300006852 | Ga0075433_10034271 | Ga0075433_100342714 | 244 |
| 234 | 3300006871 | Ga0075434_100013735 | Ga0075434_1000137353 | 244 |
| 235 | 3300006880 | Ga0075429_100004332 | Ga0075429_1000043327 | 244 |
| 236 | 3300007076 | Ga0075435_100385473 | Ga0075435_1003854732 | 244 |
| 237 | 3300009094 | Ga0111539_10004345 | Ga0111539_100043456 | 244 |
| 238 | 3300009094 | Ga0111539_10169453 | Ga0111539_101694532 | 244 |
| 239 | 3300009094 | Ga0111539_10774614 | Ga0111539_107746142 | 244 |
| 240 | 3300009098 | Ga0105245_10000020 | Ga0105245_1000002027 | 244 |
| 241 | 3300009101 | Ga0105247_10000316 | Ga0105247_1000031617 | 244 |
| 242 | 3300009147 | Ga0114129_10051723 | Ga0114129_100517237 | 244 |
| 243 | 3300009147 | Ga0114129_10097421 | Ga0114129_100974215 | 244 |
| 244 | 3300009147 | Ga0114129_10526991 | Ga0114129_105269911 | 244 |
| 245 | 3300009176 | Ga0105242_10113913 | Ga0105242_101139133 | 244 |
| 246 | 3300009545 | Ga0105237_10102097 | Ga0105237_101020972 | 244 |
| 247 | 3300009553 | Ga0105249_10000080 | Ga0105249_1000008050 | 244 |
| 248 | 3300009553 | Ga0105249_10145323 | Ga0105249_101453232 | 244 |
| 249 | 3300010375 | Ga0105239_10364266 | Ga0105239_103642662 | 244 |
| 250 | 3300013105 | Ga0157369_10458545 | Ga0157369_104585452 | 244 |
| 251 | 3300013296 | Ga0157374_10001772 | Ga0157374_1000177219 | 244 |
| 252 | 3300013296 | Ga0157374_10096749 | Ga0157374_100967494 | 244 |
| 253 | 3300013307 | Ga0157372_10689686 | Ga0157372_106896862 | 244 |
| 254 | 3300013308 | Ga0157375_10001213 | Ga0157375_1000121318 | 244 |
| 255 | 3300014325 | Ga0163163_10227094 | Ga0163163_102270943 | 244 |
| 256 | 3300017792 | Ga0163161_10180860 | Ga0163161_101808602 | 244 |
| 257 | 3300025898 | Ga0207692_10174815 | Ga0207692_101748152 | 244 |
| 258 | 3300025899 | Ga0207642_10000281 | Ga0207642_100002815 | 244 |
| 259 | 3300025899 | Ga0207642_10055639 | Ga0207642_100556391 | 244 |
| 260 | 3300025900 | Ga0207710_10059383 | Ga0207710_100593832 | 244 |
| 261 | 3300025905 | Ga0207685_10000027 | Ga0207685_1000002794 | 244 |
| 262 | 3300025909 | Ga0207705_10048298 | Ga0207705_100482982 | 244 |
| 263 | 3300025912 | Ga0207707_10373437 | Ga0207707_103734371 | 244 |
| 264 | 3300025914 | Ga0207671_10374382 | Ga0207671_103743822 | 244 |
| 265 | 3300025915 | Ga0207693_10108715 | Ga0207693_101087153 | 244 |
| 266 | 3300025916 | Ga0207663_10000498 | Ga0207663_1000049816 | 244 |
| 267 | 3300025921 | Ga0207652_10002027 | Ga0207652_100020276 | 244 |
| 268 | 3300025927 | Ga0207687_10000013 | Ga0207687_1000001369 | 244 |
| 269 | 3300025935 | Ga0207709_10137792 | Ga0207709_101377923 | 244 |
| 270 | 3300025937 | Ga0207669_10000096 | Ga0207669_1000009613 | 244 |
| 271 | 3300025937 | Ga0207669_10222963 | Ga0207669_102229632 | 244 |
| 272 | 3300025944 | Ga0207661_10238729 | Ga0207661_102387292 | 244 |
| 273 | 3300025945 | Ga0207679_10011503 | Ga0207679_100115036 | 244 |
| 274 | 3300025949 | Ga0207667_10328477 | Ga0207667_103284772 | 244 |
| 275 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007443 | 244 |
| 276 | 3300025986 | Ga0207658_10116136 | Ga0207658_101161362 | 244 |
| 277 | 3300026023 | Ga0207677_10000200 | Ga0207677_1000020044 | 244 |
| 278 | 3300026035 | Ga0207703_10000018 | Ga0207703_1000001852 | 244 |
| 279 | 3300026035 | Ga0207703_10000023 | Ga0207703_1000002366 | 244 |
| 280 | 3300026041 | Ga0207639_10010573 | Ga0207639_100105732 | 244 |
| 281 | 3300026078 | Ga0207702_10004125 | Ga0207702_100041252 | 244 |
| 282 | 3300026089 | Ga0207648_10004426 | Ga0207648_1000442610 | 244 |
| 283 | 3300026095 | Ga0207676_10000195 | Ga0207676_1000019545 | 244 |
| 284 | 3300026121 | Ga0207683_10065768 | Ga0207683_100657684 | 244 |
| 285 | 3300027907 | Ga0207428_10067434 | Ga0207428_100674343 | 244 |
| 286 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047156 | 244 |
| 287 | 3300028379 | Ga0268266_10043596 | Ga0268266_100435963 | 244 |
| 288 | 3300028379 | Ga0268266_10715194 | Ga0268266_107151941 | 244 |
| 289 | 3300028556 | Ga0265337_1000807 | Ga0265337_100080717 | 244 |
| 290 | 3300028558 | Ga0265326_10000063 | Ga0265326_100000636 | 244 |
| 291 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001388 | 244 |
| 292 | 3300028666 | Ga0265336_10012722 | Ga0265336_100127223 | 244 |
| 293 | 3300028800 | Ga0265338_10277004 | Ga0265338_102770042 | 244 |
| 294 | 3300029957 | Ga0265324_10000755 | Ga0265324_1000075516 | 244 |
| 295 | 3300031238 | Ga0265332_10007328 | Ga0265332_100073284 | 244 |
| 296 | 3300031239 | Ga0265328_10004755 | Ga0265328_100047553 | 244 |
| 297 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002387 | 244 |
| 298 | 3300031249 | Ga0265339_10018762 | Ga0265339_100187625 | 244 |
| 299 | 3300031250 | Ga0265331_10002295 | Ga0265331_100022956 | 244 |
| 300 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011387 | 244 |
| 301 | 3300031344 | Ga0265316_10030052 | Ga0265316_100300523 | 244 |
| 302 | 3300031711 | Ga0265314_10000062 | Ga0265314_10000062121 | 244 |
| 303 | 3300031995 | Ga0307409_100791860 | Ga0307409_1007918601 | 244 |
| 304 | 3300032002 | Ga0307416_100860939 | Ga0307416_1008609392 | 244 |
| 305 | 3300035120 | Ga0373957_0048693 | Ga0373957_0048693_804_1541 | 244 |
| 306 | 3300035172 | Ga0373955_0209037 | Ga0373955_0209037_91_828 | 244 |
| 307 | 3300035724 | Ga0373933_0205492 | Ga0373933_0205492_191_928 | 244 |
| 308 | 3300036401 | Ga0373937_0024047 | Ga0373937_0024047_3095_3832 | 244 |
| 309 | 3300036401 | Ga0373937_0162767 | Ga0373937_0162767_396_1130 | 244 |
| 310 | 3300037418 | Ga0395900_0010300 | Ga0395900_0010300_8601_9350 | 244 |
| 311 | 3300037418 | Ga0395900_0175051 | Ga0395900_0175051_430_1170 | 244 |
| 312 | 3300037466 | Ga0395898_0001408 | Ga0395898_0001408_18708_19457 | 244 |
| 313 | 3300037471 | Ga0395905_0003057 | Ga0395905_0003057_12026_12775 | 244 |
| 314 | 3300038443 | Ga0395901_0001723 | Ga0395901_0001723_17342_18091 | 244 |
| 315 | 3300041459 | Ga0451800_0682346 | Ga0451800_0682346_108_845 | 244 |
| 316 | 3300044694 | Ga0466963_0046051 | Ga0466963_0046051_248_982 | 244 |
| 317 | 3300045976 | Ga0466967_0170005 | Ga0466967_0170005_659_1396 | 244 |
| 318 | 3300046454 | Ga0495592_0021098 | Ga0495592_0021098_3273_4007 | 244 |
| 319 | 3300046454 | Ga0495592_0062726 | Ga0495592_0062726_1208_1942 | 244 |
| 320 | 3300046454 | Ga0495592_0220241 | Ga0495592_0220241_20_754 | 244 |
| 321 | 3300046454 | Ga0495592_0407217 | Ga0495592_0407217_107_841 | 244 |
| 322 | 3300046455 | Ga0495603_0001462 | Ga0495603_0001462_12693_13427 | 244 |
| 323 | 3300046455 | Ga0495603_0004794 | Ga0495603_0004794_2809_3543 | 244 |
| 324 | 3300046459 | Ga0495629_0435162 | Ga0495629_0435162_68_802 | 244 |
| 325 | 3300046460 | Ga0495638_0026746 | Ga0495638_0026746_1738_2484 | 244 |
| 326 | 3300046461 | Ga0495641_0000228 | Ga0495641_0000228_24130_24864 | 244 |
| 327 | 3300046463 | Ga0495653_0019096 | Ga0495653_0019096_1729_2463 | 244 |
| 328 | 3300046463 | Ga0495653_0282533 | Ga0495653_0282533_31_765 | 244 |
| 329 | 3300046473 | Ga0495582_0000726 | Ga0495582_0000726_9743_10477 | 244 |
| 330 | 3300046499 | Ga0495594_0000029 | Ga0495594_0000029_22561_23295 | 244 |
| 331 | 3300046511 | Ga0495608_0000222 | Ga0495608_0000222_7340_8074 | 244 |
| 332 | 3300046514 | Ga0495618_0000008 | Ga0495618_0000008_19882_20616 | 244 |
| 333 | 3300046514 | Ga0495618_0260440 | Ga0495618_0260440_138_872 | 244 |
| 334 | 3300046516 | Ga0495628_0008516 | Ga0495628_0008516_2440_3174 | 244 |
| 335 | 3300046516 | Ga0495628_0016259 | Ga0495628_0016259_2648_3382 | 244 |
| 336 | 3300046516 | Ga0495628_0192792 | Ga0495628_0192792_49_783 | 244 |
| 337 | 3300046517 | Ga0495630_0020713 | Ga0495630_0020713_2334_3068 | 244 |
| 338 | 3300046523 | Ga0495644_0000630 | Ga0495644_0000630_7108_7842 | 244 |
| 339 | 3300046529 | Ga0495652_0000407 | Ga0495652_0000407_16096_16842 | 244 |
| 340 | 3300046535 | Ga0495586_0032410 | Ga0495586_0032410_47_781 | 244 |
| 341 | 3300046536 | Ga0495587_0049993 | Ga0495587_0049993_260_994 | 244 |
| 342 | 3300046539 | Ga0495621_0018311 | Ga0495621_0018311_1189_1923 | 244 |
| 343 | 3300046543 | Ga0495645_0095649 | Ga0495645_0095649_1048_1833 | 244 |
| 344 | 3300046557 | Ga0495622_0000789 | Ga0495622_0000789_8918_9652 | 244 |
| 345 | 3300046559 | Ga0495667_0000018 | Ga0495667_0000018_56838_57572 | 244 |
| 346 | 3300046615 | Ga0495656_0001289 | Ga0495656_0001289_6977_7711 | 244 |
| 347 | 3300046642 | Ga0495634_0000059 | Ga0495634_0000059_61560_62294 | 244 |
| 348 | 3300046642 | Ga0495634_0018299 | Ga0495634_0018299_3327_4061 | 244 |
| 349 | 3300046660 | Ga0495625_0000171 | Ga0495625_0000171_3440_4186 | 244 |
| 350 | 3300046663 | Ga0495635_0000062 | Ga0495635_0000062_62047_62781 | 244 |
| 351 | 3300046675 | Ga0495657_0255540 | Ga0495657_0255540_29_763 | 244 |
| 352 | 3300046678 | Ga0495599_0057672 | Ga0495599_0057672_199_936 | 244 |
| 353 | 3300046680 | Ga0495646_0125474 | Ga0495646_0125474_285_1022 | 244 |
| 354 | 3300046681 | Ga0495647_0000017 | Ga0495647_0000017_79804_80538 | 244 |
| 355 | 3300046683 | Ga0495658_0000034 | Ga0495658_0000034_60766_61500 | 244 |
| 356 | 3300046684 | Ga0495669_0000310 | Ga0495669_0000310_10117_10854 | 244 |
| 357 | 3300046689 | Ga0495613_0175400 | Ga0495613_0175400_196_933 | 244 |
| 358 | 3300046689 | Ga0495613_0342476 | Ga0495613_0342476_29_775 | 244 |
| 359 | 3300046690 | Ga0495624_0001256 | Ga0495624_0001256_2834_3568 | 244 |
| 360 | 3300046694 | Ga0495649_0004181 | Ga0495649_0004181_5127_5861 | 244 |
| 361 | 3300046809 | Ga0495600_0001066 | Ga0495600_0001066_2773_3507 | 244 |
| 362 | 3300047315 | Ga0495581_0030089 | Ga0495581_0030089_72_806 | 244 |
| 363 | 3300047317 | Ga0495604_0000055 | Ga0495604_0000055_72652_73386 | 244 |
| 364 | 3300047320 | Ga0495672_0169658 | Ga0495672_0169658_322_1056 | 244 |
| 365 | 3300047321 | Ga0495676_0025700 | Ga0495676_0025700_1400_2134 | 244 |
| 366 | 3300047322 | Ga0495680_0002282 | Ga0495680_0002282_13023_13757 | 244 |
| 367 | 3300047322 | Ga0495680_0016125 | Ga0495680_0016125_5535_6269 | 244 |
| 368 | 3300047444 | Ga0495675_0172649 | Ga0495675_0172649_148_894 | 244 |
| 369 | 3300047472 | Ga0495686_0054323 | Ga0495686_0054323_1039_1773 | 244 |
| 370 | 3300048088 | Ga0495602_0001349 | Ga0495602_0001349_5600_6334 | 244 |
| 371 | 3300048088 | Ga0495602_0071241 | Ga0495602_0071241_1520_2254 | 244 |
| 372 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_261528_262262 | 244 |
| 373 | 3300048904 | Ga0496101_0000101 | Ga0496101_0000101_68792_69526 | 244 |
| 374 | 3300048905 | Ga0496102_0003911 | Ga0496102_0003911_6573_7307 | 244 |
| 375 | 3300048906 | Ga0496103_0035998 | Ga0496103_0035998_1183_1917 | 244 |
| 376 | 3300048906 | Ga0496103_0057594 | Ga0496103_0057594_1278_2012 | 244 |
| 377 | 3300048906 | Ga0496103_0154501 | Ga0496103_0154501_51_785 | 244 |
| 378 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_365949_366686 | 244 |
| 379 | 3300048907 | Ga0496104_0000190 | Ga0496104_0000190_49086_49820 | 244 |
| 380 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_275145_275882 | 244 |
| 381 | 3300048909 | Ga0496106_0000151 | Ga0496106_0000151_20073_20807 | 244 |
| 382 | 3300048909 | Ga0496106_0119979 | Ga0496106_0119979_871_1605 | 244 |
| 383 | 3300048910 | Ga0496107_0000011 | Ga0496107_0000011_49621_50355 | 244 |
| 384 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_743045_743782 | 244 |
| 385 | 3300048911 | Ga0496108_0000587 | Ga0496108_0000587_10807_11541 | 244 |
| 386 | 3300048911 | Ga0496108_0006431 | Ga0496108_0006431_6533_7267 | 244 |
| 387 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_417591_418328 | 244 |
| 388 | 3300048912 | Ga0496109_0001118 | Ga0496109_0001118_2504_3238 | 244 |
| 389 | 3300048913 | Ga0496110_0016388 | Ga0496110_0016388_1681_2415 | 244 |
| 390 | 3300048913 | Ga0496110_0029190 | Ga0496110_0029190_1031_1765 | 244 |
| 391 | 3300048914 | Ga0496111_0098241 | Ga0496111_0098241_214_948 | 244 |
| 392 | 3300048914 | Ga0496111_0113869 | Ga0496111_0113869_773_1507 | 244 |
| 393 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_268316_269050 | 244 |
| 394 | 3300048915 | Ga0496112_0198200 | Ga0496112_0198200_754_1524 | 244 |
| 395 | 3300048915 | Ga0496112_0323340 | Ga0496112_0323340_318_1052 | 244 |
| 396 | 3300048915 | Ga0496112_0399150 | Ga0496112_0399150_382_1116 | 244 |
| 397 | 3300048916 | Ga0496113_0054719 | Ga0496113_0054719_1763_2497 | 244 |
| 398 | 3300048916 | Ga0496113_0240534 | Ga0496113_0240534_670_1404 | 244 |
| 399 | 3300048917 | Ga0496114_0234374 | Ga0496114_0234374_811_1545 | 244 |
| 400 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_102011_102745 | 244 |
| 401 | 3300048918 | Ga0496115_0028569 | Ga0496115_0028569_2050_2784 | 244 |
| 402 | 3300048919 | Ga0496116_0000735 | Ga0496116_0000735_22638_23372 | 244 |
| 403 | 3300048920 | Ga0496117_0016612 | Ga0496117_0016612_2288_3022 | 244 |
| 404 | 3300048921 | Ga0496118_0000833 | Ga0496118_0000833_14358_15092 | 244 |
| 405 | 3300048921 | Ga0496118_0095828 | Ga0496118_0095828_153_887 | 244 |
| 406 | 3300048922 | Ga0496119_0001290 | Ga0496119_0001290_11861_12595 | 244 |
| 407 | 3300048922 | Ga0496119_0033172 | Ga0496119_0033172_1310_2044 | 244 |
| 408 | 3300048922 | Ga0496119_0041797 | Ga0496119_0041797_104_841 | 244 |
| 409 | 3300048923 | Ga0496120_0014960 | Ga0496120_0014960_3648_4385 | 244 |
| 410 | 3300048923 | Ga0496120_0028190 | Ga0496120_0028190_1331_2065 | 244 |
| 411 | 3300048928 | Ga0496125_0044444 | Ga0496125_0044444_2216_2953 | 244 |
| 412 | 3300048929 | Ga0496126_0007040 | Ga0496126_0007040_7249_7998 | 244 |
| 413 | 3300048929 | Ga0496126_0048803 | Ga0496126_0048803_1972_2721 | 244 |
| 414 | 3300049568 | Ga0501031_0009252 | Ga0501031_0009252_3192_3938 | 244 |
| 415 | 3300049569 | Ga0501032_0000965 | Ga0501032_0000965_7801_8547 | 244 |
| 416 | 3300049570 | Ga0501033_0000900 | Ga0501033_0000900_7977_8723 | 244 |
| 417 | 3300049571 | Ga0501034_0080673 | Ga0501034_0080673_346_1092 | 244 |
| 418 | 3300049572 | Ga0501036_0001844 | Ga0501036_0001844_7891_8637 | 244 |
| 419 | 3300049573 | Ga0501037_0002603 | Ga0501037_0002603_7914_8660 | 244 |
| 420 | 3300049574 | Ga0501038_0006062 | Ga0501038_0006062_7901_8647 | 244 |
| 421 | 3300049575 | Ga0501039_0011207 | Ga0501039_0011207_5508_6254 | 244 |
| 422 | 3300049576 | Ga0501040_0066761 | Ga0501040_0066761_1058_1804 | 244 |
| 423 | 3300049576 | Ga0501040_0138465 | Ga0501040_0138465_304_1056 | 244 |
| 424 | 3300049578 | Ga0501042_0020286 | Ga0501042_0020286_2141_2875 | 244 |
| 425 | 3300049578 | Ga0501042_0051097 | Ga0501042_0051097_1947_2681 | 244 |
| 426 | 3300049579 | Ga0501043_0004468 | Ga0501043_0004468_2645_3391 | 244 |
| 427 | 3300049580 | Ga0501046_0000702 | Ga0501046_0000702_7910_8656 | 244 |
| 428 | 3300049581 | Ga0501047_0009430 | Ga0501047_0009430_3994_4740 | 244 |
| 429 | 3300049581 | Ga0501047_0012322 | Ga0501047_0012322_2097_2846 | 244 |
| 430 | 3300049581 | Ga0501047_0227146 | Ga0501047_0227146_543_1277 | 244 |
| 431 | 3300049582 | Ga0501048_0000888 | Ga0501048_0000888_13506_14252 | 244 |
| 432 | 3300049583 | Ga0501067_0047244 | Ga0501067_0047244_915_1661 | 244 |
| 433 | 3300049584 | Ga0501068_0005996 | Ga0501068_0005996_1187_1933 | 244 |
| 434 | 3300049584 | Ga0501068_0171192 | Ga0501068_0171192_91_825 | 244 |
| 435 | 3300049585 | Ga0501069_0000880 | Ga0501069_0000880_10080_10826 | 244 |
| 436 | 3300049586 | Ga0501070_0000680 | Ga0501070_0000680_18421_19167 | 244 |
| 437 | 3300049586 | Ga0501070_0005582 | Ga0501070_0005582_3871_4605 | 244 |
| 438 | 3300049586 | Ga0501070_0046829 | Ga0501070_0046829_225_959 | 244 |
| 439 | 3300049586 | Ga0501070_0053684 | Ga0501070_0053684_2528_3277 | 244 |
| 440 | 3300049586 | Ga0501070_0065276 | Ga0501070_0065276_287_1033 | 244 |
| 441 | 3300049586 | Ga0501070_0130458 | Ga0501070_0130458_1193_1939 | 244 |
| 442 | 3300049589 | Ga0501073_0006128 | Ga0501073_0006128_7854_8600 | 244 |
| 443 | 3300049590 | Ga0501074_0015768 | Ga0501074_0015768_3360_4106 | 244 |
| 444 | 3300049591 | Ga0501075_0001068 | Ga0501075_0001068_7005_7739 | 244 |
| 445 | 3300049591 | Ga0501075_0015147 | Ga0501075_0015147_1591_2325 | 244 |
| 446 | 3300049742 | Ga0501080_0058430 | Ga0501080_0058430_1156_1902 | 244 |
| 447 | 3300049744 | Ga0501083_0001364 | Ga0501083_0001364_7934_8680 | 244 |
| 448 | 3300049822 | Ga0501035_0000887 | Ga0501035_0000887_11926_12672 | 244 |
| 449 | 3300049823 | Ga0501044_0002514 | Ga0501044_0002514_8174_8920 | 244 |
| 450 | 3300049823 | Ga0501044_0082327 | Ga0501044_0082327_436_1170 | 244 |
| 451 | 3300050492 | nmdc:mga0yw44_23848_c1 | nmdc:mga0yw44_23848_c1_458_1192 | 244 |
| 452 | 3300050508 | nmdc:mga09592_26920_c1 | nmdc:mga09592_26920_c1_1669_2421 | 244 |
| 453 | 3300050509 | nmdc:mga0qj67_435142_c1 | nmdc:mga0qj67_435142_c1_215_949 | 244 |
| 454 | 3300050509 | nmdc:mga0qj67_54467_c1 | nmdc:mga0qj67_54467_c1_1236_1988 | 244 |
| 455 | 3300050510 | nmdc:mga06r32_11329_c1 | nmdc:mga06r32_11329_c1_893_1642 | 244 |
| 456 | 3300050510 | nmdc:mga06r32_380412_c1 | nmdc:mga06r32_380412_c1_173_925 | 244 |
| 457 | 3300050510 | nmdc:mga06r32_622951_c1 | nmdc:mga06r32_622951_c1_131_865 | 244 |
| 458 | 3300050511 | nmdc:mga08y16_16065_c1 | nmdc:mga08y16_16065_c1_722_1471 | 244 |
| 459 | 3300050512 | nmdc:mga0n895_52385_c1 | nmdc:mga0n895_52385_c1_1711_2460 | 244 |
| 460 | 3300050512 | nmdc:mga0n895_866828_c1 | nmdc:mga0n895_866828_c1_98_835 | 244 |
| 461 | 3300050514 | nmdc:mga08x19_180666_c1 | nmdc:mga08x19_180666_c1_37_771 | 244 |
| 462 | 3300050514 | nmdc:mga08x19_352625_c1 | nmdc:mga08x19_352625_c1_222_956 | 244 |
| 463 | 3300050515 | nmdc:mga0a205_68435_c1 | nmdc:mga0a205_68435_c1_1974_2723 | 244 |
| 464 | 3300050515 | nmdc:mga0a205_6_c1 | nmdc:mga0a205_6_c1_104417_105151 | 244 |
| 465 | 3300053077 | Ga0495601_0000035 | Ga0495601_0000035_82174_82911 | 244 |
| 466 | 3300053077 | Ga0495601_0016138 | Ga0495601_0016138_2213_2947 | 244 |
| 467 | 3300053077 | Ga0495601_0037517 | Ga0495601_0037517_1285_2031 | 244 |
| 468 | 3300053077 | Ga0495601_0139593 | Ga0495601_0139593_173_907 | 244 |
| 469 | 3300053077 | Ga0495601_0292456 | Ga0495601_0292456_281_1015 | 244 |
| 470 | 3300053078 | Ga0495612_0002477 | Ga0495612_0002477_3897_4631 | 244 |
| 471 | 3300053078 | Ga0495612_0003571 | Ga0495612_0003571_2404_3141 | 244 |
| 472 | 3300053084 | Ga0495595_0000456 | Ga0495595_0000456_9682_10416 | 244 |
| 473 | 3300053084 | Ga0495595_0074790 | Ga0495595_0074790_104_838 | 244 |
| 474 | 3300053084 | Ga0495595_0106605 | Ga0495595_0106605_134_868 | 244 |
| 475 | 3300053085 | Ga0495619_0000025 | Ga0495619_0000025_138520_139254 | 244 |
| 476 | 3300053085 | Ga0495619_0028266 | Ga0495619_0028266_40_774 | 244 |
| 477 | 3300053085 | Ga0495619_0050588 | Ga0495619_0050588_373_1107 | 244 |
| 478 | 3300053094 | Ga0500566_0008680 | Ga0500566_0008680_2512_3246 | 244 |
| 479 | 3300053123 | Ga0500614_000486 | Ga0500614_000486_6372_7106 | 244 |
| 480 | 3300053134 | Ga0500658_0103321 | Ga0500658_0103321_193_927 | 244 |
| 481 | 3300060353 | Ga0501082_0006817 | Ga0501082_0006817_7900_8646 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y98-assembly1.cif.gz_A | crystal structure of ligd-apo form from sphingobium sp. strain syk-6 | 0.9473 | 3 | 175 |
| 6zzs-assembly2.cif.gz_E-2 | crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate | 0.9355 | 2 | 239 |
| 2ag5-assembly1.cif.gz_D | crystal structure of human dhrs6 | 0.9317 | 1 | 240 |
| 4dqx-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 | 0.9301 | 1 | 240 |
| 2ehd-assembly1.cif.gz_A | crystal structure analysis of oxidoreductase | 0.9283 | 6 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4y98A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9473 | 3 | 175 | 3.40.50.720 |
| 2ag5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9317 | 1 | 240 | 3.40.50.720 |
| 2ehdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9283 | 6 | 176 | 3.40.50.720 |
| af_P37440_1_255_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9255 | 2 | 240 | 3.40.50.720 |
| 5t2uB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9255 | 1 | 241 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838PKJ1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9556 | 1 | 215 |
GO:0016616
GO:0030497 |
| AF-A0A4Q8QWH3-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9547 | 2 | 242 |
GO:0016491
|
| AF-H0E6S3-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) | 0.9533 | 2 | 242 |
GO:0004316
|
| AF-A0A3N5FV26-F1-model_v4 | SDR family oxidoreductase | 0.9527 | 4 | 162 |
GO:0016020
GO:0016491 |
| AF-A0A7V9RIM1-F1-model_v4 | SDR family oxidoreductase | 0.9487 | 1 | 195 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar