F452166

General Info

Members Datasets Scaffolds Average Seq Length
480 231 463 207

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10042787|Ga0070666_100427873
Length 228
Sequence MGRWQSPQAADGGAKAPKRNPTMPKLTGQLVIATHNAGKLREISALLAPYGVECLSAGELGLAEPAETGTTFAENALIKAHAAAKGANLPALADDSGLCVHALGNRPGVYTADWAERQWFEGEKGRDWYMAMGKIEGLLCELGPDADRSAHFACTLALAWPDGTEAIYEGTVQGSLTWPPRGAKGFGYDPVFIARGMEQSFAEIAPEAKHQISHRADAFAKLVAAQFG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
8 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
9 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
10 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
11 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
12 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
13 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
14 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
15 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
16 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
17 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 0
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 0.21
Rhizoplane 4.79
Rhizosphere 66.46
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3273488 2162886007 Bacteria 68965
2 JGI24751J29686_10000048 3300002459 Bacteria 72524
3 Ga0055536_1003137 3300003781 Bacteria 8974
4 Ga0055536_1007110 3300003781 Bacteria 5077
5 Ga0055536_1014789 3300003781 Bacteria 2713
6 Ga0055530_10000065 3300003791 Bacteria 94009
7 Ga0055530_10009472 3300003791 Bacteria 3740
8 Ga0055531_10003276 3300003794 Bacteria 10383
9 Ga0055531_10020577 3300003794 Bacteria 2602
10 Ga0065704_10007859 3300005289 Bacteria 2473
11 Ga0065704_10070144 3300005289 Bacteria 333223
12 Ga0065704_10191884 3300005289 Bacteria 1185
13 Ga0065707_10113679 3300005295 Bacteria 2320
14 Ga0070658_10000494 3300005327 Bacteria 34238
15 Ga0070658_10006358 3300005327 Bacteria 9573
16 Ga0070658_10008296 3300005327 Bacteria 8357
17 Ga0070658_10296036 3300005327 Bacteria 1379
18 Ga0070690_100567174 3300005330 Bacteria 858
19 Ga0070670_100182872 3300005331 Bacteria 1820
20 Ga0070666_10042787 3300005335 Bacteria 3031
21 Ga0070666_10264973 3300005335 Bacteria 1219
22 Ga0070680_100003975 3300005336 Bacteria 11064
23 Ga0070680_100328508 3300005336 Bacteria 1299
24 Ga0070660_100002657 3300005339 Bacteria 12279
25 Ga0070660_100027119 3300005339 Bacteria 4273
26 Ga0070660_100656747 3300005339 Bacteria 878
27 Ga0070661_100207338 3300005344 Bacteria 1499
28 Ga0070661_100405822 3300005344 Bacteria 1078
29 Ga0070668_100000239 3300005347 Bacteria 36109
30 Ga0070668_100005057 3300005347 Bacteria 9763
31 Ga0070668_100009143 3300005347 Bacteria 7352
32 Ga0070668_100249390 3300005347 Bacteria 1473
33 Ga0070669_100001651 3300005353 Bacteria 16134
34 Ga0070669_100053369 3300005353 Bacteria 2959
35 Ga0070669_100439168 3300005353 Bacteria 1074
36 Ga0070671_100000052 3300005355 Bacteria 78614
37 Ga0070671_100001987 3300005355 Bacteria 15701
38 Ga0070671_100006930 3300005355 Bacteria 9077
39 Ga0070671_100118820 3300005355 Bacteria 2224
40 Ga0070659_100006524 3300005366 Bacteria 8427
41 Ga0070667_100002216 3300005367 Bacteria 17087
42 Ga0070667_100004652 3300005367 Bacteria 11521
43 Ga0070667_100011190 3300005367 Bacteria 7422
44 Ga0070667_100950600 3300005367 Bacteria 801
45 Ga0070678_100020989 3300005456 Bacteria 4297
46 Ga0070662_100000817 3300005457 Bacteria 19185
47 Ga0070662_100013295 3300005457 Bacteria 5476
48 Ga0070662_100069318 3300005457 Bacteria 2595
49 Ga0070685_10414075 3300005466 Bacteria 936
50 Ga0070679_100137133 3300005530 Bacteria 2428
51 Ga0070679_100179812 3300005530 Bacteria 2088
52 Ga0070679_100369503 3300005530 Bacteria 1381
53 Ga0068853_100208857 3300005539 Bacteria 1779
54 Ga0070665_100000076 3300005548 Bacteria 189228
55 Ga0070665_100077613 3300005548 Bacteria 3328
56 Ga0070665_100484552 3300005548 Bacteria 1247
57 Ga0068855_100005198 3300005563 Bacteria 15875
58 Ga0068855_100024135 3300005563 Bacteria 7279
59 Ga0068855_100025347 3300005563 Bacteria 7096
60 Ga0068855_100040201 3300005563 Bacteria 5551
61 Ga0068855_100116913 3300005563 Bacteria 3056
62 Ga0068855_100396977 3300005563 Bacteria 1512
63 Ga0068855_100857599 3300005563 Bacteria 962
64 Ga0070664_100009011 3300005564 Bacteria 8095
65 Ga0070664_100023442 3300005564 Bacteria 5099
66 Ga0068857_100025453 3300005577 Bacteria 5211
67 Ga0068857_100140917 3300005577 Bacteria 2179
68 Ga0068854_100000453 3300005578 Bacteria 25275
69 Ga0068854_100003003 3300005578 Bacteria 10472
70 Ga0068854_100010580 3300005578 Bacteria 5986
71 Ga0068854_100061583 3300005578 Bacteria 2718
72 Ga0068856_100034004 3300005614 Bacteria 4992
73 Ga0068856_100140114 3300005614 Bacteria 2425
74 Ga0068852_100000317 3300005616 Bacteria 32757
75 Ga0068852_100158174 3300005616 Bacteria 2113
76 Ga0068852_100557159 3300005616 Bacteria 1147
77 Ga0068852_100930508 3300005616 Bacteria 887
78 Ga0068852_101035750 3300005616 Bacteria 840
79 Ga0068859_100103742 3300005617 Bacteria 2902
80 Ga0068864_100017330 3300005618 Bacteria 6004
81 Ga0068864_100020793 3300005618 Bacteria 5492
82 Ga0068864_100210585 3300005618 Bacteria 1790
83 Ga0068861_100026515 3300005719 Bacteria 4214
84 Ga0068863_100000005 3300005841 Bacteria 269757
85 Ga0068863_100004778 3300005841 Bacteria 13347
86 Ga0068863_100011089 3300005841 Bacteria 8740
87 Ga0068863_100024889 3300005841 Bacteria 5709
88 Ga0068863_100828093 3300005841 Bacteria 924
89 Ga0068858_100031869 3300005842 Bacteria 4899
90 Ga0068858_100038296 3300005842 Bacteria 4448
91 Ga0068858_100181956 3300005842 Bacteria 1985
92 Ga0068858_100223207 3300005842 Bacteria 1785
93 Ga0068860_100000192 3300005843 Bacteria 97363
94 Ga0068860_100006776 3300005843 Bacteria 11488
95 Ga0068860_100019392 3300005843 Bacteria 6596
96 Ga0068860_100044281 3300005843 Bacteria 4242
97 Ga0068860_100247962 3300005843 Bacteria 1733
98 Ga0068860_100423996 3300005843 Bacteria 1319
99 Ga0068862_100005791 3300005844 Bacteria 10301
100 Ga0068862_100015532 3300005844 Bacteria 6323
101 Ga0068862_100063033 3300005844 Bacteria 3190
102 Ga0075368_10001784 3300006042 Bacteria 6921
103 Ga0075363_100006360 3300006048 Bacteria 5351
104 Ga0075364_10001132 3300006051 Bacteria 14223
105 Ga0075364_10334162 3300006051 Bacteria 1032
106 Ga0075362_10000001 3300006177 Bacteria 215983
107 Ga0075367_10007729 3300006178 Bacteria 5528
108 Ga0075369_10014399 3300006186 Bacteria 3159
109 Ga0075369_10037935 3300006186 Bacteria 2054
110 Ga0075366_10000420 3300006195 Bacteria 19887
111 Ga0075366_10022760 3300006195 Bacteria 3648
112 Ga0075366_10029053 3300006195 Bacteria 3246
113 Ga0075366_10039496 3300006195 Bacteria 2790
114 Ga0075366_10181474 3300006195 Bacteria 1279
115 Ga0097621_100203620 3300006237 Bacteria 1719
116 Ga0075370_10006385 3300006353 Bacteria 5924
117 Ga0075370_10039137 3300006353 Bacteria 2671
118 Ga0075370_10197573 3300006353 Bacteria 1186
119 Ga0075370_10331473 3300006353 Bacteria 907
120 Ga0097620_100103737 3300006931 Bacteria 2902
121 Ga0079104_1049262 3300006946 Bacteria 945
122 Ga0105251_10004260 3300009011 Bacteria 9859
123 Ga0105250_10083027 3300009092 Bacteria 1300
124 Ga0105240_10093938 3300009093 Bacteria 3660
125 Ga0105240_10353091 3300009093 Bacteria 1668
126 Ga0105240_10672608 3300009093 Bacteria 1133
127 Ga0105241_10045981 3300009174 Bacteria 3314
128 Ga0105248_10027378 3300009177 Bacteria 6345
129 Ga0105248_10053512 3300009177 Bacteria 4529
130 Ga0105248_10863846 3300009177 Bacteria 1021
131 Ga0105238_10017569 3300009551 Bacteria 7273
132 Ga0105249_10605503 3300009553 Bacteria 1151
133 Ga0105246_10001236 3300011119 Bacteria 14986
134 Ga0157373_10003144 3300013100 Bacteria 12471
135 Ga0157373_10628772 3300013100 Bacteria 783
136 Ga0157371_10008038 3300013102 Bacteria 8442
137 Ga0157371_10025049 3300013102 Bacteria 4353
138 Ga0157371_10120434 3300013102 Bacteria 1865
139 Ga0157370_10008050 3300013104 Bacteria 11412
140 Ga0157370_10166325 3300013104 Bacteria 2051
141 Ga0157370_10494216 3300013104 Bacteria 1124
142 Ga0163162_10222813 3300013306 Bacteria 2016
143 Ga0163162_10384366 3300013306 Bacteria 1537
144 Ga0157372_10019088 3300013307 Bacteria 7381
145 Ga0157372_10020903 3300013307 Bacteria 7065
146 Ga0157375_10077430 3300013308 Bacteria 3355
147 Ga0157375_10471551 3300013308 Bacteria 1420
148 Ga0163161_10022106 3300017792 Bacteria 4477
149 Ga0163161_10679617 3300017792 Bacteria 855
150 Ga0209675_1004699 3300025291 Bacteria 5986
151 Ga0209676_1000084 3300025292 Bacteria 274330
152 Ga0209676_1000187 3300025292 Bacteria 141338
153 Ga0209676_1000236 3300025292 Bacteria 118705
154 Ga0209676_1033078 3300025292 Bacteria 1546
155 Ga0209676_1043978 3300025292 Bacteria 1228
156 Ga0209025_1013790 3300025294 Bacteria 5043
157 Ga0209025_1077424 3300025294 Bacteria 1147
158 Ga0209050_1000215 3300025298 Bacteria 129179
159 Ga0209050_1000400 3300025298 Bacteria 81202
160 Ga0209050_1005880 3300025298 Bacteria 7502
161 Ga0209050_1043439 3300025298 Bacteria 1215
162 Ga0209050_1056428 3300025298 Bacteria 956
163 Ga0209257_1000232 3300025304 Bacteria 130749
164 Ga0209257_1000250 3300025304 Bacteria 124024
165 Ga0209257_1002076 3300025304 Bacteria 21106
166 Ga0207713_1006366 3300025735 Bacteria 7204
167 Ga0207647_10028538 3300025904 Bacteria 3622
168 Ga0207647_10136471 3300025904 Bacteria 1439
169 Ga0207705_10000004 3300025909 Bacteria 705756
170 Ga0207705_10000237 3300025909 Bacteria 54736
171 Ga0207705_10002247 3300025909 Bacteria 14930
172 Ga0207705_10090655 3300025909 Bacteria 2238
173 Ga0207705_10094681 3300025909 Bacteria 2191
174 Ga0207705_10129657 3300025909 Bacteria 1876
175 Ga0207695_10023097 3300025913 Bacteria 7038
176 Ga0207695_10706647 3300025913 Bacteria 888
177 Ga0207660_10060600 3300025917 Bacteria 2721
178 Ga0207657_10000994 3300025919 Bacteria 30098
179 Ga0207657_10074428 3300025919 Bacteria 2868
180 Ga0207657_10280341 3300025919 Bacteria 1323
181 Ga0207657_10575220 3300025919 Bacteria 880
182 Ga0207649_10240594 3300025920 Bacteria 1299
183 Ga0207652_10001167 3300025921 Bacteria 23590
184 Ga0207652_10024417 3300025921 Bacteria 5015
185 Ga0207681_10000207 3300025923 Bacteria 46953
186 Ga0207681_10002660 3300025923 Bacteria 11323
187 Ga0207681_10078378 3300025923 Bacteria 2325
188 Ga0207694_10124636 3300025924 Bacteria 2060
189 Ga0207650_10040385 3300025925 Bacteria 3414
190 Ga0207650_10348756 3300025925 Bacteria 1217
191 Ga0207644_10000003 3300025931 Bacteria 585905
192 Ga0207644_10000836 3300025931 Bacteria 19551
193 Ga0207644_10002731 3300025931 Bacteria 11366
194 Ga0207644_10049306 3300025931 Bacteria 3014
195 Ga0207644_10108026 3300025931 Bacteria 2100
196 Ga0207644_10301295 3300025931 Bacteria 1292
197 Ga0207690_10008522 3300025932 Bacteria 6083
198 Ga0207706_10001603 3300025933 Bacteria 22433
199 Ga0207706_10017880 3300025933 Bacteria 6384
200 Ga0207706_10032430 3300025933 Bacteria 4652
201 Ga0207709_10290164 3300025935 Bacteria 1212
202 Ga0207711_10113216 3300025941 Bacteria 2415
203 Ga0207667_10005420 3300025949 Bacteria 15554
204 Ga0207667_10028719 3300025949 Bacteria 6039
205 Ga0207667_10032623 3300025949 Bacteria 5609
206 Ga0207667_10040467 3300025949 Bacteria 4963
207 Ga0207667_10607962 3300025949 Bacteria 1102
208 Ga0207667_10711604 3300025949 Bacteria 1006
209 Ga0207668_10000045 3300025972 Bacteria 103160
210 Ga0207668_10004680 3300025972 Bacteria 8053
211 Ga0207668_10526965 3300025972 Bacteria 1020
212 Ga0207640_10000675 3300025981 Bacteria 19912
213 Ga0207640_10001572 3300025981 Bacteria 12263
214 Ga0207658_10000002 3300025986 Bacteria 1364188
215 Ga0207658_10002073 3300025986 Bacteria 14924
216 Ga0207658_10013849 3300025986 Bacteria 5518
217 Ga0207658_10071789 3300025986 Bacteria 2622
218 Ga0207703_10005791 3300026035 Bacteria 9904
219 Ga0207703_10006188 3300026035 Bacteria 9577
220 Ga0207703_10039436 3300026035 Bacteria 3775
221 Ga0207703_10125271 3300026035 Bacteria 2211
222 Ga0207703_10381020 3300026035 Bacteria 1305
223 Ga0207639_10002292 3300026041 Bacteria 12855
224 Ga0207639_10396757 3300026041 Bacteria 1242
225 Ga0207678_10210880 3300026067 Bacteria 1661
226 Ga0207702_10004299 3300026078 Bacteria 12693
227 Ga0207641_10000064 3300026088 Bacteria 156652
228 Ga0207641_10004405 3300026088 Bacteria 12201
229 Ga0207641_10081853 3300026088 Bacteria 2804
230 Ga0207641_10196174 3300026088 Bacteria 1858
231 Ga0207676_10000895 3300026095 Bacteria 23119
232 Ga0207674_10029103 3300026116 Bacteria 5822
233 Ga0207674_10202093 3300026116 Bacteria 1936
234 Ga0207674_10530084 3300026116 Bacteria 1138
235 Ga0207675_100042197 3300026118 Bacteria 4258
236 Ga0207683_10075321 3300026121 Bacteria 2987
237 Ga0207698_10000192 3300026142 Bacteria 38082
238 Ga0207698_10045543 3300026142 Bacteria 3306
239 Ga0207698_10330083 3300026142 Bacteria 1432
240 Ga0209813_10000088 3300027866 Bacteria 34192
241 Ga0209974_10023046 3300027876 Bacteria 2061
242 Ga0209974_10024700 3300027876 Bacteria 1988
243 Ga0268266_10000347 3300028379 Bacteria 72151
244 Ga0268266_10056671 3300028379 Bacteria 3371
245 Ga0268265_10003108 3300028380 Bacteria 12110
246 Ga0268265_10003649 3300028380 Bacteria 10980
247 Ga0268265_10009551 3300028380 Bacteria 6552
248 Ga0268264_10000001 3300028381 Bacteria 1221000
249 Ga0268264_10000018 3300028381 Bacteria 495324
250 Ga0268264_10013929 3300028381 Bacteria 6609
251 Ga0268264_10030769 3300028381 Bacteria 4399
252 Ga0268264_10166653 3300028381 Bacteria 1989
253 Ga0268264_10367536 3300028381 Bacteria 1374
254 Ga0265327_10079494 3300031251 Bacteria 1623
255 Ga0307408_100033988 3300031548 Bacteria 3567
256 Ga0307408_100076959 3300031548 Bacteria 2483
257 Ga0307508_10076764 3300031616 Bacteria 2919
258 Ga0316576_10303034 3300031727 Bacteria 1194
259 Ga0307405_10006159 3300031731 Bacteria 5876
260 Ga0307405_10118791 3300031731 Bacteria 1805
261 Ga0307405_10280861 3300031731 Bacteria 1253
262 Ga0307413_10016703 3300031824 Bacteria 3801
263 Ga0307413_10126456 3300031824 Bacteria 1742
264 Ga0307410_10688612 3300031852 Bacteria 861
265 Ga0307406_10079054 3300031901 Bacteria 2180
266 Ga0307406_10129258 3300031901 Bacteria 1770
267 Ga0307406_10445720 3300031901 Bacteria 1037
268 Ga0307406_10833401 3300031901 Bacteria 781
269 Ga0307407_10014968 3300031903 Bacteria 3815
270 Ga0307412_10010412 3300031911 Bacteria 5355
271 Ga0307412_10012575 3300031911 Bacteria 4939
272 Ga0307412_10033899 3300031911 Bacteria 3249
273 Ga0307412_10404396 3300031911 Bacteria 1112
274 Ga0307416_100095399 3300032002 Bacteria 2568
275 Ga0307414_10009589 3300032004 Bacteria 5569
276 Ga0307414_10049719 3300032004 Bacteria 2901
277 Ga0307414_10059340 3300032004 Bacteria 2701
278 Ga0307414_10064786 3300032004 Bacteria 2604
279 Ga0307414_10077507 3300032004 Bacteria 2419
280 Ga0307414_10263584 3300032004 Bacteria 1439
281 Ga0307414_11109135 3300032004 Bacteria 731
282 Ga0307411_10012543 3300032005 Bacteria 4632
283 Ga0307411_10019715 3300032005 Bacteria 3903
284 Ga0307411_10131364 3300032005 Bacteria 1831
285 Ga0307411_10817085 3300032005 Bacteria 822
286 Ga0307415_100461683 3300032126 Bacteria 1101
287 Ga0316583_10003929 3300032133 Bacteria 5281
288 Ga0316582_0000948 3300036647 Bacteria 12016
289 Ga0316584_0042647 3300036712 Bacteria 3382
290 Ga0316584_0160599 3300036712 Bacteria 1670
291 Ga0400483_050515 3300039062 Bacteria 1539
292 Ga0436363_1390560 3300039450 Bacteria 1222
293 Ga0451787_524686 3300041441 Bacteria 987
294 Ga0451843_1338516 3300041509 Bacteria 891
295 Ga0451853_1262026 3300041512 Bacteria 885
296 Ga0450906_050985 3300042145 Unclassified 731
297 Ga0453684_0305287 3300044712 Bacteria 1808
298 Ga0453684_0551790 3300044712 Bacteria 1269
299 Ga0451576_0000007 3300045051 Bacteria 782228
300 Ga0495627_000376 3300046453 Bacteria 41152
301 Ga0495638_0093181 3300046460 Bacteria 1812
302 Ga0495650_0001801 3300046471 Bacteria 19318
303 Ga0495596_0000053 3300046500 Bacteria 84061
304 Ga0495596_0009181 3300046500 Bacteria 4362
305 Ga0495607_0005878 3300046501 Bacteria 8715
306 Ga0495606_0033526 3300046507 Bacteria 3541
307 Ga0495610_0000018 3300046512 Bacteria 355044
308 Ga0495610_0000743 3300046512 Bacteria 30950
309 Ga0495610_0011690 3300046512 Bacteria 5341
310 Ga0495616_0079529 3300046513 Bacteria 1571
311 Ga0495616_0158308 3300046513 Bacteria 1020
312 Ga0495632_0002987 3300046519 Bacteria 12373
313 Ga0495632_0021767 3300046519 Bacteria 3448
314 Ga0495643_0000110 3300046522 Bacteria 135600
315 Ga0495643_0009664 3300046522 Bacteria 5972
316 Ga0495643_0051780 3300046522 Bacteria 2207
317 Ga0495654_0045068 3300046530 Bacteria 2177
318 Ga0495609_0006358 3300046538 Bacteria 6033
319 Ga0495597_0101238 3300046542 Bacteria 1215
320 Ga0495668_0000228 3300046616 Bacteria 81208
321 Ga0495668_0012208 3300046616 Bacteria 5104
322 Ga0495625_0000169 3300046660 Bacteria 102287
323 Ga0495625_0040131 3300046660 Bacteria 3416
324 Ga0495625_0096993 3300046660 Bacteria 2030
325 Ga0495670_0168333 3300046691 Bacteria 1153
326 Ga0495671_0017610 3300046692 Bacteria 3801
327 Ga0495671_0021101 3300046692 Bacteria 3426
328 Ga0495681_0000020 3300047470 Bacteria 170007
329 Ga0495681_0061472 3300047470 Bacteria 1730
330 Ga0495686_0277354 3300047472 Bacteria 933
331 Ga0495615_0000166 3300048090 Bacteria 16471
332 Ga0496100_0194804 3300048903 Bacteria 1473
333 Ga0496100_0350364 3300048903 Bacteria 1115
334 Ga0496101_0012870 3300048904 Bacteria 5596
335 Ga0496101_0120174 3300048904 Bacteria 1985
336 Ga0496102_0075475 3300048905 Bacteria 3099
337 Ga0496102_0274532 3300048905 Bacteria 1589
338 Ga0496103_0021361 3300048906 Bacteria 3893
339 Ga0496103_0596990 3300048906 Bacteria 703
340 Ga0496104_0006148 3300048907 Bacteria 10539
341 Ga0496105_0081632 3300048908 Bacteria 2670
342 Ga0496106_0010890 3300048909 Bacteria 6718
343 Ga0496107_0199128 3300048910 Bacteria 1488
344 Ga0496108_0508178 3300048911 Bacteria 1052
345 Ga0496109_0347341 3300048912 Bacteria 1401
346 Ga0496109_0409967 3300048912 Bacteria 1280
347 Ga0496110_0170358 3300048913 Bacteria 1975
348 Ga0496111_0055215 3300048914 Bacteria 2872
349 Ga0496111_0093034 3300048914 Bacteria 2210
350 Ga0496112_0705756 3300048915 Bacteria 936
351 Ga0496113_0008873 3300048916 Bacteria 6574
352 Ga0496114_0006267 3300048917 Bacteria 9365
353 Ga0496114_0021863 3300048917 Bacteria 5207
354 Ga0496116_0000039 3300048919 Bacteria 349134
355 Ga0496116_0022757 3300048919 Bacteria 4687
356 Ga0496117_0037702 3300048920 Bacteria 3597
357 Ga0496118_0015316 3300048921 Bacteria 7106
358 Ga0496119_0063073 3300048922 Bacteria 2206
359 Ga0496121_0000206 3300048924 Bacteria 130071
360 Ga0496121_0001452 3300048924 Bacteria 40014
361 Ga0496121_0043170 3300048924 Bacteria 3909
362 Ga0496122_0000768 3300048925 Bacteria 61953
363 Ga0496122_0033761 3300048925 Bacteria 4201
364 Ga0496122_0043385 3300048925 Bacteria 3524
365 Ga0496123_0000335 3300048926 Bacteria 89251
366 Ga0496123_0001887 3300048926 Bacteria 27348
367 Ga0496123_0002011 3300048926 Bacteria 26244
368 Ga0496123_0024332 3300048926 Bacteria 4606
369 Ga0496124_0016392 3300048927 Bacteria 7047
370 Ga0496124_0034999 3300048927 Bacteria 4398
371 Ga0496124_0192970 3300048927 Bacteria 1556
372 Ga0496125_0013373 3300048928 Bacteria 8072
373 Ga0496125_0061824 3300048928 Bacteria 3001
374 Ga0496125_0113559 3300048928 Bacteria 1954
375 Ga0496125_0167933 3300048928 Bacteria 1480
376 Ga0496125_0207786 3300048928 Bacteria 1275
377 Ga0496125_0259657 3300048928 Bacteria 1089
378 Ga0496126_0000041 3300048929 Bacteria 340389
379 Ga0496126_0019826 3300048929 Bacteria 6613
380 Ga0496126_0020468 3300048929 Bacteria 6483
381 Ga0496126_0153908 3300048929 Bacteria 1969
382 Ga0496126_0218367 3300048929 Bacteria 1603
383 Ga0501032_0145541 3300049569 Bacteria 1560
384 Ga0501032_0151873 3300049569 Bacteria 1522
385 Ga0501033_0020373 3300049570 Bacteria 5009
386 Ga0501033_0251821 3300049570 Bacteria 1251
387 Ga0501034_0134521 3300049571 Bacteria 2454
388 Ga0501036_0011875 3300049572 Bacteria 7219
389 Ga0501036_0277309 3300049572 Bacteria 1403
390 Ga0501037_0063131 3300049573 Bacteria 2700
391 Ga0501037_0502576 3300049573 Bacteria 822
392 Ga0501038_0226065 3300049574 Bacteria 1491
393 Ga0501039_0018291 3300049575 Bacteria 5378
394 Ga0501043_0042280 3300049579 Bacteria 3581
395 Ga0501043_0305021 3300049579 Bacteria 1216
396 Ga0501047_0096221 3300049581 Bacteria 2839
397 Ga0501047_0119813 3300049581 Bacteria 2514
398 Ga0501047_0454623 3300049581 Bacteria 1110
399 Ga0501074_0615223 3300049590 Bacteria 768
400 Ga0501262_023546 3300049759 Bacteria 857
401 Ga0501035_0019445 3300049822 Bacteria 6245
402 Ga0501035_0112190 3300049822 Bacteria 2389
403 Ga0501044_0001194 3300049823 Bacteria 30781
404 Ga0501044_0028654 3300049823 Bacteria 5876
405 Ga0501044_0092710 3300049823 Bacteria 3046
406 Ga0501044_0150064 3300049823 Bacteria 2314
407 Ga0501044_0163337 3300049823 Bacteria 2202
408 Ga0501044_0334366 3300049823 Bacteria 1437
409 Ga0501044_0448568 3300049823 Bacteria 1197
410 nmdc:mga03683_16433_c1 3300050489 Bacteria 2780
411 nmdc:mga03683_334_c1 3300050489 Bacteria 13821
412 nmdc:mga03683_48_c1 3300050489 Bacteria 53827
413 nmdc:mga03n38_3617_c1 3300050490 Bacteria 4993
414 nmdc:mga03n38_48103_c1 3300050490 Bacteria 1891
415 nmdc:mga00v17_10475_c1 3300050491 Bacteria 5064
416 nmdc:mga00v17_3862_c2 3300050491 Bacteria 1800
417 nmdc:mga0yw44_98182_c1 3300050492 Bacteria 1862
418 nmdc:mga0k408_125855_c1 3300050493 Bacteria 1520
419 nmdc:mga0k408_49935_c1 3300050493 Bacteria 2422
420 nmdc:mga0k408_52250_c1 3300050493 Bacteria 2368
421 nmdc:mga0k408_64097_c1 3300050493 Bacteria 2138
422 nmdc:mga0k408_93_c1 3300050493 Bacteria 42678
423 nmdc:mga06z11_636_c1 3300050494 Bacteria 12763
424 nmdc:mga04h51_287_c1 3300050495 Bacteria 12948
425 nmdc:mga07m45_1318_c1 3300050496 Bacteria 11303
426 nmdc:mga07m45_179203_c1 3300050496 Bacteria 1232
427 nmdc:mga07m45_46_c1 3300050496 Bacteria 18747
428 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
429 nmdc:mga07m45_63050_c1 3300050496 Bacteria 2102
430 nmdc:mga07m45_9640_c1 3300050496 Bacteria 5018
431 nmdc:mga0sz30_2566_c1 3300050516 Bacteria 6464
432 nmdc:mga0sz30_64568_c1 3300050516 Bacteria 1568
433 Ga0500643_000001 3300053087 Bacteria 1440111
434 Ga0500643_003825 3300053087 Bacteria 7017
435 Ga0500643_007101 3300053087 Bacteria 4582
436 Ga0500643_089608 3300053087 Bacteria 839
437 Ga0500555_083252 3300053103 Bacteria 829
438 Ga0500556_0000013 3300053104 Bacteria 243797
439 Ga0500562_023177 3300053108 Bacteria 1620
440 Ga0500562_080702 3300053108 Bacteria 880
441 Ga0500592_001874 3300053116 Bacteria 3387
442 Ga0500592_015281 3300053116 Bacteria 1231
443 Ga0500595_080854 3300053119 Bacteria 951
444 Ga0500607_000082 3300053121 Bacteria 70790
445 Ga0500607_082906 3300053121 Bacteria 1630
446 Ga0500617_091536 3300053124 Bacteria 1300
447 Ga0500658_0036118 3300053134 Bacteria 1959
448 Ga0500559_0012183 3300053136 Bacteria 3660
449 Ga0500559_0015264 3300053136 Bacteria 3244
450 Ga0500559_0297293 3300053136 Bacteria 758
451 Ga0500564_231013 3300053138 Bacteria 743
452 Ga0500568_0001414 3300053139 Bacteria 15558
453 Ga0500590_004569 3300053148 Bacteria 6548
454 Ga0500604_0182213 3300053151 Bacteria 720
455 Ga0500622_0003161 3300053156 Bacteria 11263
456 Ga0500622_0086345 3300053156 Bacteria 1564
457 Ga0500627_0000012 3300053158 Bacteria 140613
458 Ga0500627_0230578 3300053158 Bacteria 824
459 Ga0500637_0032240 3300053178 Bacteria 2921
460 Ga0500645_001456 3300053730 Bacteria 11952
461 Ga0500645_002566 3300053730 Bacteria 7999
462 Ga0500645_013522 3300053730 Bacteria 2618
463 Ga0500645_022206 3300053730 Bacteria 1954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0274532 Ga0496102_0274532_504_1019 171
2 3300039450 Ga0436363_1390560 Ga0436363_1390560_679_1206 172
3 3300053108 Ga0500562_080702 Ga0500562_080702_319_852 177
4 3300006353 Ga0075370_10039137 Ga0075370_100391373 183
5 3300050496 nmdc:mga07m45_63050_c1 nmdc:mga07m45_63050_c1_317_949 183
6 3300005327 Ga0070658_10296036 Ga0070658_102960361 185
7 3300005530 Ga0070679_100137133 Ga0070679_1001371332 185
8 3300005563 Ga0068855_100396977 Ga0068855_1003969772 185
9 3300025909 Ga0207705_10002247 Ga0207705_1000224711 185
10 3300025949 Ga0207667_10607962 Ga0207667_106079622 185
11 3300031901 Ga0307406_10833401 Ga0307406_108334012 188
12 3300045051 Ga0451576_0000007 Ga0451576_0000007_46836_47462 190
13 3300042145 Ga0450906_050985 Ga0450906_050985_121_714 192
14 3300047472 Ga0495686_0277354 Ga0495686_0277354_41_679 192
15 3300049570 Ga0501033_0251821 Ga0501033_0251821_541_1164 193
16 3300049572 Ga0501036_0277309 Ga0501036_0277309_72_695 193
17 3300005327 Ga0070658_10008296 Ga0070658_100082962 194
18 3300005339 Ga0070660_100027119 Ga0070660_1000271192 194
19 3300005530 Ga0070679_100179812 Ga0070679_1001798122 194
20 3300025909 Ga0207705_10000237 Ga0207705_1000023731 194
21 3300025919 Ga0207657_10280341 Ga0207657_102803412 194
22 3300026067 Ga0207678_10210880 Ga0207678_102108802 194
23 3300049581 Ga0501047_0119813 Ga0501047_0119813_222_848 194
24 3300049590 Ga0501074_0615223 Ga0501074_0615223_19_645 194
25 3300049822 Ga0501035_0112190 Ga0501035_0112190_1232_1858 194
26 3300049823 Ga0501044_0163337 Ga0501044_0163337_1133_1759 194
27 3300005530 Ga0070679_100369503 Ga0070679_1003695032 195
28 3300025921 Ga0207652_10001167 Ga0207652_1000116710 195
29 3300049569 Ga0501032_0145541 Ga0501032_0145541_527_1156 196
30 3300013102 Ga0157371_10120434 Ga0157371_101204342 197
31 3300013104 Ga0157370_10494216 Ga0157370_104942162 197
32 3300031824 Ga0307413_10126456 Ga0307413_101264562 197
33 3300013102 Ga0157371_10025049 Ga0157371_100250493 198
34 3300025909 Ga0207705_10129657 Ga0207705_101296572 198
35 3300025935 Ga0207709_10290164 Ga0207709_102901641 199
36 3300049573 Ga0501037_0502576 Ga0501037_0502576_208_807 199
37 3300046616 Ga0495668_0012208 Ga0495668_0012208_3824_4444 200
38 3300048928 Ga0496125_0167933 Ga0496125_0167933_663_1304 200
39 3300053116 Ga0500592_015281 Ga0500592_015281_506_1126 200
40 3300039062 Ga0400483_050515 Ga0400483_050515_200_808 201
41 3300041441 Ga0451787_524686 Ga0451787_524686_38_643 201
42 iso_pu_bacteria 2894772417 2894776228 201
43 3300053108 Ga0500562_023177 Ga0500562_023177_754_1380 202
44 iso_pu_bacteria 2919138771 2919139894 202
45 3300005347 Ga0070668_100000239 Ga0070668_10000023928 203
46 3300005353 Ga0070669_100053369 Ga0070669_1000533693 203
47 3300005355 Ga0070671_100001987 Ga0070671_1000019879 203
48 3300005367 Ga0070667_100004652 Ga0070667_10000465212 203
49 3300005616 Ga0068852_100557159 Ga0068852_1005571592 203
50 3300005618 Ga0068864_100017330 Ga0068864_1000173302 203
51 3300005719 Ga0068861_100026515 Ga0068861_1000265151 203
52 3300005841 Ga0068863_100024889 Ga0068863_1000248893 203
53 3300005842 Ga0068858_100031869 Ga0068858_1000318691 203
54 3300005843 Ga0068860_100006776 Ga0068860_10000677613 203
55 3300005844 Ga0068862_100063033 Ga0068862_1000630333 203
56 3300006195 Ga0075366_10029053 Ga0075366_100290532 203
57 3300025923 Ga0207681_10078378 Ga0207681_100783782 203
58 3300025931 Ga0207644_10000836 Ga0207644_1000083613 203
59 3300025972 Ga0207668_10000045 Ga0207668_1000004514 203
60 3300025986 Ga0207658_10000002 Ga0207658_10000002902 203
61 3300026035 Ga0207703_10006188 Ga0207703_100061888 203
62 3300026088 Ga0207641_10004405 Ga0207641_100044058 203
63 3300026088 Ga0207641_10081853 Ga0207641_100818532 203
64 3300026095 Ga0207676_10000895 Ga0207676_1000089521 203
65 3300026118 Ga0207675_100042197 Ga0207675_1000421976 203
66 3300028380 Ga0268265_10003649 Ga0268265_1000364912 203
67 3300028381 Ga0268264_10000001 Ga0268264_100000011227 203
68 3300050493 nmdc:mga0k408_52250_c1 nmdc:mga0k408_52250_c1_1626_2258 203
69 3300053148 Ga0500590_004569 Ga0500590_004569_5045_5671 203
70 3300053730 Ga0500645_022206 Ga0500645_022206_367_996 203
71 iso_pu_bacteria 2643221560 2643822186 203
72 iso_pu_bacteria 2643221605 2644037237 203
73 iso_pu_bacteria 2510917021 2511127677 204
74 iso_pu_bacteria 2643221563 2643833355 204
75 iso_pu_bacteria 2643221608 2644054282 204
76 iso_pu_bacteria 2882806704 2882807786 204
77 iso_pu_bacteria 2895880812 2895886149 204
78 3300005578 Ga0068854_100010580 Ga0068854_1000105802 205
79 iso_pu_bacteria 2643221588 2643949231 205
80 iso_pu_bacteria 2818991438 2819550470 205
81 iso_pu_bacteria 2848297114 2848299855 205
82 iso_pu_bacteria 2852653556 2852654701 205
83 iso_pu_bacteria 2896184354 2896184864 205
84 iso_pu_bacteria 2896253425 2896255201 205
85 iso_pu_bacteria 3000865235 3000866083 205
86 iso_pu_bacteria 8054302542 8054306007 205
87 3300002459 JGI24751J29686_10000048 JGI24751J29686_1000004819 206
88 3300005289 Ga0065704_10007859 Ga0065704_100078591 206
89 3300005330 Ga0070690_100567174 Ga0070690_1005671741 206
90 3300005347 Ga0070668_100249390 Ga0070668_1002493902 206
91 3300005466 Ga0070685_10414075 Ga0070685_104140751 206
92 3300005548 Ga0070665_100484552 Ga0070665_1004845522 206
93 3300005563 Ga0068855_100024135 Ga0068855_1000241351 206
94 3300005616 Ga0068852_100158174 Ga0068852_1001581742 206
95 3300005618 Ga0068864_100210585 Ga0068864_1002105853 206
96 3300006048 Ga0075363_100006360 Ga0075363_1000063608 206
97 3300006177 Ga0075362_10000001 Ga0075362_1000000146 206
98 3300006186 Ga0075369_10014399 Ga0075369_100143993 206
99 3300006195 Ga0075366_10000420 Ga0075366_100004208 206
100 3300006195 Ga0075366_10181474 Ga0075366_101814742 206
101 3300006353 Ga0075370_10006385 Ga0075370_100063856 206
102 3300009093 Ga0105240_10093938 Ga0105240_100939383 206
103 3300009093 Ga0105240_10672608 Ga0105240_106726081 206
104 3300009177 Ga0105248_10863846 Ga0105248_108638462 206
105 3300009553 Ga0105249_10605503 Ga0105249_106055031 206
106 3300013306 Ga0163162_10222813 Ga0163162_102228132 206
107 3300025294 Ga0209025_1077424 Ga0209025_10774242 206
108 3300025923 Ga0207681_10000207 Ga0207681_1000020716 206
109 3300025925 Ga0207650_10348756 Ga0207650_103487562 206
110 3300025949 Ga0207667_10028719 Ga0207667_100287194 206
111 3300025949 Ga0207667_10040467 Ga0207667_100404671 206
112 3300025972 Ga0207668_10526965 Ga0207668_105269651 206
113 3300026035 Ga0207703_10381020 Ga0207703_103810201 206
114 3300026116 Ga0207674_10530084 Ga0207674_105300842 206
115 3300028381 Ga0268264_10166653 Ga0268264_101666532 206
116 3300031251 Ga0265327_10079494 Ga0265327_100794942 206
117 3300048903 Ga0496100_0194804 Ga0496100_0194804_763_1383 206
118 3300048904 Ga0496101_0012870 Ga0496101_0012870_1460_2080 206
119 3300048905 Ga0496102_0075475 Ga0496102_0075475_914_1534 206
120 3300048906 Ga0496103_0021361 Ga0496103_0021361_2914_3534 206
121 3300048908 Ga0496105_0081632 Ga0496105_0081632_714_1334 206
122 3300048909 Ga0496106_0010890 Ga0496106_0010890_3776_4396 206
123 3300048910 Ga0496107_0199128 Ga0496107_0199128_677_1297 206
124 3300048912 Ga0496109_0409967 Ga0496109_0409967_276_896 206
125 3300048914 Ga0496111_0055215 Ga0496111_0055215_1013_1633 206
126 3300048915 Ga0496112_0705756 Ga0496112_0705756_114_734 206
127 3300048916 Ga0496113_0008873 Ga0496113_0008873_5090_5710 206
128 3300048925 Ga0496122_0000768 Ga0496122_0000768_49513_50133 206
129 3300048926 Ga0496123_0000335 Ga0496123_0000335_1865_2485 206
130 3300050489 nmdc:mga03683_48_c1 nmdc:mga03683_48_c1_48046_48681 206
131 3300050490 nmdc:mga03n38_48103_c1 nmdc:mga03n38_48103_c1_1041_1676 206
132 3300050493 nmdc:mga0k408_125855_c1 nmdc:mga0k408_125855_c1_426_1046 206
133 3300050493 nmdc:mga0k408_93_c1 nmdc:mga0k408_93_c1_28560_29195 206
134 3300050496 nmdc:mga07m45_46_c1 nmdc:mga07m45_46_c1_3756_4376 206
135 3300050516 nmdc:mga0sz30_2566_c1 nmdc:mga0sz30_2566_c1_4904_5539 206
136 3300053087 Ga0500643_003825 Ga0500643_003825_3979_4599 206
137 3300053124 Ga0500617_091536 Ga0500617_091536_112_732 206
138 3300053156 Ga0500622_0086345 Ga0500622_0086345_695_1315 206
139 3300003781 Ga0055536_1014789 Ga0055536_10147892 207
140 3300005327 Ga0070658_10000494 Ga0070658_1000049423 207
141 3300005331 Ga0070670_100182872 Ga0070670_1001828722 207
142 3300005335 Ga0070666_10042787 Ga0070666_100427873 207
143 3300005335 Ga0070666_10264973 Ga0070666_102649731 207
144 3300005347 Ga0070668_100005057 Ga0070668_1000050572 207
145 3300005347 Ga0070668_100009143 Ga0070668_1000091436 207
146 3300005353 Ga0070669_100001651 Ga0070669_10000165115 207
147 3300005355 Ga0070671_100000052 Ga0070671_10000005233 207
148 3300005355 Ga0070671_100006930 Ga0070671_1000069309 207
149 3300005367 Ga0070667_100950600 Ga0070667_1009506001 207
150 3300005548 Ga0070665_100000076 Ga0070665_10000007675 207
151 3300005563 Ga0068855_100025347 Ga0068855_1000253471 207
152 3300005563 Ga0068855_100857599 Ga0068855_1008575992 207
153 3300005578 Ga0068854_100000453 Ga0068854_10000045320 207
154 3300005578 Ga0068854_100003003 Ga0068854_10000300312 207
155 3300005614 Ga0068856_100034004 Ga0068856_1000340047 207
156 3300005614 Ga0068856_100140114 Ga0068856_1001401143 207
157 3300005616 Ga0068852_100000317 Ga0068852_10000031728 207
158 3300005616 Ga0068852_101035750 Ga0068852_1010357502 207
159 3300005617 Ga0068859_100103742 Ga0068859_1001037422 207
160 3300005618 Ga0068864_100020793 Ga0068864_1000207932 207
161 3300005841 Ga0068863_100000005 Ga0068863_1000000052 207
162 3300005841 Ga0068863_100004778 Ga0068863_1000047783 207
163 3300005841 Ga0068863_100828093 Ga0068863_1008280932 207
164 3300005842 Ga0068858_100038296 Ga0068858_1000382962 207
165 3300005842 Ga0068858_100223207 Ga0068858_1002232071 207
166 3300005843 Ga0068860_100044281 Ga0068860_1000442816 207
167 3300005843 Ga0068860_100247962 Ga0068860_1002479622 207
168 3300005843 Ga0068860_100423996 Ga0068860_1004239962 207
169 3300005844 Ga0068862_100015532 Ga0068862_1000155323 207
170 3300006353 Ga0075370_10197573 Ga0075370_101975732 207
171 3300006931 Ga0097620_100103737 Ga0097620_1001037372 207
172 3300009011 Ga0105251_10004260 Ga0105251_100042609 207
173 3300009093 Ga0105240_10353091 Ga0105240_103530912 207
174 3300009177 Ga0105248_10027378 Ga0105248_100273787 207
175 3300009177 Ga0105248_10053512 Ga0105248_100535126 207
176 3300009551 Ga0105238_10017569 Ga0105238_100175698 207
177 3300025292 Ga0209676_1000187 Ga0209676_1000187124 207
178 3300025292 Ga0209676_1033078 Ga0209676_10330782 207
179 3300025292 Ga0209676_1043978 Ga0209676_10439782 207
180 3300025298 Ga0209050_1005880 Ga0209050_10058808 207
181 3300025298 Ga0209050_1056428 Ga0209050_10564282 207
182 3300025304 Ga0209257_1002076 Ga0209257_10020762 207
183 3300025735 Ga0207713_1006366 Ga0207713_10063667 207
184 3300025904 Ga0207647_10028538 Ga0207647_100285383 207
185 3300025904 Ga0207647_10136471 Ga0207647_101364712 207
186 3300025909 Ga0207705_10000004 Ga0207705_10000004589 207
187 3300025913 Ga0207695_10023097 Ga0207695_100230977 207
188 3300025913 Ga0207695_10706647 Ga0207695_107066471 207
189 3300025923 Ga0207681_10002660 Ga0207681_100026607 207
190 3300025924 Ga0207694_10124636 Ga0207694_101246362 207
191 3300025925 Ga0207650_10040385 Ga0207650_100403854 207
192 3300025931 Ga0207644_10000003 Ga0207644_10000003513 207
193 3300025931 Ga0207644_10002731 Ga0207644_100027313 207
194 3300025931 Ga0207644_10049306 Ga0207644_100493063 207
195 3300025941 Ga0207711_10113216 Ga0207711_101132162 207
196 3300025949 Ga0207667_10711604 Ga0207667_107116042 207
197 3300025972 Ga0207668_10004680 Ga0207668_1000468010 207
198 3300025981 Ga0207640_10000675 Ga0207640_1000067517 207
199 3300025981 Ga0207640_10001572 Ga0207640_1000157211 207
200 3300025986 Ga0207658_10071789 Ga0207658_100717891 207
201 3300026035 Ga0207703_10005791 Ga0207703_100057916 207
202 3300026035 Ga0207703_10039436 Ga0207703_100394362 207
203 3300026041 Ga0207639_10396757 Ga0207639_103967571 207
204 3300026078 Ga0207702_10004299 Ga0207702_100042998 207
205 3300026088 Ga0207641_10000064 Ga0207641_1000006469 207
206 3300026088 Ga0207641_10196174 Ga0207641_101961741 207
207 3300026142 Ga0207698_10000192 Ga0207698_1000019239 207
208 3300026142 Ga0207698_10045543 Ga0207698_100455433 207
209 3300028379 Ga0268266_10000347 Ga0268266_100003479 207
210 3300028380 Ga0268265_10009551 Ga0268265_100095514 207
211 3300028381 Ga0268264_10030769 Ga0268264_100307693 207
212 3300028381 Ga0268264_10367536 Ga0268264_103675362 207
213 3300031548 Ga0307408_100076959 Ga0307408_1000769593 207
214 3300031731 Ga0307405_10118791 Ga0307405_101187912 207
215 3300031852 Ga0307410_10688612 Ga0307410_106886121 207
216 3300031901 Ga0307406_10129258 Ga0307406_101292582 207
217 3300031903 Ga0307407_10014968 Ga0307407_100149683 207
218 3300031911 Ga0307412_10033899 Ga0307412_100338993 207
219 3300032002 Ga0307416_100095399 Ga0307416_1000953993 207
220 3300032004 Ga0307414_10009589 Ga0307414_100095895 207
221 3300032004 Ga0307414_10059340 Ga0307414_100593403 207
222 3300032004 Ga0307414_10064786 Ga0307414_100647863 207
223 3300046542 Ga0495597_0101238 Ga0495597_0101238_14_637 207
224 3300046660 Ga0495625_0000169 Ga0495625_0000169_82234_82857 207
225 3300046692 Ga0495671_0017610 Ga0495671_0017610_2997_3620 207
226 3300048911 Ga0496108_0508178 Ga0496108_0508178_326_949 207
227 3300048912 Ga0496109_0347341 Ga0496109_0347341_767_1390 207
228 3300048913 Ga0496110_0170358 Ga0496110_0170358_311_934 207
229 3300048914 Ga0496111_0093034 Ga0496111_0093034_1164_1787 207
230 3300048917 Ga0496114_0021863 Ga0496114_0021863_298_921 207
231 3300048919 Ga0496116_0022757 Ga0496116_0022757_2376_2999 207
232 3300048922 Ga0496119_0063073 Ga0496119_0063073_202_825 207
233 3300048924 Ga0496121_0000206 Ga0496121_0000206_67328_67954 207
234 3300048924 Ga0496121_0043170 Ga0496121_0043170_513_1136 207
235 3300048926 Ga0496123_0024332 Ga0496123_0024332_2859_3482 207
236 3300048927 Ga0496124_0192970 Ga0496124_0192970_189_812 207
237 3300048928 Ga0496125_0013373 Ga0496125_0013373_1156_1779 207
238 3300048928 Ga0496125_0061824 Ga0496125_0061824_1357_1980 207
239 3300048929 Ga0496126_0019826 Ga0496126_0019826_2455_3078 207
240 3300048929 Ga0496126_0020468 Ga0496126_0020468_4698_5321 207
241 3300048929 Ga0496126_0153908 Ga0496126_0153908_482_1105 207
242 3300048929 Ga0496126_0218367 Ga0496126_0218367_81_704 207
243 3300049571 Ga0501034_0134521 Ga0501034_0134521_305_928 207
244 3300049759 Ga0501262_023546 Ga0501262_023546_76_699 207
245 3300049823 Ga0501044_0334366 Ga0501044_0334366_639_1262 207
246 3300050496 nmdc:mga07m45_9640_c1 nmdc:mga07m45_9640_c1_1683_2306 207
247 3300053087 Ga0500643_007101 Ga0500643_007101_578_1201 207
248 3300053087 Ga0500643_089608 Ga0500643_089608_66_689 207
249 3300053103 Ga0500555_083252 Ga0500555_083252_165_788 207
250 3300053116 Ga0500592_001874 Ga0500592_001874_837_1460 207
251 3300053121 Ga0500607_000082 Ga0500607_000082_47990_48613 207
252 3300053136 Ga0500559_0012183 Ga0500559_0012183_2148_2771 207
253 3300053136 Ga0500559_0015264 Ga0500559_0015264_684_1307 207
254 3300053136 Ga0500559_0297293 Ga0500559_0297293_22_666 207
255 3300053151 Ga0500604_0182213 Ga0500604_0182213_67_690 207
256 3300053158 Ga0500627_0000012 Ga0500627_0000012_74909_75532 207
257 3300053158 Ga0500627_0230578 Ga0500627_0230578_124_747 207
258 3300053178 Ga0500637_0032240 Ga0500637_0032240_339_962 207
259 3300053730 Ga0500645_001456 Ga0500645_001456_332_955 207
260 3300053730 Ga0500645_002566 Ga0500645_002566_5215_5838 207
261 3300005327 Ga0070658_10006358 Ga0070658_100063587 208
262 3300005336 Ga0070680_100003975 Ga0070680_1000039757 208
263 3300005336 Ga0070680_100328508 Ga0070680_1003285082 208
264 3300005339 Ga0070660_100002657 Ga0070660_1000026572 208
265 3300005339 Ga0070660_100656747 Ga0070660_1006567472 208
266 3300005344 Ga0070661_100207338 Ga0070661_1002073381 208
267 3300005344 Ga0070661_100405822 Ga0070661_1004058222 208
268 3300005353 Ga0070669_100439168 Ga0070669_1004391682 208
269 3300005366 Ga0070659_100006524 Ga0070659_1000065244 208
270 3300005367 Ga0070667_100011190 Ga0070667_1000111902 208
271 3300005456 Ga0070678_100020989 Ga0070678_1000209894 208
272 3300005457 Ga0070662_100000817 Ga0070662_1000008175 208
273 3300005457 Ga0070662_100013295 Ga0070662_1000132951 208
274 3300005457 Ga0070662_100069318 Ga0070662_1000693183 208
275 3300005539 Ga0068853_100208857 Ga0068853_1002088572 208
276 3300005548 Ga0070665_100077613 Ga0070665_1000776133 208
277 3300005563 Ga0068855_100005198 Ga0068855_10000519816 208
278 3300005563 Ga0068855_100040201 Ga0068855_1000402014 208
279 3300005563 Ga0068855_100116913 Ga0068855_1001169133 208
280 3300005564 Ga0070664_100009011 Ga0070664_1000090118 208
281 3300005564 Ga0070664_100023442 Ga0070664_1000234423 208
282 3300005577 Ga0068857_100025453 Ga0068857_1000254532 208
283 3300005577 Ga0068857_100140917 Ga0068857_1001409171 208
284 3300005578 Ga0068854_100061583 Ga0068854_1000615832 208
285 3300005616 Ga0068852_100930508 Ga0068852_1009305082 208
286 3300005842 Ga0068858_100181956 Ga0068858_1001819562 208
287 3300005843 Ga0068860_100000192 Ga0068860_1000001922 208
288 3300005844 Ga0068862_100005791 Ga0068862_1000057911 208
289 3300006042 Ga0075368_10001784 Ga0075368_100017842 208
290 3300006051 Ga0075364_10001132 Ga0075364_1000113214 208
291 3300006051 Ga0075364_10334162 Ga0075364_103341622 208
292 3300006178 Ga0075367_10007729 Ga0075367_100077296 208
293 3300006186 Ga0075369_10037935 Ga0075369_100379351 208
294 3300006195 Ga0075366_10022760 Ga0075366_100227603 208
295 3300006237 Ga0097621_100203620 Ga0097621_1002036203 208
296 3300006353 Ga0075370_10331473 Ga0075370_103314731 208
297 3300006946 Ga0079104_1049262 Ga0079104_10492622 208
298 3300009092 Ga0105250_10083027 Ga0105250_100830271 208
299 3300009174 Ga0105241_10045981 Ga0105241_100459813 208
300 3300011119 Ga0105246_10001236 Ga0105246_100012367 208
301 3300013100 Ga0157373_10003144 Ga0157373_1000314410 208
302 3300013100 Ga0157373_10628772 Ga0157373_106287721 208
303 3300013102 Ga0157371_10008038 Ga0157371_100080385 208
304 3300013104 Ga0157370_10008050 Ga0157370_100080504 208
305 3300013104 Ga0157370_10166325 Ga0157370_101663252 208
306 3300013306 Ga0163162_10384366 Ga0163162_103843662 208
307 3300013307 Ga0157372_10019088 Ga0157372_100190886 208
308 3300013307 Ga0157372_10020903 Ga0157372_100209033 208
309 3300013308 Ga0157375_10077430 Ga0157375_100774303 208
310 3300013308 Ga0157375_10471551 Ga0157375_104715512 208
311 3300017792 Ga0163161_10022106 Ga0163161_100221062 208
312 3300017792 Ga0163161_10679617 Ga0163161_106796172 208
313 3300025909 Ga0207705_10090655 Ga0207705_100906553 208
314 3300025909 Ga0207705_10094681 Ga0207705_100946812 208
315 3300025917 Ga0207660_10060600 Ga0207660_100606004 208
316 3300025919 Ga0207657_10000994 Ga0207657_100009942 208
317 3300025919 Ga0207657_10074428 Ga0207657_100744283 208
318 3300025919 Ga0207657_10575220 Ga0207657_105752202 208
319 3300025920 Ga0207649_10240594 Ga0207649_102405942 208
320 3300025921 Ga0207652_10024417 Ga0207652_100244172 208
321 3300025931 Ga0207644_10301295 Ga0207644_103012952 208
322 3300025932 Ga0207690_10008522 Ga0207690_100085222 208
323 3300025933 Ga0207706_10001603 Ga0207706_1000160317 208
324 3300025933 Ga0207706_10017880 Ga0207706_100178808 208
325 3300025933 Ga0207706_10032430 Ga0207706_100324302 208
326 3300025949 Ga0207667_10005420 Ga0207667_1000542015 208
327 3300025949 Ga0207667_10032623 Ga0207667_100326234 208
328 3300025986 Ga0207658_10013849 Ga0207658_100138493 208
329 3300026035 Ga0207703_10125271 Ga0207703_101252712 208
330 3300026041 Ga0207639_10002292 Ga0207639_100022921 208
331 3300026116 Ga0207674_10029103 Ga0207674_100291032 208
332 3300026116 Ga0207674_10202093 Ga0207674_102020932 208
333 3300026121 Ga0207683_10075321 Ga0207683_100753213 208
334 3300026142 Ga0207698_10330083 Ga0207698_103300832 208
335 3300027866 Ga0209813_10000088 Ga0209813_1000008830 208
336 3300027876 Ga0209974_10023046 Ga0209974_100230462 208
337 3300028379 Ga0268266_10056671 Ga0268266_100566712 208
338 3300028380 Ga0268265_10003108 Ga0268265_100031088 208
339 3300028381 Ga0268264_10000018 Ga0268264_1000001894 208
340 3300031616 Ga0307508_10076764 Ga0307508_100767642 208
341 3300031824 Ga0307413_10016703 Ga0307413_100167034 208
342 3300031901 Ga0307406_10445720 Ga0307406_104457202 208
343 3300031911 Ga0307412_10010412 Ga0307412_100104126 208
344 3300031911 Ga0307412_10404396 Ga0307412_104043962 208
345 3300032004 Ga0307414_10049719 Ga0307414_100497193 208
346 3300032004 Ga0307414_10077507 Ga0307414_100775072 208
347 3300032004 Ga0307414_10263584 Ga0307414_102635842 208
348 3300032005 Ga0307411_10012543 Ga0307411_100125434 208
349 3300032005 Ga0307411_10131364 Ga0307411_101313642 208
350 3300032005 Ga0307411_10817085 Ga0307411_108170852 208
351 3300032126 Ga0307415_100461683 Ga0307415_1004616832 208
352 3300041509 Ga0451843_1338516 Ga0451843_1338516_184_810 208
353 3300041512 Ga0451853_1262026 Ga0451853_1262026_67_693 208
354 3300046460 Ga0495638_0093181 Ga0495638_0093181_472_1098 208
355 3300046500 Ga0495596_0000053 Ga0495596_0000053_51075_51728 208
356 3300046519 Ga0495632_0021767 Ga0495632_0021767_2316_2969 208
357 3300046522 Ga0495643_0009664 Ga0495643_0009664_4106_4759 208
358 3300046522 Ga0495643_0051780 Ga0495643_0051780_1507_2133 208
359 3300046538 Ga0495609_0006358 Ga0495609_0006358_16_669 208
360 3300046660 Ga0495625_0040131 Ga0495625_0040131_1469_2122 208
361 3300046692 Ga0495671_0021101 Ga0495671_0021101_1418_2071 208
362 3300047470 Ga0495681_0061472 Ga0495681_0061472_87_740 208
363 3300048906 Ga0496103_0596990 Ga0496103_0596990_33_662 208
364 3300048907 Ga0496104_0006148 Ga0496104_0006148_2784_3413 208
365 3300048917 Ga0496114_0006267 Ga0496114_0006267_2088_2714 208
366 3300048920 Ga0496117_0037702 Ga0496117_0037702_1065_1694 208
367 3300048928 Ga0496125_0207786 Ga0496125_0207786_387_1013 208
368 3300049569 Ga0501032_0151873 Ga0501032_0151873_71_697 208
369 3300049570 Ga0501033_0020373 Ga0501033_0020373_3343_3969 208
370 3300049572 Ga0501036_0011875 Ga0501036_0011875_5710_6336 208
371 3300049573 Ga0501037_0063131 Ga0501037_0063131_1567_2193 208
372 3300049574 Ga0501038_0226065 Ga0501038_0226065_335_964 208
373 3300049575 Ga0501039_0018291 Ga0501039_0018291_4525_5151 208
374 3300049579 Ga0501043_0042280 Ga0501043_0042280_1669_2298 208
375 3300049581 Ga0501047_0096221 Ga0501047_0096221_303_932 208
376 3300049581 Ga0501047_0454623 Ga0501047_0454623_330_956 208
377 3300049822 Ga0501035_0019445 Ga0501035_0019445_151_777 208
378 3300049823 Ga0501044_0001194 Ga0501044_0001194_27236_27862 208
379 3300049823 Ga0501044_0028654 Ga0501044_0028654_2785_3411 208
380 3300049823 Ga0501044_0092710 Ga0501044_0092710_1693_2322 208
381 3300049823 Ga0501044_0150064 Ga0501044_0150064_634_1260 208
382 3300050489 nmdc:mga03683_16433_c1 nmdc:mga03683_16433_c1_973_1599 208
383 3300050489 nmdc:mga03683_334_c1 nmdc:mga03683_334_c1_4335_4961 208
384 3300050490 nmdc:mga03n38_3617_c1 nmdc:mga03n38_3617_c1_748_1374 208
385 3300050491 nmdc:mga00v17_10475_c1 nmdc:mga00v17_10475_c1_2358_2984 208
386 3300050491 nmdc:mga00v17_3862_c2 nmdc:mga00v17_3862_c2_415_1041 208
387 3300050492 nmdc:mga0yw44_98182_c1 nmdc:mga0yw44_98182_c1_931_1557 208
388 3300050493 nmdc:mga0k408_49935_c1 nmdc:mga0k408_49935_c1_1642_2268 208
389 3300050494 nmdc:mga06z11_636_c1 nmdc:mga06z11_636_c1_1564_2190 208
390 3300050495 nmdc:mga04h51_287_c1 nmdc:mga04h51_287_c1_6044_6670 208
391 3300050496 nmdc:mga07m45_179203_c1 nmdc:mga07m45_179203_c1_375_1001 208
392 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_370457_371083 208
393 3300050516 nmdc:mga0sz30_64568_c1 nmdc:mga0sz30_64568_c1_567_1193 208
394 3300053104 Ga0500556_0000013 Ga0500556_0000013_235615_236253 208
395 3300053119 Ga0500595_080854 Ga0500595_080854_256_882 208
396 3300053121 Ga0500607_082906 Ga0500607_082906_444_1070 208
397 3300053134 Ga0500658_0036118 Ga0500658_0036118_1026_1658 208
398 3300053139 Ga0500568_0001414 Ga0500568_0001414_7553_8179 208
399 3300053730 Ga0500645_013522 Ga0500645_013522_1646_2272 208
400 2162886007 SwRhRL2b_contig_3273488 SwRhRL2b_0336.00004870 209
401 3300003781 Ga0055536_1003137 Ga0055536_10031376 209
402 3300003781 Ga0055536_1007110 Ga0055536_10071104 209
403 3300003791 Ga0055530_10000065 Ga0055530_1000006560 209
404 3300003791 Ga0055530_10009472 Ga0055530_100094723 209
405 3300003794 Ga0055531_10003276 Ga0055531_100032762 209
406 3300003794 Ga0055531_10020577 Ga0055531_100205773 209
407 3300005289 Ga0065704_10070144 Ga0065704_10070144113 209
408 3300005289 Ga0065704_10191884 Ga0065704_101918841 209
409 3300005295 Ga0065707_10113679 Ga0065707_101136792 209
410 3300005355 Ga0070671_100118820 Ga0070671_1001188202 209
411 3300005367 Ga0070667_100002216 Ga0070667_10000221614 209
412 3300005841 Ga0068863_100011089 Ga0068863_1000110898 209
413 3300005843 Ga0068860_100019392 Ga0068860_1000193927 209
414 3300006195 Ga0075366_10039496 Ga0075366_100394962 209
415 3300025291 Ga0209675_1004699 Ga0209675_10046996 209
416 3300025292 Ga0209676_1000084 Ga0209676_1000084190 209
417 3300025292 Ga0209676_1000236 Ga0209676_100023655 209
418 3300025294 Ga0209025_1013790 Ga0209025_10137903 209
419 3300025298 Ga0209050_1000215 Ga0209050_100021553 209
420 3300025298 Ga0209050_1000400 Ga0209050_100040021 209
421 3300025298 Ga0209050_1043439 Ga0209050_10434392 209
422 3300025304 Ga0209257_1000232 Ga0209257_100023239 209
423 3300025304 Ga0209257_1000250 Ga0209257_1000250105 209
424 3300025931 Ga0207644_10108026 Ga0207644_101080263 209
425 3300025986 Ga0207658_10002073 Ga0207658_100020739 209
426 3300027876 Ga0209974_10024700 Ga0209974_100247003 209
427 3300028381 Ga0268264_10013929 Ga0268264_100139293 209
428 3300031548 Ga0307408_100033988 Ga0307408_1000339885 209
429 3300031727 Ga0316576_10303034 Ga0316576_103030342 209
430 3300031731 Ga0307405_10006159 Ga0307405_100061593 209
431 3300031731 Ga0307405_10280861 Ga0307405_102808612 209
432 3300031901 Ga0307406_10079054 Ga0307406_100790541 209
433 3300031911 Ga0307412_10012575 Ga0307412_100125754 209
434 3300032004 Ga0307414_11109135 Ga0307414_111091351 209
435 3300032005 Ga0307411_10019715 Ga0307411_100197152 209
436 3300032133 Ga0316583_10003929 Ga0316583_100039297 209
437 3300036647 Ga0316582_0000948 Ga0316582_0000948_403_1032 209
438 3300036712 Ga0316584_0042647 Ga0316584_0042647_1897_2526 209
439 3300036712 Ga0316584_0160599 Ga0316584_0160599_313_942 209
440 3300044712 Ga0453684_0305287 Ga0453684_0305287_730_1359 209
441 3300044712 Ga0453684_0551790 Ga0453684_0551790_185_814 209
442 3300046453 Ga0495627_000376 Ga0495627_000376_40008_40682 209
443 3300046471 Ga0495650_0001801 Ga0495650_0001801_13129_13803 209
444 3300046500 Ga0495596_0009181 Ga0495596_0009181_1831_2478 209
445 3300046501 Ga0495607_0005878 Ga0495607_0005878_283_939 209
446 3300046507 Ga0495606_0033526 Ga0495606_0033526_865_1512 209
447 3300046512 Ga0495610_0000018 Ga0495610_0000018_32041_32685 209
448 3300046512 Ga0495610_0000743 Ga0495610_0000743_25261_25908 209
449 3300046512 Ga0495610_0011690 Ga0495610_0011690_505_1152 209
450 3300046513 Ga0495616_0079529 Ga0495616_0079529_168_824 209
451 3300046513 Ga0495616_0158308 Ga0495616_0158308_348_995 209
452 3300046519 Ga0495632_0002987 Ga0495632_0002987_4478_5152 209
453 3300046522 Ga0495643_0000110 Ga0495643_0000110_83802_84449 209
454 3300046530 Ga0495654_0045068 Ga0495654_0045068_55_729 209
455 3300046616 Ga0495668_0000228 Ga0495668_0000228_67637_68269 209
456 3300046660 Ga0495625_0096993 Ga0495625_0096993_367_999 209
457 3300046691 Ga0495670_0168333 Ga0495670_0168333_72_704 209
458 3300047470 Ga0495681_0000020 Ga0495681_0000020_40322_40996 209
459 3300048090 Ga0495615_0000166 Ga0495615_0000166_11306_11962 209
460 3300048903 Ga0496100_0350364 Ga0496100_0350364_138_767 209
461 3300048904 Ga0496101_0120174 Ga0496101_0120174_438_1067 209
462 3300048919 Ga0496116_0000039 Ga0496116_0000039_109581_110210 209
463 3300048921 Ga0496118_0015316 Ga0496118_0015316_4392_5021 209
464 3300048924 Ga0496121_0001452 Ga0496121_0001452_11761_12390 209
465 3300048925 Ga0496122_0033761 Ga0496122_0033761_1382_2011 209
466 3300048925 Ga0496122_0043385 Ga0496122_0043385_537_1193 209
467 3300048926 Ga0496123_0001887 Ga0496123_0001887_22301_22957 209
468 3300048926 Ga0496123_0002011 Ga0496123_0002011_18305_18934 209
469 3300048927 Ga0496124_0016392 Ga0496124_0016392_2973_3602 209
470 3300048927 Ga0496124_0034999 Ga0496124_0034999_475_1131 209
471 3300048928 Ga0496125_0113559 Ga0496125_0113559_785_1441 209
472 3300048928 Ga0496125_0259657 Ga0496125_0259657_434_1063 209
473 3300048929 Ga0496126_0000041 Ga0496126_0000041_273836_274465 209
474 3300049579 Ga0501043_0305021 Ga0501043_0305021_444_1073 209
475 3300049823 Ga0501044_0448568 Ga0501044_0448568_192_821 209
476 3300050493 nmdc:mga0k408_64097_c1 nmdc:mga0k408_64097_c1_450_1082 209
477 3300050496 nmdc:mga07m45_1318_c1 nmdc:mga07m45_1318_c1_7468_8100 209
478 3300053087 Ga0500643_000001 Ga0500643_000001_1408463_1409128 209
479 3300053138 Ga0500564_231013 Ga0500564_231013_83_721 209
480 3300053156 Ga0500622_0003161 Ga0500622_0003161_1044_1676 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

30

225

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9373 7 205
1k7k-assembly1.cif.gz_A crystal structure of rdgb- inosine triphosphate pyrophosphatase from e. coli 0.9193 8 209
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9144 7 205
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.8927 9 205
2pyu-assembly1.cif.gz_A-2 structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp 0.886 1 206
ID Description Score Start End Superfamily
af_A0A1D6PZP4_59_232_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9054 45 207 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8966 7 205 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8939 7 209 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8896 7 209 3.90.950.10
af_P9WMR7_2_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8872 8 206 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A2D5DM23-F1-model_v4 deleted 0.9832 3 193
AF-A0A443JB87-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9814 2 204 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A520J2U2-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9784 59 207 GO:0005829
GO:0009117
GO:0009143
GO:0047429
AF-A0A8B2PK53-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9775 31 204 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A0F9FF79-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9766 46 207 GO:0005829
GO:0009143
GO:0047429

Feature Viewer

pLDDT pTM Quality
93.36 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map