F452276

General Info

Members Datasets Scaffolds Average Seq Length
480 254 446 280

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0068545|Ga0495648_0068545_785_1705
Length 306
Sequence MSGSIIEICAPSRAEENRAMSRFAYVNGRFVRHGEAAVHIEDRGYQLADGVYEVWAVFGGKLADAAGHFTRLWRSLDALKIAHPMSEKALTVVLREAIRRNKVREGMVYLQVTRGVAPRDHAFPNPAVPPAVVITAKRVDRAVAEAKAAKGQSVVTVPETRWGRCDIKSIGLLPNALAKQVAREHGAVEAWFVDELGLVTEGASSNAXIVDAEGRLRTRDTQANILRGITRSSLLEVIAEAGLPVAEQPFTVEEAKAAREAFITGAGTLVLPIVSVDGAQIGDGKPGPVATRLRRLYIERAKAAAI

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
17 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
18 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
19 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
24 2849560528 Caulobacter zeae 410 Isolate Unclassified
25 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
26 2851153111 Caulobacter radicis 736 Isolate Unclassified
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
32 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
33 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
237 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
241 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
251 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
252 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.04
Nodule 0
Rhizoplane 3.33
Rhizosphere 65.62
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10011054 3300003215 Bacteria 4021
2 rootH1_10024972 3300003316 Bacteria 2419
3 rootL2_10016341 3300003322 Bacteria 1170
4 rootL2_10108629 3300003322 Bacteria 2276
5 Ga0055537_1001548 3300003773 Bacteria 8793
6 Ga0055536_1001784 3300003781 Bacteria 12672
7 Ga0055536_1001785 3300003781 Bacteria 12671
8 Ga0055536_1004131 3300003781 Bacteria 7528
9 Ga0055528_1009282 3300003790 Bacteria 4123
10 Ga0055530_10002235 3300003791 Bacteria 12741
11 Ga0055530_10002261 3300003791 Bacteria 12672
12 Ga0055530_10012334 3300003791 Bacteria 2990
13 Ga0055531_10001651 3300003794 Bacteria 16116
14 Ga0055531_10003859 3300003794 Bacteria 9380
15 Ga0055531_10004432 3300003794 Bacteria 8554
16 Ga0055531_10021933 3300003794 Bacteria 2454
17 Ga0065165_1000277 3300005262 Bacteria 87540
18 Ga0065165_1000979 3300005262 Bacteria 35374
19 Ga0070658_10141448 3300005327 Bacteria 2010
20 Ga0070670_100000037 3300005331 Bacteria 156070
21 Ga0070670_100128993 3300005331 Bacteria 2183
22 Ga0070670_100221763 3300005331 Bacteria 1645
23 Ga0070666_10038205 3300005335 Bacteria 3194
24 Ga0070666_10083827 3300005335 Bacteria 2181
25 Ga0070682_100374245 3300005337 Bacteria 1069
26 Ga0068868_100088795 3300005338 Bacteria 2488
27 Ga0070660_100025974 3300005339 Bacteria 4358
28 Ga0070660_100039179 3300005339 Bacteria 3601
29 Ga0070689_100552643 3300005340 Bacteria 992
30 Ga0070691_10016761 3300005341 Bacteria 3369
31 Ga0070668_100000097 3300005347 Bacteria 53800
32 Ga0070668_100003647 3300005347 Bacteria 11362
33 Ga0070668_100008258 3300005347 Bacteria 7728
34 Ga0070668_100032514 3300005347 Bacteria 3970
35 Ga0070669_100009680 3300005353 Bacteria 6864
36 Ga0070669_100224256 3300005353 Bacteria 1487
37 Ga0070671_100015818 3300005355 Bacteria 6094
38 Ga0070673_100063025 3300005364 Bacteria 2948
39 Ga0070659_100000206 3300005366 Bacteria 45867
40 Ga0070659_100082619 3300005366 Bacteria 2566
41 Ga0070667_100000083 3300005367 Bacteria 118261
42 Ga0070667_100015009 3300005367 Bacteria 6400
43 Ga0070667_100019958 3300005367 Bacteria 5563
44 Ga0070662_100057312 3300005457 Bacteria 2831
45 Ga0070681_10020463 3300005458 Bacteria 6632
46 Ga0070681_10102470 3300005458 Bacteria 2807
47 Ga0070681_10137131 3300005458 Bacteria 2377
48 Ga0070679_100014435 3300005530 Bacteria 7586
49 Ga0070679_100118978 3300005530 Bacteria 2626
50 Ga0068853_100117512 3300005539 Bacteria 2368
51 Ga0068853_100219238 3300005539 Bacteria 1737
52 Ga0070665_100000116 3300005548 Bacteria 150141
53 Ga0070665_100000278 3300005548 Bacteria 84248
54 Ga0070665_100002488 3300005548 Bacteria 20280
55 Ga0070665_100019655 3300005548 Bacteria 6779
56 Ga0070665_100089774 3300005548 Bacteria 3079
57 Ga0068855_100153498 3300005563 Bacteria 2617
58 Ga0068855_100163838 3300005563 Bacteria 2522
59 Ga0068855_100334574 3300005563 Bacteria 1671
60 Ga0068856_100217689 3300005614 Bacteria 1925
61 Ga0068852_100069141 3300005616 Bacteria 3094
62 Ga0068859_100008475 3300005617 Bacteria 10403
63 Ga0068859_100012653 3300005617 Bacteria 8482
64 Ga0068859_100317326 3300005617 Bacteria 1652
65 Ga0068864_100000115 3300005618 Bacteria 79542
66 Ga0068864_100001225 3300005618 Bacteria 21325
67 Ga0068864_100012817 3300005618 Bacteria 6932
68 Ga0068864_100045218 3300005618 Bacteria 3777
69 Ga0068861_100366727 3300005719 Bacteria 1268
70 Ga0068863_100000007 3300005841 Bacteria 257578
71 Ga0068863_100000392 3300005841 Bacteria 44421
72 Ga0068863_100001891 3300005841 Bacteria 20782
73 Ga0068863_100071096 3300005841 Bacteria 3292
74 Ga0068858_100000031 3300005842 Bacteria 143397
75 Ga0068858_100009930 3300005842 Bacteria 9041
76 Ga0068858_100058358 3300005842 Bacteria 3568
77 Ga0068860_100000128 3300005843 Bacteria 122731
78 Ga0068860_100000145 3300005843 Bacteria 115830
79 Ga0068860_100053593 3300005843 Bacteria 3835
80 Ga0068860_100081778 3300005843 Bacteria 3071
81 Ga0068860_100211397 3300005843 Bacteria 1882
82 Ga0068862_100000121 3300005844 Bacteria 91849
83 Ga0068862_100041215 3300005844 Bacteria 3929
84 Ga0068862_100098611 3300005844 Bacteria 2553
85 Ga0068862_100128607 3300005844 Bacteria 2238
86 Ga0070717_10082704 3300006028 Bacteria 2699
87 Ga0075368_10000507 3300006042 Bacteria 11578
88 Ga0075367_10028953 3300006178 Bacteria 3164
89 Ga0075369_10017537 3300006186 Bacteria 2903
90 Ga0075366_10038607 3300006195 Bacteria 2820
91 Ga0075370_10121370 3300006353 Bacteria 1521
92 Ga0075370_10146693 3300006353 Bacteria 1381
93 Ga0068865_100001650 3300006881 Bacteria 13080
94 Ga0097620_100008475 3300006931 Bacteria 10403
95 Ga0097620_100012653 3300006931 Bacteria 8482
96 Ga0097620_100317314 3300006931 Bacteria 1652
97 Ga0105240_10002344 3300009093 Bacteria 30572
98 Ga0105240_10003036 3300009093 Bacteria 26403
99 Ga0105240_10103156 3300009093 Bacteria 3466
100 Ga0105240_10195224 3300009093 Bacteria 2377
101 Ga0105240_10430017 3300009093 Bacteria 1481
102 Ga0105240_10593506 3300009093 Bacteria 1220
103 Ga0105240_10626944 3300009093 Bacteria 1181
104 Ga0105241_10141161 3300009174 Bacteria 1961
105 Ga0105248_10021528 3300009177 Bacteria 7141
106 Ga0105248_10030040 3300009177 Bacteria 6065
107 Ga0105248_10167635 3300009177 Bacteria 2475
108 Ga0105248_10340869 3300009177 Bacteria 1687
109 Ga0105238_10002686 3300009551 Bacteria 17688
110 Ga0105238_10036220 3300009551 Bacteria 5015
111 Ga0105238_10072766 3300009551 Bacteria 3432
112 Ga0105238_10081313 3300009551 Bacteria 3229
113 Ga0105238_10172779 3300009551 Bacteria 2137
114 Ga0105238_10526611 3300009551 Bacteria 1185
115 Ga0105249_10000410 3300009553 Bacteria 41122
116 Ga0105239_10364604 3300010375 Bacteria 1632
117 Ga0157373_10000955 3300013100 Bacteria 22427
118 Ga0157373_10001704 3300013100 Bacteria 16742
119 Ga0157371_10211905 3300013102 Bacteria 1390
120 Ga0157370_10064898 3300013104 Bacteria 3455
121 Ga0157375_10020078 3300013308 Bacteria 6097
122 Ga0163163_10002453 3300014325 Bacteria 15680
123 Ga0163163_10008010 3300014325 Bacteria 9352
124 Ga0163163_10154580 3300014325 Bacteria 2338
125 Ga0163163_10334391 3300014325 Bacteria 1569
126 Ga0157379_10002929 3300014968 Bacteria 14405
127 Ga0157379_10027128 3300014968 Bacteria 5099
128 Ga0157379_10287489 3300014968 Bacteria 1497
129 Ga0213876_10000108 3300021384 Bacteria 91222
130 Ga0213876_10023034 3300021384 Bacteria 3291
131 Ga0209026_1000755 3300025250 Bacteria 18340
132 Ga0209148_1011724 3300025254 Bacteria 1622
133 Ga0209565_1000475 3300025263 Bacteria 29667
134 Ga0209673_1000941 3300025273 Bacteria 36504
135 Ga0209675_1006647 3300025291 Bacteria 4596
136 Ga0209676_1000057 3300025292 Bacteria 361061
137 Ga0209676_1000061 3300025292 Bacteria 332674
138 Ga0209676_1001335 3300025292 Bacteria 24868
139 Ga0209676_1002066 3300025292 Bacteria 15614
140 Ga0209564_1005262 3300025295 Bacteria 7468
141 Ga0209758_1001598 3300025297 Bacteria 25915
142 Ga0209758_1002304 3300025297 Bacteria 19732
143 Ga0209758_1004011 3300025297 Bacteria 12728
144 Ga0209050_1000135 3300025298 Bacteria 184020
145 Ga0209050_1000200 3300025298 Bacteria 134115
146 Ga0209050_1001221 3300025298 Bacteria 29961
147 Ga0209050_1013858 3300025298 Bacteria 3536
148 Ga0209050_1034697 3300025298 Bacteria 1504
149 Ga0209256_1001833 3300025299 Bacteria 19808
150 Ga0209256_1002440 3300025299 Bacteria 15186
151 Ga0209256_1011418 3300025299 Bacteria 3554
152 Ga0209051_1003169 3300025303 Bacteria 11021
153 Ga0209257_1000225 3300025304 Bacteria 134023
154 Ga0209257_1000350 3300025304 Bacteria 95008
155 Ga0209257_1000439 3300025304 Bacteria 79332
156 Ga0209257_1001135 3300025304 Bacteria 34110
157 Ga0209257_1001883 3300025304 Bacteria 22693
158 Ga0209257_1002835 3300025304 Bacteria 16261
159 Ga0207710_10034491 3300025900 Bacteria 2223
160 Ga0207680_10012538 3300025903 Bacteria 4320
161 Ga0207680_10242654 3300025903 Bacteria 1242
162 Ga0207705_10142704 3300025909 Bacteria 1789
163 Ga0207707_10034064 3300025912 Bacteria 4457
164 Ga0207707_10048598 3300025912 Bacteria 3695
165 Ga0207695_10001670 3300025913 Bacteria 35733
166 Ga0207695_10001727 3300025913 Bacteria 34901
167 Ga0207695_10011998 3300025913 Bacteria 10426
168 Ga0207695_10012731 3300025913 Bacteria 10072
169 Ga0207695_10123334 3300025913 Bacteria 2556
170 Ga0207695_10420739 3300025913 Bacteria 1220
171 Ga0207671_10230941 3300025914 Bacteria 1451
172 Ga0207660_10006796 3300025917 Bacteria 7410
173 Ga0207657_10011260 3300025919 Bacteria 8888
174 Ga0207657_10068631 3300025919 Bacteria 3011
175 Ga0207652_10016562 3300025921 Bacteria 6019
176 Ga0207652_10049768 3300025921 Bacteria 3588
177 Ga0207681_10008523 3300025923 Bacteria 6260
178 Ga0207681_10026538 3300025923 Bacteria 3737
179 Ga0207694_10042964 3300025924 Bacteria 3488
180 Ga0207694_10131721 3300025924 Bacteria 2005
181 Ga0207694_10151387 3300025924 Bacteria 1869
182 Ga0207650_10000099 3300025925 Bacteria 113522
183 Ga0207650_10029759 3300025925 Bacteria 3928
184 Ga0207650_10104513 3300025925 Bacteria 2185
185 Ga0207644_10010335 3300025931 Bacteria 6152
186 Ga0207690_10000129 3300025932 Bacteria 62350
187 Ga0207690_10025820 3300025932 Bacteria 3693
188 Ga0207706_10031495 3300025933 Bacteria 4724
189 Ga0207704_10001553 3300025938 Bacteria 10296
190 Ga0207711_10015019 3300025941 Bacteria 6432
191 Ga0207711_10045768 3300025941 Bacteria 3739
192 Ga0207667_10029177 3300025949 Bacteria 5984
193 Ga0207667_10105079 3300025949 Bacteria 2913
194 Ga0207667_10109530 3300025949 Bacteria 2848
195 Ga0207651_10051441 3300025960 Bacteria 2803
196 Ga0207712_10003410 3300025961 Bacteria 10044
197 Ga0207668_10000028 3300025972 Bacteria 125361
198 Ga0207668_10000828 3300025972 Bacteria 18733
199 Ga0207668_10003243 3300025972 Bacteria 9540
200 Ga0207668_10060410 3300025972 Bacteria 2660
201 Ga0207658_10000209 3300025986 Bacteria 61041
202 Ga0207658_10007659 3300025986 Bacteria 7353
203 Ga0207677_10053357 3300026023 Bacteria 2752
204 Ga0207703_10000038 3300026035 Bacteria 175917
205 Ga0207703_10016753 3300026035 Bacteria 5717
206 Ga0207703_10119100 3300026035 Bacteria 2264
207 Ga0207639_10213845 3300026041 Bacteria 1661
208 Ga0207702_10227814 3300026078 Bacteria 1740
209 Ga0207702_10472443 3300026078 Bacteria 1219
210 Ga0207641_10000012 3300026088 Bacteria 375486
211 Ga0207641_10000341 3300026088 Bacteria 56155
212 Ga0207641_10004917 3300026088 Bacteria 11484
213 Ga0207641_10248795 3300026088 Bacteria 1659
214 Ga0207676_10000610 3300026095 Bacteria 29371
215 Ga0207676_10000637 3300026095 Bacteria 28167
216 Ga0207676_10008902 3300026095 Bacteria 7143
217 Ga0207676_10032695 3300026095 Bacteria 3923
218 Ga0207676_10193065 3300026095 Bacteria 1793
219 Ga0207675_100040064 3300026118 Bacteria 4372
220 Ga0207675_100201814 3300026118 Bacteria 1910
221 Ga0207698_10242929 3300026142 Bacteria 1642
222 Ga0207698_10852606 3300026142 Bacteria 916
223 Ga0209967_1005035 3300027364 Bacteria 1768
224 Ga0210000_1001907 3300027462 Bacteria 2948
225 Ga0209999_1001720 3300027543 Bacteria 3794
226 Ga0209983_1012644 3300027665 Bacteria 1733
227 Ga0268266_10000064 3300028379 Bacteria 249533
228 Ga0268266_10001158 3300028379 Bacteria 32665
229 Ga0268266_10005451 3300028379 Bacteria 11854
230 Ga0268266_10030256 3300028379 Bacteria 4601
231 Ga0268266_10066657 3300028379 Bacteria 3114
232 Ga0268265_10001336 3300028380 Bacteria 21037
233 Ga0268265_10040101 3300028380 Bacteria 3456
234 Ga0268265_10173275 3300028380 Bacteria 1846
235 Ga0268264_10000059 3300028381 Bacteria 306927
236 Ga0268264_10044071 3300028381 Bacteria 3700
237 Ga0268264_10132016 3300028381 Bacteria 2215
238 Ga0265337_1058245 3300028556 Bacteria 1074
239 Ga0265334_10001441 3300028573 Bacteria 11435
240 Ga0307517_10012250 3300028786 Bacteria 11791
241 Ga0307517_10054379 3300028786 Bacteria 3960
242 Ga0307515_10046005 3300028794 Bacteria 6684
243 Ga0265338_10019502 3300028800 Bacteria 7189
244 Ga0265338_10141820 3300028800 Bacteria 1881
245 Ga0265327_10000166 3300031251 Bacteria 141539
246 Ga0265327_10006559 3300031251 Bacteria 9263
247 Ga0265327_10165079 3300031251 Bacteria 1020
248 Ga0307513_10001153 3300031456 Bacteria 38347
249 Ga0307513_10002695 3300031456 Bacteria 24428
250 Ga0307513_10005321 3300031456 Bacteria 17020
251 Ga0307513_10095473 3300031456 Bacteria 3014
252 Ga0316579_10050212 3300031691 Bacteria 1950
253 Ga0265314_10035212 3300031711 Bacteria 3651
254 Ga0307516_10000004 3300031730 Bacteria 367451
255 Ga0307406_10000761 3300031901 Bacteria 18132
256 Ga0307412_10137884 3300031911 Bacteria 1782
257 Ga0307414_10039492 3300032004 Bacteria 3179
258 Ga0307414_10047842 3300032004 Bacteria 2946
259 Ga0307414_10090110 3300032004 Bacteria 2275
260 Ga0307414_10160186 3300032004 Bacteria 1786
261 Ga0307414_10229550 3300032004 Bacteria 1529
262 Ga0307510_10020294 3300033180 Bacteria 7769
263 Ga0373936_0001078 3300035113 Bacteria 9771
264 Ga0373946_0008035 3300035171 Bacteria 3874
265 Ga0373927_0005817 3300035695 Bacteria 8456
266 Ga0373925_0000478 3300037068 Bacteria 39975
267 Ga0373925_0082657 3300037068 Bacteria 2445
268 Ga0395899_0000013 3300037312 Bacteria 510397
269 Ga0395899_0000407 3300037312 Bacteria 50216
270 Ga0395899_0038572 3300037312 Bacteria 3578
271 Ga0395899_0100329 3300037312 Bacteria 2091
272 Ga0395900_0000009 3300037418 Bacteria 476249
273 Ga0395900_0077750 3300037418 Bacteria 3409
274 Ga0395898_0009683 3300037466 Bacteria 10106
275 Ga0395898_0027308 3300037466 Bacteria 5732
276 Ga0395905_0005890 3300037471 Bacteria 12443
277 Ga0395905_0182874 3300037471 Bacteria 1968
278 Ga0395905_0274642 3300037471 Bacteria 1571
279 Ga0395905_0306811 3300037471 Bacteria 1475
280 Ga0395905_0674679 3300037471 Bacteria 936
281 Ga0395901_0000014 3300038443 Bacteria 375100
282 Ga0395901_0279060 3300038443 Bacteria 1736
283 Ga0436365_0504517 3300039437 Bacteria 6100
284 Ga0436365_1544656 3300039437 Bacteria 122419
285 Ga0436365_1718085 3300039437 Bacteria 3611
286 Ga0436361_1148114 3300039447 Bacteria 29234
287 Ga0450901_001515 3300042533 Bacteria 2642
288 Ga0466968_0062017 3300044735 Bacteria 1614
289 Ga0466968_0072576 3300044735 Bacteria 1501
290 Ga0451576_0183262 3300045051 Bacteria 2186
291 Ga0495627_002098 3300046453 Bacteria 10119
292 Ga0495590_0006851 3300046457 Bacteria 4427
293 Ga0495629_0039309 3300046459 Bacteria 3330
294 Ga0495638_0000585 3300046460 Bacteria 41159
295 Ga0495638_0000595 3300046460 Bacteria 40733
296 Ga0495638_0004039 3300046460 Bacteria 11253
297 Ga0495638_0015863 3300046460 Bacteria 5048
298 Ga0495638_0108515 3300046460 Bacteria 1651
299 Ga0495638_0124406 3300046460 Bacteria 1521
300 Ga0495650_0000007 3300046471 Bacteria 718072
301 Ga0495583_0000037 3300046506 Bacteria 244437
302 Ga0495583_0135721 3300046506 Bacteria 1027
303 Ga0495606_0086797 3300046507 Bacteria 1932
304 Ga0495610_0000205 3300046512 Bacteria 65600
305 Ga0495610_0001459 3300046512 Bacteria 20922
306 Ga0495610_0003505 3300046512 Bacteria 12191
307 Ga0495616_0000159 3300046513 Bacteria 58948
308 Ga0495631_0007090 3300046518 Bacteria 5731
309 Ga0495631_0154919 3300046518 Bacteria 983
310 Ga0495632_0005666 3300046519 Bacteria 8212
311 Ga0495632_0036755 3300046519 Bacteria 2489
312 Ga0495632_0047472 3300046519 Bacteria 2129
313 Ga0495637_0005910 3300046520 Bacteria 6186
314 Ga0495637_0029290 3300046520 Bacteria 2452
315 Ga0495637_0062855 3300046520 Bacteria 1518
316 Ga0495643_0013329 3300046522 Bacteria 4924
317 Ga0495648_0054005 3300046524 Bacteria 2430
318 Ga0495648_0068545 3300046524 Bacteria 2069
319 Ga0495654_0000100 3300046530 Bacteria 98615
320 Ga0495654_0030593 3300046530 Bacteria 2738
321 Ga0495597_0033131 3300046542 Bacteria 2341
322 Ga0495622_0023187 3300046557 Bacteria 2893
323 Ga0495668_0000345 3300046616 Bacteria 61921
324 Ga0495668_0002985 3300046616 Bacteria 13224
325 Ga0495668_0024823 3300046616 Bacteria 3408
326 Ga0495668_0031972 3300046616 Bacteria 2963
327 Ga0495625_0000080 3300046660 Bacteria 156895
328 Ga0495625_0007880 3300046660 Bacteria 9174
329 Ga0495625_0011578 3300046660 Bacteria 7179
330 Ga0495625_0044891 3300046660 Bacteria 3197
331 Ga0495625_0071086 3300046660 Bacteria 2442
332 Ga0495625_0116160 3300046660 Bacteria 1825
333 Ga0495625_0192873 3300046660 Bacteria 1348
334 Ga0495669_0000024 3300046684 Bacteria 113943
335 Ga0495669_0065630 3300046684 Bacteria 1648
336 Ga0495669_0068668 3300046684 Bacteria 1613
337 Ga0495670_0113932 3300046691 Bacteria 1401
338 Ga0495670_0339365 3300046691 Bacteria 808
339 Ga0495671_0059220 3300046692 Bacteria 1894
340 Ga0495649_0000868 3300046694 Bacteria 24311
341 Ga0495660_0108582 3300046810 Bacteria 1418
342 Ga0495636_0027952 3300047318 Bacteria 2298
343 Ga0495672_0027862 3300047320 Bacteria 3583
344 Ga0495673_0000132 3300047469 Bacteria 138001
345 Ga0495673_0000330 3300047469 Bacteria 60940
346 Ga0495673_0017258 3300047469 Bacteria 3672
347 Ga0495686_0000525 3300047472 Bacteria 55165
348 Ga0495686_0012848 3300047472 Bacteria 5839
349 Ga0495686_0019298 3300047472 Bacteria 4557
350 Ga0495686_0070101 3300047472 Bacteria 2160
351 Ga0495686_0086162 3300047472 Bacteria 1912
352 Ga0495686_0089482 3300047472 Bacteria 1870
353 Ga0495686_0102822 3300047472 Bacteria 1721
354 Ga0495593_0011453 3300047673 Bacteria 5094
355 Ga0496102_0039205 3300048905 Bacteria 4280
356 Ga0496106_0026740 3300048909 Bacteria 4297
357 Ga0496106_0030270 3300048909 Bacteria 4037
358 Ga0496106_0157077 3300048909 Bacteria 1797
359 Ga0496107_0000110 3300048910 Bacteria 39732
360 Ga0496107_0060824 3300048910 Bacteria 2734
361 Ga0496108_0018026 3300048911 Bacteria 5776
362 Ga0496109_0322731 3300048912 Bacteria 1457
363 Ga0496110_0474655 3300048913 Bacteria 1139
364 Ga0496112_0020401 3300048915 Bacteria 6282
365 Ga0496112_0243332 3300048915 Bacteria 1751
366 Ga0496113_0367287 3300048916 Bacteria 1155
367 Ga0496115_0000598 3300048918 Bacteria 27622
368 Ga0496115_0004231 3300048918 Bacteria 10380
369 Ga0496115_0014971 3300048918 Bacteria 5880
370 Ga0496115_0076963 3300048918 Bacteria 2712
371 Ga0496121_0019891 3300048924 Bacteria 6683
372 Ga0496122_0018335 3300048925 Bacteria 6476
373 Ga0496123_0000539 3300048926 Bacteria 65166
374 Ga0496124_0030836 3300048927 Bacteria 4751
375 Ga0496125_0006744 3300048928 Bacteria 12339
376 Ga0496125_0010256 3300048928 Bacteria 9490
377 Ga0496125_0074667 3300048928 Bacteria 2628
378 Ga0496126_0005285 3300048929 Bacteria 14819
379 Ga0495678_000191 3300049459 Bacteria 71862
380 Ga0495682_0045422 3300049460 Bacteria 1605
381 Ga0501032_0066093 3300049569 Bacteria 2417
382 Ga0501033_0050203 3300049570 Bacteria 3096
383 Ga0501037_0070446 3300049573 Bacteria 2544
384 Ga0501037_0080232 3300049573 Bacteria 2368
385 Ga0501047_0078904 3300049581 Bacteria 3166
386 Ga0501047_0455763 3300049581 Bacteria 1108
387 Ga0501048_0062234 3300049582 Bacteria 2642
388 Ga0501069_0255952 3300049585 Bacteria 1022
389 Ga0501238_004550 3300049671 Bacteria 1738
390 Ga0501035_0031556 3300049822 Bacteria 4825
391 Ga0501044_0011457 3300049823 Bacteria 9606
392 Ga0501044_0016468 3300049823 Bacteria 7935
393 Ga0501044_0224288 3300049823 Bacteria 1829
394 nmdc:mga00v17_405_c1 3300050491 Bacteria 24411
395 nmdc:mga0k408_56455_c1 3300050493 Bacteria 2279
396 nmdc:mga0k408_81943_c1 3300050493 Bacteria 1890
397 nmdc:mga07m45_1752_c1 3300050496 Bacteria 9997
398 nmdc:mga0sz30_23808_c1 3300050516 Bacteria 2495
399 Ga0500578_0000008 3300053086 Bacteria 223557
400 Ga0500643_000376 3300053087 Bacteria 34859
401 Ga0500643_025824 3300053087 Bacteria 1847
402 Ga0500644_0000028 3300053088 Bacteria 92405
403 Ga0500644_0142534 3300053088 Bacteria 954
404 Ga0500651_0006348 3300053093 Bacteria 6807
405 Ga0500641_0000264 3300053096 Bacteria 19552
406 Ga0500641_0027163 3300053096 Bacteria 2227
407 Ga0500650_0149652 3300053098 Bacteria 1080
408 Ga0500556_0000273 3300053104 Bacteria 40555
409 Ga0500556_0001358 3300053104 Bacteria 10788
410 Ga0500556_0016230 3300053104 Bacteria 2313
411 Ga0500562_000706 3300053108 Bacteria 8129
412 Ga0500562_000813 3300053108 Bacteria 7604
413 Ga0500562_000904 3300053108 Bacteria 7193
414 Ga0500562_003507 3300053108 Bacteria 3933
415 Ga0500594_0000015 3300053118 Bacteria 67180
416 Ga0500595_001608 3300053119 Bacteria 11900
417 Ga0500595_050366 3300053119 Bacteria 1293
418 Ga0500608_000025 3300053122 Bacteria 71403
419 Ga0500608_066224 3300053122 Bacteria 1723
420 Ga0500614_002640 3300053123 Bacteria 3971
421 Ga0500618_000034 3300053125 Bacteria 120560
422 Ga0500642_0013799 3300053130 Bacteria 2984
423 Ga0500658_0002444 3300053134 Bacteria 7185
424 Ga0500658_0008800 3300053134 Bacteria 3726
425 Ga0500559_0000005 3300053136 Bacteria 230231
426 Ga0500559_0002934 3300053136 Bacteria 8575
427 Ga0500559_0102368 3300053136 Bacteria 1320
428 Ga0500564_000007 3300053138 Bacteria 84097
429 Ga0500573_0199349 3300053140 Bacteria 1063
430 Ga0500577_0001077 3300053142 Bacteria 7042
431 Ga0500616_0016176 3300053153 Bacteria 4252
432 Ga0500622_0000105 3300053156 Bacteria 85855
433 Ga0500622_0010120 3300053156 Bacteria 5194
434 Ga0500622_0011582 3300053156 Bacteria 4798
435 Ga0500622_0018570 3300053156 Bacteria 3697
436 Ga0500622_0020758 3300053156 Bacteria 3486
437 Ga0500622_0043855 3300053156 Bacteria 2318
438 Ga0500622_0050594 3300053156 Bacteria 2141
439 Ga0500639_089932 3300053163 Bacteria 1531
440 Ga0500576_068527 3300053725 Bacteria 1531
441 Ga0500625_019188 3300053729 Bacteria 3209
442 Ga0500645_000419 3300053730 Bacteria 29374
443 Ga0500645_002080 3300053730 Bacteria 9264
444 Ga0500645_003577 3300053730 Bacteria 6240
445 Ga0500645_004920 3300053730 Bacteria 5022
446 Ga0500596_001239 3300053735 Bacteria 5165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0065630 Ga0495669_0065630_465_1256 250
2 3300046691 Ga0495670_0339365 Ga0495670_0339365_12_794 253
3 3300009177 Ga0105248_10030040 Ga0105248_100300404 260
4 3300009553 Ga0105249_10000410 Ga0105249_1000041024 260
5 3300014325 Ga0163163_10334391 Ga0163163_103343912 260
6 3300014968 Ga0157379_10002929 Ga0157379_100029291 260
7 3300048905 Ga0496102_0039205 Ga0496102_0039205_3378_4190 260
8 3300048909 Ga0496106_0157077 Ga0496106_0157077_957_1769 260
9 3300027364 Ga0209967_1005035 Ga0209967_10050352 263
10 3300027462 Ga0210000_1001907 Ga0210000_10019073 263
11 3300027543 Ga0209999_1001720 Ga0209999_10017202 263
12 3300028556 Ga0265337_1058245 Ga0265337_10582451 269
13 3300053087 Ga0500643_000376 Ga0500643_000376_15509_16372 269
14 3300053096 Ga0500641_0000264 Ga0500641_0000264_11838_12701 269
15 3300053153 Ga0500616_0016176 Ga0500616_0016176_207_1070 269
16 3300053156 Ga0500622_0018570 Ga0500622_0018570_1565_2428 269
17 3300053156 Ga0500622_0020758 Ga0500622_0020758_242_1105 269
18 3300053730 Ga0500645_000419 Ga0500645_000419_24818_25681 269
19 3300005843 Ga0068860_100000145 Ga0068860_10000014565 270
20 3300005843 Ga0068860_100211397 Ga0068860_1002113972 270
21 3300053104 Ga0500556_0001358 Ga0500556_0001358_2765_3628 270
22 3300053108 Ga0500562_003507 Ga0500562_003507_1784_2647 270
23 3300053730 Ga0500645_003577 Ga0500645_003577_1166_2029 270
24 3300005337 Ga0070682_100374245 Ga0070682_1003742451 271
25 3300005617 Ga0068859_100317326 Ga0068859_1003173262 271
26 3300005844 Ga0068862_100128607 Ga0068862_1001286072 271
27 3300006931 Ga0097620_100317314 Ga0097620_1003173143 271
28 3300013100 Ga0157373_10001704 Ga0157373_100017047 271
29 3300028573 Ga0265334_10001441 Ga0265334_100014414 271
30 3300028800 Ga0265338_10019502 Ga0265338_100195025 271
31 3300031711 Ga0265314_10035212 Ga0265314_100352122 271
32 3300031730 Ga0307516_10000004 Ga0307516_10000004318 271
33 3300039447 Ga0436361_1148114 Ga0436361_1148114_17858_18721 271
34 3300047472 Ga0495686_0019298 Ga0495686_0019298_2677_3540 271
35 3300048927 Ga0496124_0030836 Ga0496124_0030836_1764_2627 271
36 3300049573 Ga0501037_0080232 Ga0501037_0080232_14_877 271
37 3300049581 Ga0501047_0455763 Ga0501047_0455763_137_1000 271
38 3300049823 Ga0501044_0016468 Ga0501044_0016468_5647_6510 271
39 3300049823 Ga0501044_0224288 Ga0501044_0224288_739_1602 271
40 3300005539 Ga0068853_100219238 Ga0068853_1002192382 272
41 3300006186 Ga0075369_10017537 Ga0075369_100175372 272
42 3300013100 Ga0157373_10000955 Ga0157373_1000095519 272
43 3300028800 Ga0265338_10141820 Ga0265338_101418203 272
44 3300032004 Ga0307414_10039492 Ga0307414_100394924 272
45 3300032004 Ga0307414_10160186 Ga0307414_101601862 272
46 3300032004 Ga0307414_10229550 Ga0307414_102295502 272
47 3300050516 nmdc:mga0sz30_23808_c1 nmdc:mga0sz30_23808_c1_1152_2015 272
48 3300005327 Ga0070658_10141448 Ga0070658_101414482 273
49 3300005331 Ga0070670_100128993 Ga0070670_1001289933 273
50 3300005347 Ga0070668_100008258 Ga0070668_1000082586 273
51 3300005367 Ga0070667_100019958 Ga0070667_1000199582 273
52 3300005548 Ga0070665_100000278 Ga0070665_10000027835 273
53 3300005548 Ga0070665_100089774 Ga0070665_1000897742 273
54 3300005563 Ga0068855_100334574 Ga0068855_1003345743 273
55 3300005614 Ga0068856_100217689 Ga0068856_1002176893 273
56 3300005618 Ga0068864_100000115 Ga0068864_10000011549 273
57 3300005841 Ga0068863_100000007 Ga0068863_100000007128 273
58 3300005842 Ga0068858_100000031 Ga0068858_10000003168 273
59 3300005844 Ga0068862_100098611 Ga0068862_1000986113 273
60 3300009551 Ga0105238_10081313 Ga0105238_100813133 273
61 3300010375 Ga0105239_10364604 Ga0105239_103646043 273
62 3300014325 Ga0163163_10154580 Ga0163163_101545802 273
63 3300014968 Ga0157379_10287489 Ga0157379_102874892 273
64 3300025900 Ga0207710_10034491 Ga0207710_100344912 273
65 3300025924 Ga0207694_10131721 Ga0207694_101317213 273
66 3300025925 Ga0207650_10104513 Ga0207650_101045133 273
67 3300025972 Ga0207668_10000028 Ga0207668_1000002843 273
68 3300026035 Ga0207703_10000038 Ga0207703_10000038119 273
69 3300026078 Ga0207702_10472443 Ga0207702_104724432 273
70 3300026088 Ga0207641_10000012 Ga0207641_10000012181 273
71 3300026095 Ga0207676_10000610 Ga0207676_1000061029 273
72 3300028379 Ga0268266_10001158 Ga0268266_1000115811 273
73 3300028379 Ga0268266_10066657 Ga0268266_100666572 273
74 3300028380 Ga0268265_10173275 Ga0268265_101732753 273
75 3300032004 Ga0307414_10047842 Ga0307414_100478423 273
76 3300046459 Ga0495629_0039309 Ga0495629_0039309_2082_2945 273
77 3300046506 Ga0495583_0135721 Ga0495583_0135721_101_964 273
78 3300046520 Ga0495637_0029290 Ga0495637_0029290_464_1327 273
79 3300046522 Ga0495643_0013329 Ga0495643_0013329_1413_2276 273
80 3300046530 Ga0495654_0030593 Ga0495654_0030593_208_1071 273
81 3300046557 Ga0495622_0023187 Ga0495622_0023187_1921_2784 273
82 3300047673 Ga0495593_0011453 Ga0495593_0011453_2375_3238 273
83 3300049460 Ga0495682_0045422 Ga0495682_0045422_483_1346 273
84 3300053119 Ga0500595_001608 Ga0500595_001608_9189_10052 273
85 3300053122 Ga0500608_066224 Ga0500608_066224_792_1655 273
86 3300053123 Ga0500614_002640 Ga0500614_002640_2980_3843 273
87 3300053130 Ga0500642_0013799 Ga0500642_0013799_1758_2621 273
88 3300053134 Ga0500658_0008800 Ga0500658_0008800_1419_2282 273
89 3300053163 Ga0500639_089932 Ga0500639_089932_10_873 273
90 3300053725 Ga0500576_068527 Ga0500576_068527_585_1448 273
91 3300053729 Ga0500625_019188 Ga0500625_019188_1199_2062 273
92 3300053735 Ga0500596_001239 Ga0500596_001239_2000_2863 273
93 3300003794 Ga0055531_10021933 Ga0055531_100219332 274
94 3300005347 Ga0070668_100003647 Ga0070668_1000036473 274
95 3300005353 Ga0070669_100009680 Ga0070669_1000096802 274
96 3300005355 Ga0070671_100015818 Ga0070671_1000158183 274
97 3300005617 Ga0068859_100012653 Ga0068859_1000126535 274
98 3300005719 Ga0068861_100366727 Ga0068861_1003667272 274
99 3300005841 Ga0068863_100001891 Ga0068863_10000189113 274
100 3300005842 Ga0068858_100009930 Ga0068858_1000099304 274
101 3300005843 Ga0068860_100081778 Ga0068860_1000817782 274
102 3300006931 Ga0097620_100012653 Ga0097620_1000126535 274
103 3300009177 Ga0105248_10021528 Ga0105248_100215283 274
104 3300014325 Ga0163163_10002453 Ga0163163_1000245312 274
105 3300014968 Ga0157379_10027128 Ga0157379_100271285 274
106 3300025304 Ga0209257_1001135 Ga0209257_100113528 274
107 3300025923 Ga0207681_10008523 Ga0207681_100085234 274
108 3300025931 Ga0207644_10010335 Ga0207644_100103354 274
109 3300025941 Ga0207711_10045768 Ga0207711_100457683 274
110 3300025972 Ga0207668_10003243 Ga0207668_100032433 274
111 3300026088 Ga0207641_10004917 Ga0207641_100049175 274
112 3300026118 Ga0207675_100201814 Ga0207675_1002018142 274
113 3300028381 Ga0268264_10044071 Ga0268264_100440713 274
114 3300028786 Ga0307517_10012250 Ga0307517_100122504 274
115 3300031456 Ga0307513_10001153 Ga0307513_100011538 274
116 3300032004 Ga0307414_10090110 Ga0307414_100901102 274
117 3300037471 Ga0395905_0182874 Ga0395905_0182874_503_1366 274
118 3300045051 Ga0451576_0183262 Ga0451576_0183262_112_954 274
119 3300046460 Ga0495638_0124406 Ga0495638_0124406_176_1039 274
120 3300046694 Ga0495649_0000868 Ga0495649_0000868_11197_12060 274
121 3300049570 Ga0501033_0050203 Ga0501033_0050203_1013_1873 274
122 3300049573 Ga0501037_0070446 Ga0501037_0070446_1485_2345 274
123 3300049581 Ga0501047_0078904 Ga0501047_0078904_1082_1942 274
124 3300049823 Ga0501044_0011457 Ga0501044_0011457_7530_8390 274
125 3300003322 rootL2_10108629 rootL2_101086292 275
126 3300005331 Ga0070670_100221763 Ga0070670_1002217631 275
127 3300005347 Ga0070668_100032514 Ga0070668_1000325143 275
128 3300005353 Ga0070669_100224256 Ga0070669_1002242562 275
129 3300005367 Ga0070667_100015009 Ga0070667_1000150092 275
130 3300005617 Ga0068859_100008475 Ga0068859_1000084757 275
131 3300005841 Ga0068863_100071096 Ga0068863_1000710962 275
132 3300005842 Ga0068858_100058358 Ga0068858_1000583582 275
133 3300005843 Ga0068860_100053593 Ga0068860_1000535933 275
134 3300005844 Ga0068862_100041215 Ga0068862_1000412153 275
135 3300006931 Ga0097620_100008475 Ga0097620_1000084757 275
136 3300021384 Ga0213876_10023034 Ga0213876_100230344 275
137 3300025923 Ga0207681_10026538 Ga0207681_100265384 275
138 3300025925 Ga0207650_10029759 Ga0207650_100297592 275
139 3300025972 Ga0207668_10060410 Ga0207668_100604103 275
140 3300025986 Ga0207658_10007659 Ga0207658_100076596 275
141 3300026035 Ga0207703_10119100 Ga0207703_101191003 275
142 3300026095 Ga0207676_10193065 Ga0207676_101930652 275
143 3300026118 Ga0207675_100040064 Ga0207675_1000400642 275
144 3300028380 Ga0268265_10040101 Ga0268265_100401013 275
145 3300028381 Ga0268264_10132016 Ga0268264_101320162 275
146 3300039437 Ga0436365_1718085 Ga0436365_1718085_474_1337 275
147 3300046684 Ga0495669_0000024 Ga0495669_0000024_19993_20856 275
148 3300047472 Ga0495686_0070101 Ga0495686_0070101_560_1423 275
149 3300049582 Ga0501048_0062234 Ga0501048_0062234_489_1352 275
150 3300053108 Ga0500562_000706 Ga0500562_000706_6959_7822 275
151 3300005366 Ga0070659_100082619 Ga0070659_1000826192 276
152 3300005458 Ga0070681_10102470 Ga0070681_101024703 276
153 3300005530 Ga0070679_100118978 Ga0070679_1001189782 276
154 3300005539 Ga0068853_100117512 Ga0068853_1001175122 276
155 3300005548 Ga0070665_100000116 Ga0070665_10000011642 276
156 3300005563 Ga0068855_100153498 Ga0068855_1001534983 276
157 3300006042 Ga0075368_10000507 Ga0075368_100005078 276
158 3300006178 Ga0075367_10028953 Ga0075367_100289533 276
159 3300006195 Ga0075366_10038607 Ga0075366_100386072 276
160 3300006353 Ga0075370_10146693 Ga0075370_101466932 276
161 3300009551 Ga0105238_10526611 Ga0105238_105266111 276
162 3300025917 Ga0207660_10006796 Ga0207660_100067964 276
163 3300025919 Ga0207657_10011260 Ga0207657_100112606 276
164 3300025921 Ga0207652_10016562 Ga0207652_100165623 276
165 3300025932 Ga0207690_10025820 Ga0207690_100258204 276
166 3300025949 Ga0207667_10105079 Ga0207667_101050792 276
167 3300028379 Ga0268266_10000064 Ga0268266_10000064148 276
168 3300033180 Ga0307510_10020294 Ga0307510_100202943 276
169 3300035171 Ga0373946_0008035 Ga0373946_0008035_2264_3127 276
170 3300035695 Ga0373927_0005817 Ga0373927_0005817_1140_2003 276
171 3300037068 Ga0373925_0000478 Ga0373925_0000478_15238_16101 276
172 3300046684 Ga0495669_0068668 Ga0495669_0068668_718_1581 276
173 3300048928 Ga0496125_0010256 Ga0496125_0010256_5114_5977 276
174 3300048929 Ga0496126_0005285 Ga0496126_0005285_9312_10175 276
175 3300050491 nmdc:mga00v17_405_c1 nmdc:mga00v17_405_c1_17180_18043 276
176 3300050493 nmdc:mga0k408_81943_c1 nmdc:mga0k408_81943_c1_328_1191 276
177 3300050496 nmdc:mga07m45_1752_c1 nmdc:mga07m45_1752_c1_5688_6551 276
178 3300053156 Ga0500622_0050594 Ga0500622_0050594_1238_2101 276
179 3300005331 Ga0070670_100000037 Ga0070670_10000003799 277
180 3300005335 Ga0070666_10038205 Ga0070666_100382052 277
181 3300005347 Ga0070668_100000097 Ga0070668_10000009720 277
182 3300005367 Ga0070667_100000083 Ga0070667_10000008399 277
183 3300005548 Ga0070665_100002488 Ga0070665_10000248817 277
184 3300005618 Ga0068864_100001225 Ga0068864_10000122517 277
185 3300005841 Ga0068863_100000392 Ga0068863_10000039227 277
186 3300005843 Ga0068860_100000128 Ga0068860_10000012841 277
187 3300005844 Ga0068862_100000121 Ga0068862_10000012115 277
188 3300025903 Ga0207680_10012538 Ga0207680_100125384 277
189 3300025925 Ga0207650_10000099 Ga0207650_10000099123 277
190 3300025941 Ga0207711_10015019 Ga0207711_100150194 277
191 3300025961 Ga0207712_10003410 Ga0207712_100034107 277
192 3300025972 Ga0207668_10000828 Ga0207668_1000082813 277
193 3300025986 Ga0207658_10000209 Ga0207658_1000020922 277
194 3300026035 Ga0207703_10016753 Ga0207703_100167534 277
195 3300026088 Ga0207641_10000341 Ga0207641_1000034143 277
196 3300026095 Ga0207676_10000637 Ga0207676_100006377 277
197 3300028379 Ga0268266_10005451 Ga0268266_100054512 277
198 3300028380 Ga0268265_10001336 Ga0268265_1000133618 277
199 3300028381 Ga0268264_10000059 Ga0268264_10000059211 277
200 3300031456 Ga0307513_10002695 Ga0307513_1000269511 277
201 3300037312 Ga0395899_0100329 Ga0395899_0100329_177_1040 277
202 3300003781 Ga0055536_1001785 Ga0055536_10017852 278
203 3300003791 Ga0055530_10002235 Ga0055530_1000223511 278
204 3300003794 Ga0055531_10001651 Ga0055531_100016515 278
205 3300009177 Ga0105248_10167635 Ga0105248_101676353 278
206 3300013308 Ga0157375_10020078 Ga0157375_100200784 278
207 3300021384 Ga0213876_10000108 Ga0213876_1000010847 278
208 3300025292 Ga0209676_1001335 Ga0209676_10013355 278
209 3300025292 Ga0209676_1002066 Ga0209676_10020662 278
210 3300025298 Ga0209050_1000135 Ga0209050_100013511 278
211 3300025304 Ga0209257_1002835 Ga0209257_10028355 278
212 3300031456 Ga0307513_10005321 Ga0307513_100053216 278
213 3300039437 Ga0436365_1544656 Ga0436365_1544656_61420_62283 278
214 3300053122 Ga0500608_000025 Ga0500608_000025_65887_66750 278
215 3300053136 Ga0500559_0102368 Ga0500559_0102368_188_1051 278
216 3300003781 Ga0055536_1001784 Ga0055536_10017842 279
217 3300003791 Ga0055530_10002261 Ga0055530_1000226111 279
218 3300005563 Ga0068855_100163838 Ga0068855_1001638382 279
219 3300025292 Ga0209676_1000057 Ga0209676_100005730 279
220 3300025298 Ga0209050_1001221 Ga0209050_100122123 279
221 3300025303 Ga0209051_1003169 Ga0209051_10031692 279
222 3300025304 Ga0209257_1001883 Ga0209257_10018832 279
223 3300025949 Ga0207667_10109530 Ga0207667_101095303 279
224 3300005262 Ga0065165_1000979 Ga0065165_100097917 280
225 3300005335 Ga0070666_10083827 Ga0070666_100838272 280
226 3300005338 Ga0068868_100088795 Ga0068868_1000887953 280
227 3300005364 Ga0070673_100063025 Ga0070673_1000630253 280
228 3300005457 Ga0070662_100057312 Ga0070662_1000573123 280
229 3300005618 Ga0068864_100012817 Ga0068864_1000128179 280
230 3300005618 Ga0068864_100045218 Ga0068864_1000452183 280
231 3300006353 Ga0075370_10121370 Ga0075370_101213703 280
232 3300025295 Ga0209564_1005262 Ga0209564_10052627 280
233 3300025933 Ga0207706_10031495 Ga0207706_100314953 280
234 3300025960 Ga0207651_10051441 Ga0207651_100514413 280
235 3300026023 Ga0207677_10053357 Ga0207677_100533572 280
236 3300026088 Ga0207641_10248795 Ga0207641_102487951 280
237 3300026095 Ga0207676_10008902 Ga0207676_100089023 280
238 3300026095 Ga0207676_10032695 Ga0207676_100326953 280
239 3300037312 Ga0395899_0000407 Ga0395899_0000407_19823_20686 280
240 3300037418 Ga0395900_0000009 Ga0395900_0000009_259275_260138 280
241 3300037466 Ga0395898_0009683 Ga0395898_0009683_1305_2168 280
242 3300037471 Ga0395905_0005890 Ga0395905_0005890_185_1048 280
243 3300038443 Ga0395901_0000014 Ga0395901_0000014_210474_211337 280
244 3300046460 Ga0495638_0000595 Ga0495638_0000595_5033_5896 280
245 3300046506 Ga0495583_0000037 Ga0495583_0000037_47201_48064 280
246 3300047469 Ga0495673_0017258 Ga0495673_0017258_2410_3273 280
247 3300048909 Ga0496106_0030270 Ga0496106_0030270_1176_2039 280
248 3300048910 Ga0496107_0060824 Ga0496107_0060824_280_1143 280
249 3300048911 Ga0496108_0018026 Ga0496108_0018026_1724_2587 280
250 3300048912 Ga0496109_0322731 Ga0496109_0322731_228_1091 280
251 3300048913 Ga0496110_0474655 Ga0496110_0474655_241_1104 280
252 3300048915 Ga0496112_0020401 Ga0496112_0020401_1259_2122 280
253 3300048928 Ga0496125_0074667 Ga0496125_0074667_332_1195 280
254 3300053087 Ga0500643_025824 Ga0500643_025824_838_1701 280
255 3300009174 Ga0105241_10141161 Ga0105241_101411612 281
256 3300009551 Ga0105238_10072766 Ga0105238_100727664 281
257 3300037471 Ga0395905_0306811 Ga0395905_0306811_373_1236 281
258 3300037471 Ga0395905_0674679 Ga0395905_0674679_15_860 281
259 3300048918 Ga0496115_0076963 Ga0496115_0076963_987_1850 281
260 3300049569 Ga0501032_0066093 Ga0501032_0066093_1211_2074 281
261 3300003316 rootH1_10024972 rootH1_100249722 282
262 3300003794 Ga0055531_10004432 Ga0055531_100044324 282
263 3300025254 Ga0209148_1011724 Ga0209148_10117242 282
264 3300025304 Ga0209257_1000350 Ga0209257_100035078 282
265 3300026078 Ga0207702_10227814 Ga0207702_102278143 282
266 3300028794 Ga0307515_10046005 Ga0307515_100460056 282
267 3300031691 Ga0316579_10050212 Ga0316579_100502122 282
268 3300037312 Ga0395899_0000013 Ga0395899_0000013_68420_69283 282
269 3300046513 Ga0495616_0000159 Ga0495616_0000159_54056_54919 282
270 3300046519 Ga0495632_0005666 Ga0495632_0005666_7050_7913 282
271 3300046660 Ga0495625_0000080 Ga0495625_0000080_43725_44627 282
272 3300046660 Ga0495625_0011578 Ga0495625_0011578_194_1057 282
273 3300046691 Ga0495670_0113932 Ga0495670_0113932_241_1104 282
274 3300046810 Ga0495660_0108582 Ga0495660_0108582_250_1140 282
275 3300053108 Ga0500562_000904 Ga0500562_000904_5394_6257 282
276 3300053136 Ga0500559_0002934 Ga0500559_0002934_2215_3078 282
277 3300053156 Ga0500622_0043855 Ga0500622_0043855_1362_2225 282
278 iso_pu_bacteria 2928972540 2928974829 282
279 iso_pu_bacteria 2941485952 2941487512 282
280 iso_pu_bacteria 2977240413 2977242127 282
281 iso_pu_bacteria 2510917020 2511122761 283
282 iso_pu_bacteria 2582581279 2585148635 283
283 iso_pu_bacteria 2582581280 2585153854 283
284 iso_pu_bacteria 2582581293 2585198067 283
285 iso_pu_bacteria 2585428106 2587916594 283
286 iso_pu_bacteria 2643221545 2643747823 283
287 iso_pu_bacteria 2643221552 2643778509 283
288 iso_pu_bacteria 2643221574 2643883555 283
289 iso_pu_bacteria 2643221583 2643924918 283
290 iso_pu_bacteria 2643221584 2643931336 283
291 iso_pu_bacteria 2643221598 2644000213 283
292 iso_pu_bacteria 2643221614 2644085026 283
293 iso_pu_bacteria 2643221640 2644225875 283
294 iso_pu_bacteria 2643221642 2644235364 283
295 iso_pu_bacteria 2643221661 2644342578 283
296 iso_pu_bacteria 2643221663 2644352040 283
297 iso_pu_bacteria 2643221666 2644365878 283
298 iso_pu_bacteria 2643221691 2644511437 283
299 iso_pu_bacteria 2643221699 2644551909 283
300 iso_pu_bacteria 2643221699 2644553056 283
301 iso_pu_bacteria 2791355048 2792463339 283
302 iso_pu_bacteria 2818991435 2819537961 283
303 iso_pu_bacteria 2818991454 2819648478 283
304 iso_pu_bacteria 2843744320 2843748071 283
305 iso_pu_bacteria 2849560528 2849564890 283
306 iso_pu_bacteria 2849573788 2849574650 283
307 iso_pu_bacteria 2851153111 2851154607 283
308 iso_pu_bacteria 2857504554 2857506234 283
309 iso_pu_bacteria 2884960567 2884964989 283
310 iso_pu_bacteria 2898329390 2898329831 283
311 iso_pu_bacteria 2928531327 2928535262 283
312 3300013102 Ga0157371_10211905 Ga0157371_102119053 286
313 3300013104 Ga0157370_10064898 Ga0157370_100648984 286
314 3300042533 Ga0450901_001515 Ga0450901_001515_1380_2240 286
315 3300048925 Ga0496122_0018335 Ga0496122_0018335_3418_4278 286
316 3300048926 Ga0496123_0000539 Ga0496123_0000539_27927_28787 286
317 3300048928 Ga0496125_0006744 Ga0496125_0006744_10571_11431 286
318 3300049822 Ga0501035_0031556 Ga0501035_0031556_1859_2719 286
319 3300003215 JGI25153J46596_10011054 JGI25153J46596_100110542 287
320 3300003322 rootL2_10016341 rootL2_100163411 287
321 3300003773 Ga0055537_1001548 Ga0055537_10015484 287
322 3300003781 Ga0055536_1004131 Ga0055536_10041313 287
323 3300003790 Ga0055528_1009282 Ga0055528_10092825 287
324 3300003791 Ga0055530_10012334 Ga0055530_100123342 287
325 3300003794 Ga0055531_10003859 Ga0055531_100038597 287
326 3300005262 Ga0065165_1000277 Ga0065165_100027733 287
327 3300005339 Ga0070660_100025974 Ga0070660_1000259744 287
328 3300005339 Ga0070660_100039179 Ga0070660_1000391793 287
329 3300005340 Ga0070689_100552643 Ga0070689_1005526431 287
330 3300005341 Ga0070691_10016761 Ga0070691_100167612 287
331 3300005366 Ga0070659_100000206 Ga0070659_10000020617 287
332 3300005458 Ga0070681_10020463 Ga0070681_100204635 287
333 3300005458 Ga0070681_10137131 Ga0070681_101371312 287
334 3300005530 Ga0070679_100014435 Ga0070679_1000144355 287
335 3300005548 Ga0070665_100019655 Ga0070665_1000196553 287
336 3300005616 Ga0068852_100069141 Ga0068852_1000691412 287
337 3300006028 Ga0070717_10082704 Ga0070717_100827043 287
338 3300006881 Ga0068865_100001650 Ga0068865_1000016506 287
339 3300009093 Ga0105240_10002344 Ga0105240_1000234424 287
340 3300009093 Ga0105240_10003036 Ga0105240_1000303632 287
341 3300009093 Ga0105240_10103156 Ga0105240_101031563 287
342 3300009093 Ga0105240_10195224 Ga0105240_101952242 287
343 3300009093 Ga0105240_10430017 Ga0105240_104300172 287
344 3300009093 Ga0105240_10593506 Ga0105240_105935062 287
345 3300009093 Ga0105240_10626944 Ga0105240_106269442 287
346 3300009177 Ga0105248_10340869 Ga0105248_103408692 287
347 3300009551 Ga0105238_10002686 Ga0105238_1000268617 287
348 3300009551 Ga0105238_10036220 Ga0105238_100362206 287
349 3300009551 Ga0105238_10172779 Ga0105238_101727793 287
350 3300014325 Ga0163163_10008010 Ga0163163_100080104 287
351 3300025250 Ga0209026_1000755 Ga0209026_10007553 287
352 3300025263 Ga0209565_1000475 Ga0209565_100047522 287
353 3300025273 Ga0209673_1000941 Ga0209673_10009413 287
354 3300025291 Ga0209675_1006647 Ga0209675_10066473 287
355 3300025292 Ga0209676_1000061 Ga0209676_1000061147 287
356 3300025297 Ga0209758_1001598 Ga0209758_100159822 287
357 3300025297 Ga0209758_1002304 Ga0209758_10023044 287
358 3300025297 Ga0209758_1004011 Ga0209758_100401111 287
359 3300025298 Ga0209050_1000200 Ga0209050_100020037 287
360 3300025298 Ga0209050_1013858 Ga0209050_10138583 287
361 3300025298 Ga0209050_1034697 Ga0209050_10346971 287
362 3300025299 Ga0209256_1001833 Ga0209256_10018337 287
363 3300025299 Ga0209256_1002440 Ga0209256_100244011 287
364 3300025299 Ga0209256_1011418 Ga0209256_10114182 287
365 3300025304 Ga0209257_1000225 Ga0209257_100022537 287
366 3300025304 Ga0209257_1000439 Ga0209257_100043911 287
367 3300025903 Ga0207680_10242654 Ga0207680_102426542 287
368 3300025909 Ga0207705_10142704 Ga0207705_101427042 287
369 3300025912 Ga0207707_10034064 Ga0207707_100340642 287
370 3300025912 Ga0207707_10048598 Ga0207707_100485983 287
371 3300025913 Ga0207695_10001670 Ga0207695_100016706 287
372 3300025913 Ga0207695_10001727 Ga0207695_100017277 287
373 3300025913 Ga0207695_10011998 Ga0207695_100119987 287
374 3300025913 Ga0207695_10012731 Ga0207695_100127316 287
375 3300025913 Ga0207695_10123334 Ga0207695_101233342 287
376 3300025913 Ga0207695_10420739 Ga0207695_104207392 287
377 3300025914 Ga0207671_10230941 Ga0207671_102309412 287
378 3300025919 Ga0207657_10068631 Ga0207657_100686312 287
379 3300025921 Ga0207652_10049768 Ga0207652_100497683 287
380 3300025924 Ga0207694_10042964 Ga0207694_100429644 287
381 3300025924 Ga0207694_10151387 Ga0207694_101513872 287
382 3300025932 Ga0207690_10000129 Ga0207690_1000012949 287
383 3300025938 Ga0207704_10001553 Ga0207704_100015535 287
384 3300025949 Ga0207667_10029177 Ga0207667_100291774 287
385 3300026041 Ga0207639_10213845 Ga0207639_102138453 287
386 3300026142 Ga0207698_10242929 Ga0207698_102429292 287
387 3300026142 Ga0207698_10852606 Ga0207698_108526061 287
388 3300027665 Ga0209983_1012644 Ga0209983_10126443 287
389 3300028379 Ga0268266_10030256 Ga0268266_100302563 287
390 3300028786 Ga0307517_10054379 Ga0307517_100543793 287
391 3300031251 Ga0265327_10000166 Ga0265327_1000016626 287
392 3300031251 Ga0265327_10006559 Ga0265327_100065593 287
393 3300031251 Ga0265327_10165079 Ga0265327_101650791 287
394 3300031456 Ga0307513_10095473 Ga0307513_100954732 287
395 3300031901 Ga0307406_10000761 Ga0307406_1000076112 287
396 3300031911 Ga0307412_10137884 Ga0307412_101378842 287
397 3300035113 Ga0373936_0001078 Ga0373936_0001078_8759_9622 287
398 3300037068 Ga0373925_0082657 Ga0373925_0082657_593_1456 287
399 3300037312 Ga0395899_0038572 Ga0395899_0038572_2143_3006 287
400 3300037418 Ga0395900_0077750 Ga0395900_0077750_1345_2208 287
401 3300037466 Ga0395898_0027308 Ga0395898_0027308_64_927 287
402 3300037471 Ga0395905_0274642 Ga0395905_0274642_96_959 287
403 3300038443 Ga0395901_0279060 Ga0395901_0279060_151_1014 287
404 3300039437 Ga0436365_0504517 Ga0436365_0504517_3335_4198 287
405 3300044735 Ga0466968_0062017 Ga0466968_0062017_104_967 287
406 3300044735 Ga0466968_0072576 Ga0466968_0072576_474_1337 287
407 3300046453 Ga0495627_002098 Ga0495627_002098_1747_2610 287
408 3300046457 Ga0495590_0006851 Ga0495590_0006851_1507_2370 287
409 3300046460 Ga0495638_0000585 Ga0495638_0000585_9728_10591 287
410 3300046460 Ga0495638_0004039 Ga0495638_0004039_5309_6172 287
411 3300046460 Ga0495638_0015863 Ga0495638_0015863_2821_3684 287
412 3300046460 Ga0495638_0108515 Ga0495638_0108515_622_1485 287
413 3300046471 Ga0495650_0000007 Ga0495650_0000007_141332_142195 287
414 3300046507 Ga0495606_0086797 Ga0495606_0086797_715_1593 287
415 3300046512 Ga0495610_0000205 Ga0495610_0000205_56136_56999 287
416 3300046512 Ga0495610_0001459 Ga0495610_0001459_17969_18832 287
417 3300046512 Ga0495610_0003505 Ga0495610_0003505_421_1284 287
418 3300046518 Ga0495631_0007090 Ga0495631_0007090_1202_2065 287
419 3300046518 Ga0495631_0154919 Ga0495631_0154919_39_902 287
420 3300046519 Ga0495632_0036755 Ga0495632_0036755_1520_2410 287
421 3300046519 Ga0495632_0047472 Ga0495632_0047472_1008_1871 287
422 3300046520 Ga0495637_0005910 Ga0495637_0005910_875_1738 287
423 3300046520 Ga0495637_0062855 Ga0495637_0062855_130_993 287
424 3300046524 Ga0495648_0054005 Ga0495648_0054005_1367_2230 287
425 3300046524 Ga0495648_0068545 Ga0495648_0068545_785_1705 287
426 3300046530 Ga0495654_0000100 Ga0495654_0000100_83546_84409 287
427 3300046542 Ga0495597_0033131 Ga0495597_0033131_338_1201 287
428 3300046616 Ga0495668_0000345 Ga0495668_0000345_18175_19038 287
429 3300046616 Ga0495668_0002985 Ga0495668_0002985_12172_13035 287
430 3300046616 Ga0495668_0024823 Ga0495668_0024823_765_1655 287
431 3300046616 Ga0495668_0031972 Ga0495668_0031972_634_1497 287
432 3300046660 Ga0495625_0007880 Ga0495625_0007880_943_1806 287
433 3300046660 Ga0495625_0044891 Ga0495625_0044891_700_1563 287
434 3300046660 Ga0495625_0071086 Ga0495625_0071086_863_1726 287
435 3300046660 Ga0495625_0116160 Ga0495625_0116160_800_1663 287
436 3300046660 Ga0495625_0192873 Ga0495625_0192873_344_1207 287
437 3300046692 Ga0495671_0059220 Ga0495671_0059220_746_1609 287
438 3300047318 Ga0495636_0027952 Ga0495636_0027952_745_1608 287
439 3300047320 Ga0495672_0027862 Ga0495672_0027862_2352_3215 287
440 3300047469 Ga0495673_0000132 Ga0495673_0000132_56394_57296 287
441 3300047469 Ga0495673_0000330 Ga0495673_0000330_29648_30511 287
442 3300047472 Ga0495686_0000525 Ga0495686_0000525_14341_15204 287
443 3300047472 Ga0495686_0012848 Ga0495686_0012848_4045_4908 287
444 3300047472 Ga0495686_0086162 Ga0495686_0086162_156_1019 287
445 3300047472 Ga0495686_0089482 Ga0495686_0089482_178_1041 287
446 3300047472 Ga0495686_0102822 Ga0495686_0102822_126_989 287
447 3300048909 Ga0496106_0026740 Ga0496106_0026740_116_979 287
448 3300048910 Ga0496107_0000110 Ga0496107_0000110_27406_28269 287
449 3300048915 Ga0496112_0243332 Ga0496112_0243332_556_1419 287
450 3300048916 Ga0496113_0367287 Ga0496113_0367287_55_918 287
451 3300048918 Ga0496115_0000598 Ga0496115_0000598_13226_14089 287
452 3300048918 Ga0496115_0004231 Ga0496115_0004231_9243_10121 287
453 3300048918 Ga0496115_0014971 Ga0496115_0014971_1053_1916 287
454 3300048924 Ga0496121_0019891 Ga0496121_0019891_1273_2136 287
455 3300049459 Ga0495678_000191 Ga0495678_000191_58941_59804 287
456 3300049585 Ga0501069_0255952 Ga0501069_0255952_79_942 287
457 3300049671 Ga0501238_004550 Ga0501238_004550_728_1591 287
458 3300050493 nmdc:mga0k408_56455_c1 nmdc:mga0k408_56455_c1_1057_1920 287
459 3300053086 Ga0500578_0000008 Ga0500578_0000008_30450_31313 287
460 3300053088 Ga0500644_0000028 Ga0500644_0000028_62762_63625 287
461 3300053088 Ga0500644_0142534 Ga0500644_0142534_68_931 287
462 3300053093 Ga0500651_0006348 Ga0500651_0006348_5901_6764 287
463 3300053096 Ga0500641_0027163 Ga0500641_0027163_693_1556 287
464 3300053098 Ga0500650_0149652 Ga0500650_0149652_73_936 287
465 3300053104 Ga0500556_0000273 Ga0500556_0000273_15403_16266 287
466 3300053104 Ga0500556_0016230 Ga0500556_0016230_1038_1901 287
467 3300053108 Ga0500562_000813 Ga0500562_000813_441_1304 287
468 3300053118 Ga0500594_0000015 Ga0500594_0000015_19569_20432 287
469 3300053119 Ga0500595_050366 Ga0500595_050366_282_1145 287
470 3300053125 Ga0500618_000034 Ga0500618_000034_101386_102249 287
471 3300053134 Ga0500658_0002444 Ga0500658_0002444_1258_2121 287
472 3300053136 Ga0500559_0000005 Ga0500559_0000005_24764_25627 287
473 3300053138 Ga0500564_000007 Ga0500564_000007_62835_63698 287
474 3300053140 Ga0500573_0199349 Ga0500573_0199349_58_921 287
475 3300053142 Ga0500577_0001077 Ga0500577_0001077_151_1014 287
476 3300053156 Ga0500622_0000105 Ga0500622_0000105_47439_48302 287
477 3300053156 Ga0500622_0010120 Ga0500622_0010120_2838_3701 287
478 3300053156 Ga0500622_0011582 Ga0500622_0011582_3341_4204 287
479 3300053730 Ga0500645_002080 Ga0500645_002080_125_988 287
480 3300053730 Ga0500645_004920 Ga0500645_004920_1487_2350 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

50

276

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dab-assembly1.cif.gz_A l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate 0.9603 4 280
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.9594 4 280
5daa-assembly1.cif.gz_B e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate 0.9582 4 280
1g2w-assembly1.cif.gz_B e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase 0.9576 4 280
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.946 4 280
ID Description Score Start End Superfamily
3lqsA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9606 126 280 3.20.10.10
af_Q2FXI0_1_119_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9507 3 120 3.30.470.10
5cm0C01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9446 3 120 3.30.470.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9406 4 120 3.30.470.10
af_Q2FXI0_1_119_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9355 3 120 3.30.470.10
ID Description Score Start End GO Terms
AF-D6V6F1-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9896 1 280 GO:0005829
GO:0008483
GO:0046394
AF-A0A519KT82-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9871 170 286 GO:0005829
GO:0046394
GO:0047810
AF-A0A2D5FP47-F1-model_v4 deleted 0.9864 1 279
AF-A0A1H1FX82-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9842 1 280 GO:0005829
GO:0008483
GO:0046394
AF-A0A5M6I7J6-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9767 1 286 GO:0005829
GO:0008483
GO:0046394

Feature Viewer

pLDDT pTM Quality
93.77 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map