F452241

General Info

Members Datasets Scaffolds Average Seq Length
480 214 960 350

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100227057|Ga0207675_1002270571
Length 388
Sequence MKNELETKVEEIKQDADVQRALEQTAPAQQKKATLRTRLRDKFVIGSHLALLIVIGVVYQLIDIRFKWFFESYELVEKLIIAVSVAVVCLMLLRLIEVYFIGRVANAVHKYNLNRVARLVVWLVIGFFVLTILFQNWYTAVVSFGLISLVLGFALQTPITSFIGWIYILVREPYRVGDRIRIGTATGDVIDVGYLDTTLWEFGGDFLSTEHPSGRVIKFPNSSVLSTPVYNYTWPLFPYIWNEIKFPIAYNCDLDFVAKTMQEVAEQEVGEAMMKHVRVFRELLAQTPVNRLEVQERPVVLFRVADNSWLEVIVRYLVPPKEAGRVKNRLMKKLLTRLSAEPDGVTCPLALQVGQFGITQVRARSDQVGSLDPFSIAHVYVSRISWRE

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
184 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
185 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
186 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
197 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
198 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
212 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
213 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
214 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.04
Rhizosphere 97.71
Stem 0
Stem Tuber 0
Unclassified 15.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100227057 3300026118 Unclassified 1800
2 JGI24751J29686_10000032 3300002459 Bacteria 87712
3 JGI25406J46586_10010803 3300003203 Bacteria 4029
4 JGI25406J46586_10012716 3300003203 Bacteria 3638
5 JGI25406J46586_10013797 3300003203 Bacteria 3455
6 rootL2_10074879 3300003322 Bacteria 3646
7 Ga0065704_10079381 3300005289 Unclassified 4179
8 Ga0065704_10210461 3300005289 Bacteria 1111
9 Ga0065712_10020885 3300005290 Bacteria 2856
10 Ga0065712_10109014 3300005290 Bacteria 1863
11 Ga0065715_10024540 3300005293 Bacteria 1916
12 Ga0065715_10097959 3300005293 Bacteria 3615
13 Ga0065715_10132331 3300005293 Bacteria 1992
14 Ga0065715_10150343 3300005293 Unclassified 1737
15 Ga0065707_10000528 3300005295 Bacteria 36759
16 Ga0065707_10088794 3300005295 Bacteria 4540
17 Ga0065707_10103096 3300005295 Bacteria 2767
18 Ga0065707_10104752 3300005295 Bacteria 2680
19 Ga0070683_100108707 3300005329 Bacteria 2615
20 Ga0070670_100001346 3300005331 Bacteria 19660
21 Ga0070670_100046269 3300005331 Bacteria 3741
22 Ga0070670_100049569 3300005331 Bacteria 3610
23 Ga0070670_100099071 3300005331 Bacteria 2508
24 Ga0070670_100266166 3300005331 Bacteria 1495
25 Ga0070670_100286797 3300005331 Bacteria 1438
26 Ga0068869_100058130 3300005334 Bacteria 2826
27 Ga0068869_100058379 3300005334 Bacteria 2821
28 Ga0068869_100086211 3300005334 Bacteria 2353
29 Ga0068869_100355430 3300005334 Bacteria 1195
30 Ga0070680_100053126 3300005336 Bacteria 3307
31 Ga0070682_100007261 3300005337 Bacteria 6246
32 Ga0070682_100012701 3300005337 Bacteria 4833
33 Ga0068868_100005684 3300005338 Bacteria 8782
34 Ga0070689_100001941 3300005340 Bacteria 13387
35 Ga0070691_10126486 3300005341 Unclassified 1291
36 Ga0070661_100156579 3300005344 Bacteria 1724
37 Ga0070692_10008970 3300005345 Bacteria 4486
38 Ga0070692_10028429 3300005345 Bacteria 2778
39 Ga0070668_100001444 3300005347 Bacteria 17153
40 Ga0070669_100061190 3300005353 Bacteria 2766
41 Ga0070675_100307490 3300005354 Bacteria 1398
42 Ga0070673_100009067 3300005364 Bacteria 6660
43 Ga0070673_100292814 3300005364 Bacteria 1431
44 Ga0070703_10000276 3300005406 Bacteria 24391
45 Ga0070701_10044406 3300005438 Bacteria 2276
46 Ga0070701_10067201 3300005438 Bacteria 1907
47 Ga0070705_100000245 3300005440 Bacteria 32243
48 Ga0070705_100015304 3300005440 Bacteria 3962
49 Ga0070700_100000118 3300005441 Bacteria 49489
50 Ga0070700_100002188 3300005441 Bacteria 9933
51 Ga0070700_100006565 3300005441 Bacteria 6227
52 Ga0070700_100016829 3300005441 Bacteria 4170
53 Ga0070694_100002598 3300005444 Bacteria 10674
54 Ga0070694_100048167 3300005444 Bacteria 2866
55 Ga0070694_100131237 3300005444 Bacteria 1810
56 Ga0070708_100110442 3300005445 Unclassified 2526
57 Ga0070708_100205730 3300005445 Bacteria 1844
58 Ga0070708_100301426 3300005445 Bacteria 1509
59 Ga0070663_100083627 3300005455 Bacteria 2351
60 Ga0070662_100031529 3300005457 Bacteria 3720
61 Ga0070681_10134301 3300005458 Bacteria 2405
62 Ga0070681_10235199 3300005458 Bacteria 1746
63 Ga0068867_100058711 3300005459 Bacteria 2851
64 Ga0068867_100176717 3300005459 Bacteria 1695
65 Ga0068867_100366987 3300005459 Unclassified 1206
66 Ga0070706_100002730 3300005467 Bacteria 17642
67 Ga0070706_100005966 3300005467 Bacteria 11526
68 Ga0070706_100111247 3300005467 Bacteria 2549
69 Ga0070707_100028917 3300005468 Bacteria 5275
70 Ga0070707_100044060 3300005468 Bacteria 4271
71 Ga0070707_100105757 3300005468 Bacteria 2729
72 Ga0070707_100196893 3300005468 Bacteria 1964
73 Ga0070698_100025786 3300005471 Bacteria 6126
74 Ga0070698_100031813 3300005471 Bacteria 5468
75 Ga0070698_100044215 3300005471 Bacteria 4563
76 Ga0070698_100048935 3300005471 Unclassified 4318
77 Ga0070698_100159547 3300005471 Bacteria 2200
78 Ga0070699_100000009 3300005518 Bacteria 272902
79 Ga0070699_100008250 3300005518 Bacteria 9035
80 Ga0070699_100020795 3300005518 Bacteria 5659
81 Ga0070699_100041225 3300005518 Bacteria 3997
82 Ga0070699_100102068 3300005518 Bacteria 2515
83 Ga0070679_100328889 3300005530 Bacteria 1477
84 Ga0070697_100108217 3300005536 Bacteria 2314
85 Ga0068853_100252982 3300005539 Bacteria 1617
86 Ga0070672_100003395 3300005543 Bacteria 10322
87 Ga0070686_100023184 3300005544 Bacteria 3707
88 Ga0070695_100024621 3300005545 Unclassified 3711
89 Ga0070695_100040804 3300005545 Bacteria 2940
90 Ga0070696_100001408 3300005546 Bacteria 15708
91 Ga0070696_100022024 3300005546 Bacteria 4326
92 Ga0070696_100034574 3300005546 Bacteria 3477
93 Ga0070693_100013920 3300005547 Bacteria 4108
94 Ga0070693_100072042 3300005547 Bacteria 2037
95 Ga0070704_100015563 3300005549 Bacteria 4781
96 Ga0070704_100023451 3300005549 Bacteria 4031
97 Ga0070704_100032150 3300005549 Bacteria 3536
98 Ga0070704_100035469 3300005549 Bacteria 3391
99 Ga0070704_100198763 3300005549 Bacteria 1617
100 Ga0068857_100022496 3300005577 Bacteria 5547
101 Ga0068857_100061756 3300005577 Bacteria 3329
102 Ga0068857_100217433 3300005577 Bacteria 1745
103 Ga0068854_100115711 3300005578 Unclassified 2029
104 Ga0070702_100056410 3300005615 Bacteria 2268
105 Ga0070702_100278844 3300005615 Bacteria 1147
106 Ga0068859_100018183 3300005617 Bacteria 7065
107 Ga0068859_100018205 3300005617 Bacteria 7061
108 Ga0068859_100023081 3300005617 Bacteria 6239
109 Ga0068859_100066638 3300005617 Bacteria 3636
110 Ga0068859_100107397 3300005617 Bacteria 2851
111 Ga0068859_100109663 3300005617 Bacteria 2821
112 Ga0068859_100160721 3300005617 Bacteria 2325
113 Ga0068859_100296497 3300005617 Bacteria 1710
114 Ga0068859_100418812 3300005617 Unclassified 1436
115 Ga0068864_100012058 3300005618 Bacteria 7139
116 Ga0068864_100025305 3300005618 Bacteria 4997
117 Ga0068864_100053517 3300005618 Unclassified 3482
118 Ga0068864_100081984 3300005618 Bacteria 2829
119 Ga0068864_100493272 3300005618 Bacteria 1177
120 Ga0068861_100021228 3300005719 Bacteria 4667
121 Ga0068851_10003472 3300005834 Bacteria 7017
122 Ga0068870_10006085 3300005840 Bacteria 5300
123 Ga0068863_100047143 3300005841 Bacteria 4089
124 Ga0068863_100087398 3300005841 Unclassified 2954
125 Ga0068863_100117375 3300005841 Bacteria 2536
126 Ga0068863_100384597 3300005841 Bacteria 1371
127 Ga0068858_100121693 3300005842 Bacteria 2441
128 Ga0068858_100361959 3300005842 Unclassified 1390
129 Ga0068860_100012698 3300005843 Bacteria 8286
130 Ga0068860_100018678 3300005843 Bacteria 6741
131 Ga0068860_100233409 3300005843 Bacteria 1788
132 Ga0068860_100518351 3300005843 Unclassified 1192
133 Ga0068862_100014976 3300005844 Bacteria 6442
134 Ga0068862_100029030 3300005844 Bacteria 4659
135 Ga0068862_100133886 3300005844 Bacteria 2195
136 Ga0068862_100180043 3300005844 Bacteria 1897
137 Ga0081539_10000980 3300005985 Bacteria 53183
138 Ga0081539_10002125 3300005985 Bacteria 29321
139 Ga0081539_10002159 3300005985 Bacteria 28971
140 Ga0081539_10011263 3300005985 Bacteria 7107
141 Ga0070715_10000006 3300006163 Bacteria 216296
142 Ga0070716_100000010 3300006173 Bacteria 157261
143 Ga0075427_10000747 3300006194 Unclassified 3916
144 Ga0097621_100001839 3300006237 Bacteria 14544
145 Ga0097621_100160639 3300006237 Unclassified 1931
146 Ga0068871_100046279 3300006358 Unclassified 3504
147 Ga0075428_100020772 3300006844 Bacteria 7270
148 Ga0075428_100132646 3300006844 Unclassified 2709
149 Ga0075431_100003169 3300006847 Bacteria 15913
150 Ga0075431_100014180 3300006847 Bacteria 8059
151 Ga0075431_100025808 3300006847 Bacteria 6023
152 Ga0075431_100059558 3300006847 Bacteria 3940
153 Ga0075433_10002022 3300006852 Bacteria 15293
154 Ga0075433_10031186 3300006852 Bacteria 4555
155 Ga0075433_10085375 3300006852 Unclassified 2786
156 Ga0075433_10115827 3300006852 Bacteria 2378
157 Ga0075433_10267352 3300006852 Unclassified 1516
158 Ga0075433_10310151 3300006852 Bacteria 1396
159 Ga0075434_100006956 3300006871 Bacteria 10427
160 Ga0075434_100110207 3300006871 Bacteria 2763
161 Ga0075434_100129506 3300006871 Bacteria 2542
162 Ga0075434_100130813 3300006871 Bacteria 2529
163 Ga0075434_100147599 3300006871 Unclassified 2372
164 Ga0075429_100003359 3300006880 Bacteria 13643
165 Ga0075429_100024927 3300006880 Bacteria 5193
166 Ga0075429_100044862 3300006880 Bacteria 3845
167 Ga0075429_100045062 3300006880 Bacteria 3837
168 Ga0075429_100048375 3300006880 Plasmid 3698
169 Ga0075429_100128388 3300006880 Bacteria 2218
170 Ga0075429_100176928 3300006880 Bacteria 1869
171 Ga0068865_100123824 3300006881 Unclassified 1927
172 Ga0097620_100018180 3300006931 Bacteria 7065
173 Ga0097620_100018205 3300006931 Bacteria 7061
174 Ga0097620_100023084 3300006931 Bacteria 6239
175 Ga0097620_100066637 3300006931 Bacteria 3636
176 Ga0097620_100107408 3300006931 Bacteria 2851
177 Ga0097620_100109660 3300006931 Bacteria 2821
178 Ga0097620_100160716 3300006931 Bacteria 2325
179 Ga0097620_100296494 3300006931 Bacteria 1710
180 Ga0097620_100418783 3300006931 Unclassified 1436
181 Ga0075435_100040596 3300007076 Unclassified 3717
182 Ga0105240_10105390 3300009093 Bacteria 3423
183 Ga0111539_10002546 3300009094 Bacteria 24141
184 Ga0111539_10015403 3300009094 Bacteria 9514
185 Ga0111539_10077936 3300009094 Bacteria 3900
186 Ga0111539_10084180 3300009094 Bacteria 3740
187 Ga0111539_10181311 3300009094 Bacteria 2459
188 Ga0111539_10222056 3300009094 Unclassified 2200
189 Ga0111539_10347794 3300009094 Bacteria 1725
190 Ga0111539_10404872 3300009094 Unclassified 1589
191 Ga0105247_10002005 3300009101 Bacteria 14105
192 Ga0105247_10068834 3300009101 Bacteria 2207
193 Ga0114129_10008593 3300009147 Bacteria 14562
194 Ga0114129_10033491 3300009147 Bacteria 7261
195 Ga0114129_10077763 3300009147 Bacteria 4615
196 Ga0114129_10079088 3300009147 Bacteria 4572
197 Ga0114129_10096752 3300009147 Bacteria 4087
198 Ga0114129_10100054 3300009147 Bacteria 4012
199 Ga0114129_10151913 3300009147 Bacteria 3168
200 Ga0114129_10181450 3300009147 Unclassified 2863
201 Ga0114129_10340258 3300009147 Bacteria 1990
202 Ga0105243_10011740 3300009148 Bacteria 6623
203 Ga0105243_10035381 3300009148 Bacteria 3871
204 Ga0105243_10246719 3300009148 Bacteria 1592
205 Ga0105241_10008713 3300009174 Bacteria 7453
206 Ga0105241_10037817 3300009174 Bacteria 3637
207 Ga0105241_10276516 3300009174 Bacteria 1432
208 Ga0105242_10012256 3300009176 Bacteria 6598
209 Ga0105248_10007908 3300009177 Bacteria 11684
210 Ga0105248_10160803 3300009177 Bacteria 2533
211 Ga0105248_10162468 3300009177 Unclassified 2518
212 Ga0105248_10288450 3300009177 Bacteria 1848
213 Ga0105237_10000990 3300009545 Bacteria 38185
214 Ga0105237_10121511 3300009545 Unclassified 2606
215 Ga0105238_10095289 3300009551 Bacteria 2963
216 Ga0105249_10000092 3300009553 Bacteria 125188
217 Ga0105249_10003496 3300009553 Bacteria 13589
218 Ga0105249_10040914 3300009553 Bacteria 4211
219 Ga0105249_10072429 3300009553 Bacteria 3185
220 Ga0105249_10109148 3300009553 Bacteria 2613
221 Ga0105249_10135901 3300009553 Bacteria 2352
222 Ga0105239_10066545 3300010375 Bacteria 3958
223 Ga0105246_10012915 3300011119 Bacteria 5226
224 Ga0105246_10022941 3300011119 Bacteria 4034
225 Ga0157373_10006508 3300013100 Bacteria 8716
226 Ga0157373_10173001 3300013100 Unclassified 1520
227 Ga0157370_10056237 3300013104 Bacteria 3745
228 Ga0157369_10044247 3300013105 Bacteria 4847
229 Ga0157378_10055272 3300013297 Bacteria 3536
230 Ga0157378_10178332 3300013297 Bacteria 1997
231 Ga0157378_10183804 3300013297 Bacteria 1968
232 Ga0163162_10000002 3300013306 Bacteria 717331
233 Ga0163162_10045339 3300013306 Bacteria 4405
234 Ga0163162_10055255 3300013306 Bacteria 3996
235 Ga0163162_10139393 3300013306 Bacteria 2537
236 Ga0163162_10160668 3300013306 Bacteria 2368
237 Ga0163162_10258225 3300013306 Bacteria 1874
238 Ga0163162_10360374 3300013306 Bacteria 1587
239 Ga0163162_10545375 3300013306 Bacteria 1288
240 Ga0157372_10050287 3300013307 Bacteria 4637
241 Ga0157372_10094481 3300013307 Bacteria 3405
242 Ga0157372_10281587 3300013307 Bacteria 1933
243 Ga0157372_10282522 3300013307 Bacteria 1930
244 Ga0157372_10374899 3300013307 Bacteria 1658
245 Ga0157375_10050623 3300013308 Bacteria 4075
246 Ga0157375_10162819 3300013308 Bacteria 2374
247 Ga0157375_10206302 3300013308 Bacteria 2122
248 Ga0163163_10000062 3300014325 Bacteria 119109
249 Ga0163163_10006393 3300014325 Bacteria 10293
250 Ga0163163_10036050 3300014325 Bacteria 4802
251 Ga0157380_10003019 3300014326 Bacteria 11465
252 Ga0157380_10007584 3300014326 Bacteria 7709
253 Ga0157380_10074557 3300014326 Bacteria 2755
254 Ga0182008_10029400 3300014497 Bacteria 2777
255 Ga0157379_10005897 3300014968 Bacteria 10545
256 Ga0157379_10056167 3300014968 Unclassified 3518
257 Ga0157379_10160518 3300014968 Bacteria 2029
258 Ga0182006_1027895 3300015261 Bacteria 2301
259 Ga0163161_10000426 3300017792 Bacteria 35489
260 Ga0163161_10209814 3300017792 Bacteria 1504
261 Ga0209646_1005014 3300025246 Bacteria 2351
262 Ga0207697_10041026 3300025315 Bacteria 1900
263 Ga0207656_10017583 3300025321 Bacteria 2803
264 Ga0207653_10000081 3300025885 Bacteria 69110
265 Ga0207710_10000595 3300025900 Bacteria 21248
266 Ga0207688_10125537 3300025901 Bacteria 1500
267 Ga0207647_10030758 3300025904 Unclassified 3460
268 Ga0207685_10000010 3300025905 Bacteria 216792
269 Ga0207643_10010692 3300025908 Bacteria 4945
270 Ga0207684_10000161 3300025910 Bacteria 114989
271 Ga0207684_10020138 3300025910 Bacteria 5698
272 Ga0207684_10123914 3300025910 Unclassified 2217
273 Ga0207707_10085517 3300025912 Unclassified 2755
274 Ga0207671_10016454 3300025914 Bacteria 5745
275 Ga0207660_10037887 3300025917 Bacteria 3363
276 Ga0207662_10061294 3300025918 Bacteria 2258
277 Ga0207662_10098536 3300025918 Bacteria 1809
278 Ga0207652_10251713 3300025921 Bacteria 1593
279 Ga0207646_10000308 3300025922 Bacteria 66466
280 Ga0207646_10063273 3300025922 Unclassified 3303
281 Ga0207681_10089647 3300025923 Bacteria 2193
282 Ga0207681_10226401 3300025923 Bacteria 1449
283 Ga0207650_10000006 3300025925 Bacteria 544730
284 Ga0207650_10274774 3300025925 Bacteria 1370
285 Ga0207650_10291339 3300025925 Unclassified 1331
286 Ga0207659_10152559 3300025926 Bacteria 1805
287 Ga0207706_10057630 3300025933 Bacteria 3422
288 Ga0207706_10070726 3300025933 Bacteria 3069
289 Ga0207686_10090484 3300025934 Bacteria 2019
290 Ga0207709_10008457 3300025935 Bacteria 5693
291 Ga0207709_10026519 3300025935 Bacteria 3329
292 Ga0207670_10001000 3300025936 Bacteria 14947
293 Ga0207670_10062024 3300025936 Bacteria 2553
294 Ga0207670_10144975 3300025936 Unclassified 1755
295 Ga0207670_10243326 3300025936 Unclassified 1387
296 Ga0207704_10416951 3300025938 Bacteria 1063
297 Ga0207665_10000010 3300025939 Bacteria 157219
298 Ga0207665_10119623 3300025939 Bacteria 1859
299 Ga0207691_10005813 3300025940 Bacteria 11935
300 Ga0207691_10014109 3300025940 Bacteria 7622
301 Ga0207691_10070649 3300025940 Unclassified 3152
302 Ga0207711_10010667 3300025941 Bacteria 7640
303 Ga0207689_10007979 3300025942 Bacteria 9249
304 Ga0207689_10228680 3300025942 Bacteria 1537
305 Ga0207689_10264550 3300025942 Unclassified 1423
306 Ga0207667_10321247 3300025949 Bacteria 1581
307 Ga0207651_10080996 3300025960 Bacteria 2339
308 Ga0207651_10306466 3300025960 Bacteria 1323
309 Ga0207712_10000075 3300025961 Bacteria 120693
310 Ga0207712_10102996 3300025961 Unclassified 2126
311 Ga0207712_10132248 3300025961 Bacteria 1903
312 Ga0207712_10139608 3300025961 Bacteria 1858
313 Ga0207668_10001185 3300025972 Bacteria 15489
314 Ga0207703_10063539 3300026035 Bacteria 3027
315 Ga0207703_10112838 3300026035 Unclassified 2323
316 Ga0207703_10151447 3300026035 Bacteria 2023
317 Ga0207703_10480514 3300026035 Bacteria 1164
318 Ga0207678_10013050 3300026067 Bacteria 7290
319 Ga0207708_10000037 3300026075 Bacteria 137489
320 Ga0207708_10004858 3300026075 Bacteria 9906
321 Ga0207708_10007408 3300026075 Bacteria 8108
322 Ga0207708_10017652 3300026075 Bacteria 5371
323 Ga0207708_10027389 3300026075 Bacteria 4315
324 Ga0207708_10029442 3300026075 Bacteria 4162
325 Ga0207641_10178827 3300026088 Unclassified 1942
326 Ga0207641_10249018 3300026088 Bacteria 1659
327 Ga0207648_10026714 3300026089 Bacteria 5127
328 Ga0207648_10098460 3300026089 Bacteria 2561
329 Ga0207648_10215371 3300026089 Bacteria 1706
330 Ga0207676_10025312 3300026095 Bacteria 4403
331 Ga0207676_10105981 3300026095 Bacteria 2341
332 Ga0207676_10189856 3300026095 Unclassified 1807
333 Ga0207676_10392304 3300026095 Unclassified 1295
334 Ga0207674_10011426 3300026116 Bacteria 9978
335 Ga0207674_10020646 3300026116 Bacteria 7112
336 Ga0207674_10217699 3300026116 Bacteria 1858
337 Ga0207675_100034288 3300026118 Bacteria 4732
338 Ga0207675_100085809 3300026118 Bacteria 2955
339 Ga0207683_10048743 3300026121 Unclassified 3708
340 Ga0207683_10321929 3300026121 Bacteria 1416
341 Ga0207428_10007256 3300027907 Bacteria 10133
342 Ga0207428_10043224 3300027907 Bacteria 3640
343 Ga0268265_10041388 3300028380 Bacteria 3410
344 Ga0268265_10043867 3300028380 Unclassified 3327
345 Ga0268265_10150639 3300028380 Bacteria 1961
346 Ga0268264_10025492 3300028381 Bacteria 4831
347 Ga0268264_10137040 3300028381 Bacteria 2177
348 Ga0268264_10169963 3300028381 Bacteria 1971
349 Ga0268264_10200775 3300028381 Unclassified 1824
350 Ga0265327_10000008 3300031251 Bacteria 658870
351 Ga0307405_10174124 3300031731 Bacteria 1538
352 Ga0307405_10184958 3300031731 Bacteria 1499
353 Ga0307413_10000156 3300031824 Bacteria 18633
354 Ga0307413_10067759 3300031824 Bacteria 2233
355 Ga0307410_10064451 3300031852 Bacteria 2518
356 Ga0307410_10066836 3300031852 Bacteria 2478
357 Ga0307410_10121406 3300031852 Unclassified 1906
358 Ga0307406_10112196 3300031901 Bacteria 1879
359 Ga0307406_10204702 3300031901 Bacteria 1456
360 Ga0307407_10029139 3300031903 Bacteria 2962
361 Ga0307412_10145711 3300031911 Bacteria 1740
362 Ga0307412_10219284 3300031911 Bacteria 1457
363 Ga0307409_100161001 3300031995 Unclassified 1963
364 Ga0307416_100042526 3300032002 Bacteria 3548
365 Ga0307411_10080955 3300032005 Bacteria 2235
366 Ga0307411_10092198 3300032005 Unclassified 2118
367 Ga0307415_100043242 3300032126 Bacteria 3004
368 Ga0307415_100207514 3300032126 Bacteria 1560
369 Ga0373951_0002582 3300035091 Bacteria 4548
370 Ga0373941_0007671 3300035115 Bacteria 2650
371 Ga0373961_0048782 3300035241 Bacteria 1249
372 Ga0395899_0035997 3300037312 Bacteria 3714
373 Ga0395899_0054005 3300037312 Bacteria 2974
374 Ga0395899_0075313 3300037312 Bacteria 2464
375 Ga0395900_0001225 3300037418 Bacteria 31551
376 Ga0395900_0005166 3300037418 Bacteria 13706
377 Ga0395900_0198922 3300037418 Unclassified 2029
378 Ga0395898_0027935 3300037466 Bacteria 5658
379 Ga0395898_0042625 3300037466 Bacteria 4476
380 Ga0395898_0065509 3300037466 Bacteria 3522
381 Ga0395905_0020554 3300037471 Bacteria 6252
382 Ga0395901_0015313 3300038443 Bacteria 7804
383 Ga0395901_0108679 3300038443 Bacteria 2911
384 Ga0395901_0327084 3300038443 Bacteria 1585
385 Ga0242420_000597 3300038996 Bacteria 4210
386 Ga0439455_0005160 3300042012 Bacteria 2636
387 Ga0466972_0000077 3300044658 Bacteria 91574
388 Ga0466972_0015003 3300044658 Bacteria 3875
389 Ga0453683_0146291 3300044673 Bacteria 1492
390 Ga0453683_0189380 3300044673 Bacteria 1305
391 Ga0453684_0037001 3300044712 Bacteria 6709
392 Ga0453684_0121056 3300044712 Bacteria 3160
393 Ga0453684_0137604 3300044712 Bacteria 2921
394 Ga0466957_0002588 3300044842 Bacteria 9745
395 Ga0451576_0033856 3300045051 Bacteria 5428
396 Ga0451576_0134918 3300045051 Bacteria 2574
397 Ga0451576_0206301 3300045051 Unclassified 2052
398 Ga0451576_0459586 3300045051 Unclassified 1337
399 Ga0451576_0518847 3300045051 Unclassified 1252
400 Ga0495647_0077178 3300046681 Bacteria 1344
401 Ga0495624_0089162 3300046690 Bacteria 1904
402 Ga0496106_0039090 3300048909 Bacteria 3553
403 Ga0496107_0032228 3300048910 Bacteria 3745
404 Ga0496110_0190997 3300048913 Unclassified 1860
405 Ga0496112_0055118 3300048915 Bacteria 3908
406 Ga0496112_0099717 3300048915 Unclassified 2875
407 Ga0501034_0014959 3300049571 Bacteria 7981
408 Ga0501037_0006686 3300049573 Bacteria 8432
409 Ga0501037_0088364 3300049573 Bacteria 2243
410 Ga0501038_0000750 3300049574 Bacteria 28938
411 Ga0501038_0091825 3300049574 Bacteria 2543
412 Ga0501041_0282095 3300049577 Unclassified 1045
413 Ga0501043_0010086 3300049579 Bacteria 7407
414 Ga0501043_0021707 3300049579 Bacteria 5033
415 Ga0501047_0087388 3300049581 Unclassified 2995
416 Ga0501048_0053161 3300049582 Bacteria 2882
417 Ga0501070_0015349 3300049586 Bacteria 6445
418 Ga0501072_0004145 3300049588 Bacteria 10974
419 Ga0501075_0386351 3300049591 Unclassified 1067
420 Ga0501198_002122 3300049649 Bacteria 2641
421 Ga0501207_009669 3300049654 Bacteria 1411
422 Ga0501209_035903 3300049656 Bacteria 1285
423 Ga0501216_003559 3300049660 Bacteria 2277
424 Ga0501217_005082 3300049661 Bacteria 2734
425 Ga0501223_002101 3300049663 Unclassified 4468
426 Ga0501223_024695 3300049663 Bacteria 1169
427 Ga0501227_004177 3300049665 Bacteria 3106
428 Ga0501235_008875 3300049669 Bacteria 2192
429 Ga0501260_000457 3300049689 Unclassified 3193
430 Ga0501225_0011611 3300049705 Bacteria 2477
431 Ga0501079_0101285 3300049741 Bacteria 2233
432 Ga0501080_0212987 3300049742 Bacteria 1770
433 Ga0501081_0092216 3300049743 Unclassified 2131
434 Ga0501263_011008 3300049760 Bacteria 1118
435 Ga0501268_003301 3300049765 Bacteria 2198
436 Ga0501278_002837 3300049774 Bacteria 1217
437 Ga0501035_0008708 3300049822 Bacteria 9449
438 Ga0501044_0009521 3300049823 Bacteria 10577
439 Ga0501044_0032040 3300049823 Bacteria 5526
440 Ga0501044_0032826 3300049823 Bacteria 5457
441 Ga0501226_001114 3300049853 Unclassified 3474
442 Ga0501226_004065 3300049853 Bacteria 1708
443 nmdc:mga05p37_11587_c1 3300050507 Bacteria 10506
444 nmdc:mga05p37_173425_c1 3300050507 Bacteria 2629
445 nmdc:mga05p37_179782_c1 3300050507 Bacteria 2574
446 nmdc:mga05p37_27333_c1 3300050507 Bacteria 6945
447 nmdc:mga05p37_32057_c1 3300050507 Bacteria 6426
448 nmdc:mga05p37_46207_c1 3300050507 Bacteria 5354
449 nmdc:mga05p37_4628_c1 3300050507 Bacteria 14963
450 nmdc:mga05p37_51781_c1 3300050507 Bacteria 5048
451 nmdc:mga05p37_550977_c1 3300050507 Bacteria 1313
452 nmdc:mga09592_121470_c1 3300050508 Bacteria 2244
453 nmdc:mga09592_122946_c1 3300050508 Bacteria 2230
454 nmdc:mga09592_183756_c1 3300050508 Bacteria 1809
455 nmdc:mga09592_199654_c1 3300050508 Bacteria 1732
456 nmdc:mga09592_22419_c1 3300050508 Bacteria 5211
457 nmdc:mga09592_3154_c1 3300050508 Bacteria 13389
458 nmdc:mga09592_70225_c1 3300050508 Bacteria 2971
459 nmdc:mga09592_99272_c1 3300050508 Unclassified 2493
460 nmdc:mga0qj67_227235_c1 3300050509 Unclassified 1515
461 nmdc:mga06r32_129983_c1 3300050510 Unclassified 2490
462 nmdc:mga06r32_332206_c1 3300050510 Bacteria 1505
463 nmdc:mga08y16_15610_c1 3300050511 Bacteria 7986
464 nmdc:mga08y16_29969_c1 3300050511 Bacteria 5730
465 nmdc:mga08y16_339651_c1 3300050511 Unclassified 1544
466 nmdc:mga08y16_6140_c1 3300050511 Bacteria 12598
467 nmdc:mga08y16_88822_c1 3300050511 Bacteria 3221
468 nmdc:mga0n895_103343_c1 3300050512 Bacteria 2861
469 nmdc:mga0n895_400496_c1 3300050512 Unclassified 1388
470 nmdc:mga0n895_616387_c1 3300050512 Unclassified 1086
471 nmdc:mga0a205_174269_c1 3300050515 Unclassified 2047
472 nmdc:mga0a205_22865_c1 3300050515 Bacteria 5927
473 nmdc:mga0a205_272110_c1 3300050515 Unclassified 1571
474 nmdc:mga0a205_29461_c1 3300050515 Bacteria 5253
475 Ga0501084_0141391 3300054114 Unclassified 2027
476 Ga0530510_0007508 3300061734 Bacteria 7595
477 2538834727 2537561836 Bacteria 3910579
478 2643830971 2643221562 Bacteria 4048635
479 2643894673 2643221577 Bacteria 3710843
480 2644476822 2643221685 Bacteria 3673288
481 Ga0207675_100227057
482 JGI24751J29686_10000032
483 JGI25406J46586_10010803
484 JGI25406J46586_10012716
485 JGI25406J46586_10013797
486 rootL2_10074879
487 Ga0065704_10079381
488 Ga0065704_10210461
489 Ga0065712_10020885
490 Ga0065712_10109014
491 Ga0065715_10024540
492 Ga0065715_10097959
493 Ga0065715_10132331
494 Ga0065715_10150343
495 Ga0065707_10000528
496 Ga0065707_10088794
497 Ga0065707_10103096
498 Ga0065707_10104752
499 Ga0070683_100108707
500 Ga0070670_100001346
501 Ga0070670_100046269
502 Ga0070670_100049569
503 Ga0070670_100099071
504 Ga0070670_100266166
505 Ga0070670_100286797
506 Ga0068869_100058130
507 Ga0068869_100058379
508 Ga0068869_100086211
509 Ga0068869_100355430
510 Ga0070680_100053126
511 Ga0070682_100007261
512 Ga0070682_100012701
513 Ga0068868_100005684
514 Ga0070689_100001941
515 Ga0070691_10126486
516 Ga0070661_100156579
517 Ga0070692_10008970
518 Ga0070692_10028429
519 Ga0070668_100001444
520 Ga0070669_100061190
521 Ga0070675_100307490
522 Ga0070673_100009067
523 Ga0070673_100292814
524 Ga0070703_10000276
525 Ga0070701_10044406
526 Ga0070701_10067201
527 Ga0070705_100000245
528 Ga0070705_100015304
529 Ga0070700_100000118
530 Ga0070700_100002188
531 Ga0070700_100006565
532 Ga0070700_100016829
533 Ga0070694_100002598
534 Ga0070694_100048167
535 Ga0070694_100131237
536 Ga0070708_100110442
537 Ga0070708_100205730
538 Ga0070708_100301426
539 Ga0070663_100083627
540 Ga0070662_100031529
541 Ga0070681_10134301
542 Ga0070681_10235199
543 Ga0068867_100058711
544 Ga0068867_100176717
545 Ga0068867_100366987
546 Ga0070706_100002730
547 Ga0070706_100005966
548 Ga0070706_100111247
549 Ga0070707_100028917
550 Ga0070707_100044060
551 Ga0070707_100105757
552 Ga0070707_100196893
553 Ga0070698_100025786
554 Ga0070698_100031813
555 Ga0070698_100044215
556 Ga0070698_100048935
557 Ga0070698_100159547
558 Ga0070699_100000009
559 Ga0070699_100008250
560 Ga0070699_100020795
561 Ga0070699_100041225
562 Ga0070699_100102068
563 Ga0070679_100328889
564 Ga0070697_100108217
565 Ga0068853_100252982
566 Ga0070672_100003395
567 Ga0070686_100023184
568 Ga0070695_100024621
569 Ga0070695_100040804
570 Ga0070696_100001408
571 Ga0070696_100022024
572 Ga0070696_100034574
573 Ga0070693_100013920
574 Ga0070693_100072042
575 Ga0070704_100015563
576 Ga0070704_100023451
577 Ga0070704_100032150
578 Ga0070704_100035469
579 Ga0070704_100198763
580 Ga0068857_100022496
581 Ga0068857_100061756
582 Ga0068857_100217433
583 Ga0068854_100115711
584 Ga0070702_100056410
585 Ga0070702_100278844
586 Ga0068859_100018183
587 Ga0068859_100018205
588 Ga0068859_100023081
589 Ga0068859_100066638
590 Ga0068859_100107397
591 Ga0068859_100109663
592 Ga0068859_100160721
593 Ga0068859_100296497
594 Ga0068859_100418812
595 Ga0068864_100012058
596 Ga0068864_100025305
597 Ga0068864_100053517
598 Ga0068864_100081984
599 Ga0068864_100493272
600 Ga0068861_100021228
601 Ga0068851_10003472
602 Ga0068870_10006085
603 Ga0068863_100047143
604 Ga0068863_100087398
605 Ga0068863_100117375
606 Ga0068863_100384597
607 Ga0068858_100121693
608 Ga0068858_100361959
609 Ga0068860_100012698
610 Ga0068860_100018678
611 Ga0068860_100233409
612 Ga0068860_100518351
613 Ga0068862_100014976
614 Ga0068862_100029030
615 Ga0068862_100133886
616 Ga0068862_100180043
617 Ga0081539_10000980
618 Ga0081539_10002125
619 Ga0081539_10002159
620 Ga0081539_10011263
621 Ga0070715_10000006
622 Ga0070716_100000010
623 Ga0075427_10000747
624 Ga0097621_100001839
625 Ga0097621_100160639
626 Ga0068871_100046279
627 Ga0075428_100020772
628 Ga0075428_100132646
629 Ga0075431_100003169
630 Ga0075431_100014180
631 Ga0075431_100025808
632 Ga0075431_100059558
633 Ga0075433_10002022
634 Ga0075433_10031186
635 Ga0075433_10085375
636 Ga0075433_10115827
637 Ga0075433_10267352
638 Ga0075433_10310151
639 Ga0075434_100006956
640 Ga0075434_100110207
641 Ga0075434_100129506
642 Ga0075434_100130813
643 Ga0075434_100147599
644 Ga0075429_100003359
645 Ga0075429_100024927
646 Ga0075429_100044862
647 Ga0075429_100045062
648 Ga0075429_100048375
649 Ga0075429_100128388
650 Ga0075429_100176928
651 Ga0068865_100123824
652 Ga0097620_100018180
653 Ga0097620_100018205
654 Ga0097620_100023084
655 Ga0097620_100066637
656 Ga0097620_100107408
657 Ga0097620_100109660
658 Ga0097620_100160716
659 Ga0097620_100296494
660 Ga0097620_100418783
661 Ga0075435_100040596
662 Ga0105240_10105390
663 Ga0111539_10002546
664 Ga0111539_10015403
665 Ga0111539_10077936
666 Ga0111539_10084180
667 Ga0111539_10181311
668 Ga0111539_10222056
669 Ga0111539_10347794
670 Ga0111539_10404872
671 Ga0105247_10002005
672 Ga0105247_10068834
673 Ga0114129_10008593
674 Ga0114129_10033491
675 Ga0114129_10077763
676 Ga0114129_10079088
677 Ga0114129_10096752
678 Ga0114129_10100054
679 Ga0114129_10151913
680 Ga0114129_10181450
681 Ga0114129_10340258
682 Ga0105243_10011740
683 Ga0105243_10035381
684 Ga0105243_10246719
685 Ga0105241_10008713
686 Ga0105241_10037817
687 Ga0105241_10276516
688 Ga0105242_10012256
689 Ga0105248_10007908
690 Ga0105248_10160803
691 Ga0105248_10162468
692 Ga0105248_10288450
693 Ga0105237_10000990
694 Ga0105237_10121511
695 Ga0105238_10095289
696 Ga0105249_10000092
697 Ga0105249_10003496
698 Ga0105249_10040914
699 Ga0105249_10072429
700 Ga0105249_10109148
701 Ga0105249_10135901
702 Ga0105239_10066545
703 Ga0105246_10012915
704 Ga0105246_10022941
705 Ga0157373_10006508
706 Ga0157373_10173001
707 Ga0157370_10056237
708 Ga0157369_10044247
709 Ga0157378_10055272
710 Ga0157378_10178332
711 Ga0157378_10183804
712 Ga0163162_10000002
713 Ga0163162_10045339
714 Ga0163162_10055255
715 Ga0163162_10139393
716 Ga0163162_10160668
717 Ga0163162_10258225
718 Ga0163162_10360374
719 Ga0163162_10545375
720 Ga0157372_10050287
721 Ga0157372_10094481
722 Ga0157372_10281587
723 Ga0157372_10282522
724 Ga0157372_10374899
725 Ga0157375_10050623
726 Ga0157375_10162819
727 Ga0157375_10206302
728 Ga0163163_10000062
729 Ga0163163_10006393
730 Ga0163163_10036050
731 Ga0157380_10003019
732 Ga0157380_10007584
733 Ga0157380_10074557
734 Ga0182008_10029400
735 Ga0157379_10005897
736 Ga0157379_10056167
737 Ga0157379_10160518
738 Ga0182006_1027895
739 Ga0163161_10000426
740 Ga0163161_10209814
741 Ga0209646_1005014
742 Ga0207697_10041026
743 Ga0207656_10017583
744 Ga0207653_10000081
745 Ga0207710_10000595
746 Ga0207688_10125537
747 Ga0207647_10030758
748 Ga0207685_10000010
749 Ga0207643_10010692
750 Ga0207684_10000161
751 Ga0207684_10020138
752 Ga0207684_10123914
753 Ga0207707_10085517
754 Ga0207671_10016454
755 Ga0207660_10037887
756 Ga0207662_10061294
757 Ga0207662_10098536
758 Ga0207652_10251713
759 Ga0207646_10000308
760 Ga0207646_10063273
761 Ga0207681_10089647
762 Ga0207681_10226401
763 Ga0207650_10000006
764 Ga0207650_10274774
765 Ga0207650_10291339
766 Ga0207659_10152559
767 Ga0207706_10057630
768 Ga0207706_10070726
769 Ga0207686_10090484
770 Ga0207709_10008457
771 Ga0207709_10026519
772 Ga0207670_10001000
773 Ga0207670_10062024
774 Ga0207670_10144975
775 Ga0207670_10243326
776 Ga0207704_10416951
777 Ga0207665_10000010
778 Ga0207665_10119623
779 Ga0207691_10005813
780 Ga0207691_10014109
781 Ga0207691_10070649
782 Ga0207711_10010667
783 Ga0207689_10007979
784 Ga0207689_10228680
785 Ga0207689_10264550
786 Ga0207667_10321247
787 Ga0207651_10080996
788 Ga0207651_10306466
789 Ga0207712_10000075
790 Ga0207712_10102996
791 Ga0207712_10132248
792 Ga0207712_10139608
793 Ga0207668_10001185
794 Ga0207703_10063539
795 Ga0207703_10112838
796 Ga0207703_10151447
797 Ga0207703_10480514
798 Ga0207678_10013050
799 Ga0207708_10000037
800 Ga0207708_10004858
801 Ga0207708_10007408
802 Ga0207708_10017652
803 Ga0207708_10027389
804 Ga0207708_10029442
805 Ga0207641_10178827
806 Ga0207641_10249018
807 Ga0207648_10026714
808 Ga0207648_10098460
809 Ga0207648_10215371
810 Ga0207676_10025312
811 Ga0207676_10105981
812 Ga0207676_10189856
813 Ga0207676_10392304
814 Ga0207674_10011426
815 Ga0207674_10020646
816 Ga0207674_10217699
817 Ga0207675_100034288
818 Ga0207675_100085809
819 Ga0207683_10048743
820 Ga0207683_10321929
821 Ga0207428_10007256
822 Ga0207428_10043224
823 Ga0268265_10041388
824 Ga0268265_10043867
825 Ga0268265_10150639
826 Ga0268264_10025492
827 Ga0268264_10137040
828 Ga0268264_10169963
829 Ga0268264_10200775
830 Ga0265327_10000008
831 Ga0307405_10174124
832 Ga0307405_10184958
833 Ga0307413_10000156
834 Ga0307413_10067759
835 Ga0307410_10064451
836 Ga0307410_10066836
837 Ga0307410_10121406
838 Ga0307406_10112196
839 Ga0307406_10204702
840 Ga0307407_10029139
841 Ga0307412_10145711
842 Ga0307412_10219284
843 Ga0307409_100161001
844 Ga0307416_100042526
845 Ga0307411_10080955
846 Ga0307411_10092198
847 Ga0307415_100043242
848 Ga0307415_100207514
849 Ga0373951_0002582
850 Ga0373941_0007671
851 Ga0373961_0048782
852 Ga0395899_0035997
853 Ga0395899_0054005
854 Ga0395899_0075313
855 Ga0395900_0001225
856 Ga0395900_0005166
857 Ga0395900_0198922
858 Ga0395898_0027935
859 Ga0395898_0042625
860 Ga0395898_0065509
861 Ga0395905_0020554
862 Ga0395901_0015313
863 Ga0395901_0108679
864 Ga0395901_0327084
865 Ga0242420_000597
866 Ga0439455_0005160
867 Ga0466972_0000077
868 Ga0466972_0015003
869 Ga0453683_0146291
870 Ga0453683_0189380
871 Ga0453684_0037001
872 Ga0453684_0121056
873 Ga0453684_0137604
874 Ga0466957_0002588
875 Ga0451576_0033856
876 Ga0451576_0134918
877 Ga0451576_0206301
878 Ga0451576_0459586
879 Ga0451576_0518847
880 Ga0495647_0077178
881 Ga0495624_0089162
882 Ga0496106_0039090
883 Ga0496107_0032228
884 Ga0496110_0190997
885 Ga0496112_0055118
886 Ga0496112_0099717
887 Ga0501034_0014959
888 Ga0501037_0006686
889 Ga0501037_0088364
890 Ga0501038_0000750
891 Ga0501038_0091825
892 Ga0501041_0282095
893 Ga0501043_0010086
894 Ga0501043_0021707
895 Ga0501047_0087388
896 Ga0501048_0053161
897 Ga0501070_0015349
898 Ga0501072_0004145
899 Ga0501075_0386351
900 Ga0501198_002122
901 Ga0501207_009669
902 Ga0501209_035903
903 Ga0501216_003559
904 Ga0501217_005082
905 Ga0501223_002101
906 Ga0501223_024695
907 Ga0501227_004177
908 Ga0501235_008875
909 Ga0501260_000457
910 Ga0501225_0011611
911 Ga0501079_0101285
912 Ga0501080_0212987
913 Ga0501081_0092216
914 Ga0501263_011008
915 Ga0501268_003301
916 Ga0501278_002837
917 Ga0501035_0008708
918 Ga0501044_0009521
919 Ga0501044_0032040
920 Ga0501044_0032826
921 Ga0501226_001114
922 Ga0501226_004065
923 nmdc:mga05p37_11587_c1
924 nmdc:mga05p37_173425_c1
925 nmdc:mga05p37_179782_c1
926 nmdc:mga05p37_27333_c1
927 nmdc:mga05p37_32057_c1
928 nmdc:mga05p37_46207_c1
929 nmdc:mga05p37_4628_c1
930 nmdc:mga05p37_51781_c1
931 nmdc:mga05p37_550977_c1
932 nmdc:mga09592_121470_c1
933 nmdc:mga09592_122946_c1
934 nmdc:mga09592_183756_c1
935 nmdc:mga09592_199654_c1
936 nmdc:mga09592_22419_c1
937 nmdc:mga09592_3154_c1
938 nmdc:mga09592_70225_c1
939 nmdc:mga09592_99272_c1
940 nmdc:mga0qj67_227235_c1
941 nmdc:mga06r32_129983_c1
942 nmdc:mga06r32_332206_c1
943 nmdc:mga08y16_15610_c1
944 nmdc:mga08y16_29969_c1
945 nmdc:mga08y16_339651_c1
946 nmdc:mga08y16_6140_c1
947 nmdc:mga08y16_88822_c1
948 nmdc:mga0n895_103343_c1
949 nmdc:mga0n895_400496_c1
950 nmdc:mga0n895_616387_c1
951 nmdc:mga0a205_174269_c1
952 nmdc:mga0a205_22865_c1
953 nmdc:mga0a205_272110_c1
954 nmdc:mga0a205_29461_c1
955 Ga0501084_0141391
956 Ga0530510_0007508
957 2538834727
958 2643830971
959 2643894673
960 2644476822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00924

MS_channel_2nd

Mechanosensitive ion channel, beta-domain

157

234

0.85

Map