F451999

General Info

Members Datasets Scaffolds Average Seq Length
479 279 477 157

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100697335|Ga0070669_1006973351
Length 190
Sequence MGRDALHRLGPAHAGGEFDSGPWSPLASPAVSGFRIGQGYDIHPLAAGRRLILGGIEIPHTRGLLGHSDADAVLHAVTDALLGAIGAGDIGRHFSDSDPRHQNRPSREFVTETMAMVRARGYRVGNVDVTIHAEEPKLAPHLDAMRALVAELLGIAADAANVKATRGEGLGPIGRAEGIAAEAVVLLERA

Samples

Sample ID Description Type Environment
1 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
2 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
193 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
194 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.21
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 1.46
Rhizosphere 92.69
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002962 3300002705 Bacteria 5773
2 JGI25154J39366_1002233 3300002738 Bacteria 5315
3 Ga0055538_1003408 3300003751 Bacteria 2031
4 Ga0055533_1002564 3300003756 Bacteria 4060
5 Ga0055542_1000961 3300003762 Bacteria 18802
6 Ga0055541_1001800 3300003841 Bacteria 4481
7 Ga0065707_10089909 3300005295 Bacteria 4243
8 Ga0070683_100715545 3300005329 Bacteria 959
9 Ga0070690_100005668 3300005330 Bacteria 7027
10 Ga0070690_100558940 3300005330 Bacteria 863
11 Ga0070690_100739181 3300005330 Bacteria 759
12 Ga0068869_100008574 3300005334 Bacteria 6599
13 Ga0068869_100063718 3300005334 Bacteria 2709
14 Ga0068869_100267329 3300005334 Bacteria 1371
15 Ga0070680_100153636 3300005336 Bacteria 1933
16 Ga0070680_100333559 3300005336 Bacteria 1288
17 Ga0070682_100000004 3300005337 Bacteria 388780
18 Ga0068868_100190230 3300005338 Bacteria 1707
19 Ga0068868_100714452 3300005338 Bacteria 897
20 Ga0070689_100000971 3300005340 Bacteria 17911
21 Ga0070689_100004116 3300005340 Bacteria 9793
22 Ga0070689_100029158 3300005340 Bacteria 4174
23 Ga0070691_10016825 3300005341 Bacteria 3363
24 Ga0070691_10060368 3300005341 Bacteria 1823
25 Ga0070691_10287392 3300005341 Bacteria 894
26 Ga0070687_100036645 3300005343 Unclassified 2446
27 Ga0070687_100040518 3300005343 Bacteria 2347
28 Ga0070687_100434628 3300005343 Bacteria 869
29 Ga0070692_10065793 3300005345 Bacteria 1920
30 Ga0070668_100037422 3300005347 Bacteria 3705
31 Ga0070669_100045261 3300005353 Bacteria 3206
32 Ga0070669_100697335 3300005353 Unclassified 857
33 Ga0070675_100245141 3300005354 Bacteria 1566
34 Ga0070675_100452689 3300005354 Bacteria 1151
35 Ga0070674_100042003 3300005356 Bacteria 3104
36 Ga0070673_100036870 3300005364 Bacteria 3722
37 Ga0070688_100000351 3300005365 Bacteria 23359
38 Ga0070688_100043702 3300005365 Bacteria 2762
39 Ga0070688_100472534 3300005365 Bacteria 941
40 Ga0070688_100569937 3300005365 Bacteria 863
41 Ga0070659_100008608 3300005366 Bacteria 7463
42 Ga0070667_100082113 3300005367 Bacteria 2759
43 Ga0070710_10925054 3300005437 Unclassified 631
44 Ga0070701_10000349 3300005438 Bacteria 15321
45 Ga0070701_10004286 3300005438 Bacteria 5755
46 Ga0070701_10006464 3300005438 Bacteria 4935
47 Ga0070705_100339691 3300005440 Bacteria 1091
48 Ga0070705_100834726 3300005440 Bacteria 736
49 Ga0070700_100000023 3300005441 Bacteria 129791
50 Ga0070700_100002242 3300005441 Bacteria 9839
51 Ga0070700_100062770 3300005441 Bacteria 2348
52 Ga0070694_100168093 3300005444 Bacteria 1614
53 Ga0070694_100175915 3300005444 Bacteria 1580
54 Ga0070694_100175923 3300005444 Bacteria 1580
55 Ga0070708_100132641 3300005445 Bacteria 2306
56 Ga0070708_100410717 3300005445 Bacteria 1277
57 Ga0070663_100037876 3300005455 Bacteria 3360
58 Ga0070681_10052307 3300005458 Bacteria 4073
59 Ga0068867_100004274 3300005459 Bacteria 10049
60 Ga0070685_10000043 3300005466 Bacteria 75315
61 Ga0070685_10604878 3300005466 Bacteria 789
62 Ga0070706_100169922 3300005467 Bacteria 2036
63 Ga0070706_100394328 3300005467 Unclassified 1288
64 Ga0070707_100000020 3300005468 Bacteria 130967
65 Ga0070707_100044642 3300005468 Bacteria 4243
66 Ga0070707_100345885 3300005468 Bacteria 1444
67 Ga0070707_100481476 3300005468 Unclassified 1202
68 Ga0070707_100534283 3300005468 Bacteria 1135
69 Ga0070698_100058912 3300005471 Bacteria 3881
70 Ga0070698_100153800 3300005471 Bacteria 2246
71 Ga0070698_100338200 3300005471 Bacteria 1437
72 Ga0070698_100716754 3300005471 Bacteria 943
73 Ga0070699_100175411 3300005518 Unclassified 1900
74 Ga0070699_100488718 3300005518 Bacteria 1118
75 Ga0070699_100908575 3300005518 Bacteria 806
76 Ga0070679_100064698 3300005530 Bacteria 3645
77 Ga0070679_100110217 3300005530 Bacteria 2739
78 Ga0070697_100028751 3300005536 Bacteria 4453
79 Ga0070697_100293505 3300005536 Bacteria 1397
80 Ga0070697_100916282 3300005536 Bacteria 778
81 Ga0070672_100464421 3300005543 Bacteria 1091
82 Ga0070686_100001492 3300005544 Bacteria 13175
83 Ga0070686_100007508 3300005544 Bacteria 6085
84 Ga0070686_100063119 3300005544 Bacteria 2399
85 Ga0070695_100080718 3300005545 Bacteria 2150
86 Ga0070695_100814977 3300005545 Bacteria 749
87 Ga0070696_100046668 3300005546 Bacteria 3004
88 Ga0070693_100282702 3300005547 Bacteria 1112
89 Ga0070665_100219835 3300005548 Bacteria 1900
90 Ga0070665_101206750 3300005548 Bacteria 767
91 Ga0070704_100008895 3300005549 Bacteria 6045
92 Ga0070704_100384843 3300005549 Bacteria 1193
93 Ga0070704_100553053 3300005549 Bacteria 1006
94 Ga0070704_100842424 3300005549 Bacteria 822
95 Ga0070664_100166085 3300005564 Bacteria 1956
96 Ga0068857_100407068 3300005577 Bacteria 1267
97 Ga0068854_100033675 3300005578 Bacteria 3572
98 Ga0070702_100008885 3300005615 Bacteria 4889
99 Ga0070702_100131498 3300005615 Bacteria 1581
100 Ga0070702_100931215 3300005615 Bacteria 683
101 Ga0068859_100006485 3300005617 Bacteria 11877
102 Ga0068859_100024468 3300005617 Bacteria 6058
103 Ga0068864_100109514 3300005618 Bacteria 2459
104 Ga0068866_10009348 3300005718 Bacteria 4159
105 Ga0068866_10032823 3300005718 Bacteria 2513
106 Ga0068861_100049632 3300005719 Bacteria 3178
107 Ga0068861_100184033 3300005719 Bacteria 1741
108 Ga0068861_100251193 3300005719 Unclassified 1509
109 Ga0068870_10132430 3300005840 Bacteria 1450
110 Ga0068870_10191430 3300005840 Bacteria 1234
111 Ga0068863_100212388 3300005841 Bacteria 1863
112 Ga0068858_100000126 3300005842 Bacteria 79740
113 Ga0068858_100034035 3300005842 Bacteria 4726
114 Ga0068858_100215700 3300005842 Bacteria 1817
115 Ga0068860_100029701 3300005843 Bacteria 5259
116 Ga0068860_100049535 3300005843 Bacteria 4000
117 Ga0068860_100472979 3300005843 Unclassified 1248
118 Ga0068862_100822284 3300005844 Bacteria 908
119 Ga0070715_10243447 3300006163 Unclassified 936
120 Ga0070715_10284868 3300006163 Bacteria 878
121 Ga0070715_10738832 3300006163 Bacteria 591
122 Ga0070716_100047265 3300006173 Bacteria 2427
123 Ga0070716_100343224 3300006173 Bacteria 1054
124 Ga0070716_100424203 3300006173 Bacteria 963
125 Ga0097621_100019691 3300006237 Bacteria 5186
126 Ga0097621_100290652 3300006237 Bacteria 1441
127 Ga0097621_100599083 3300006237 Bacteria 1007
128 Ga0068871_100063686 3300006358 Bacteria 3017
129 Ga0068871_100209161 3300006358 Bacteria 1687
130 Ga0068871_101258514 3300006358 Bacteria 695
131 Ga0075428_100010352 3300006844 Bacteria 10350
132 Ga0075428_100059879 3300006844 Bacteria 4169
133 Ga0075431_100001900 3300006847 Bacteria 19822
134 Ga0075431_100363592 3300006847 Unclassified 1453
135 Ga0075431_100605655 3300006847 Unclassified 1079
136 Ga0075431_101906686 3300006847 Bacteria 550
137 Ga0075433_10004298 3300006852 Bacteria 11067
138 Ga0075434_100004987 3300006871 Bacteria 12043
139 Ga0075434_100026137 3300006871 Bacteria 5717
140 Ga0075429_100453403 3300006880 Unclassified 1124
141 Ga0075429_101080133 3300006880 Bacteria 701
142 Ga0068865_100007196 3300006881 Bacteria 6836
143 Ga0075436_100030597 3300006914 Bacteria 3704
144 Ga0075436_100149118 3300006914 Bacteria 1645
145 Ga0097620_100006485 3300006931 Bacteria 11877
146 Ga0097620_100024467 3300006931 Bacteria 6058
147 Ga0075435_100000533 3300007076 Bacteria 23314
148 Ga0075435_100154764 3300007076 Bacteria 1929
149 Ga0075435_101018430 3300007076 Bacteria 723
150 Ga0099794_10599872 3300007265 Unclassified 583
151 Ga0105244_10309203 3300009036 Bacteria 731
152 Ga0105240_10033173 3300009093 Bacteria 6674
153 Ga0105240_10063832 3300009093 Bacteria 4579
154 Ga0105240_10175752 3300009093 Bacteria 2531
155 Ga0105240_10329382 3300009093 Bacteria 1738
156 Ga0105240_10761152 3300009093 Bacteria 1052
157 Ga0111539_10024047 3300009094 Bacteria 7483
158 Ga0105245_10025088 3300009098 Bacteria 5242
159 Ga0105245_10154318 3300009098 Bacteria 2174
160 Ga0105245_10759368 3300009098 Bacteria 1006
161 Ga0114129_10308809 3300009147 Bacteria 2106
162 Ga0114129_10428110 3300009147 Bacteria 1739
163 Ga0114129_10901323 3300009147 Bacteria 1120
164 Ga0114129_11256243 3300009147 Bacteria 920
165 Ga0105243_10048068 3300009148 Bacteria 3362
166 Ga0105243_11493934 3300009148 Bacteria 699
167 Ga0105242_10006488 3300009176 Bacteria 9009
168 Ga0105242_10036636 3300009176 Bacteria 3936
169 Ga0105242_10039058 3300009176 Bacteria 3820
170 Ga0105242_10275821 3300009176 Bacteria 1525
171 Ga0105248_10000669 3300009177 Bacteria 38860
172 Ga0105248_10129555 3300009177 Bacteria 2846
173 Ga0105237_10229452 3300009545 Bacteria 1857
174 Ga0105238_10000002 3300009551 Bacteria 772711
175 Ga0105238_10645018 3300009551 Unclassified 1069
176 Ga0105249_10741254 3300009553 Bacteria 1044
177 Ga0099796_10025635 3300010159 Bacteria 1864
178 Ga0105246_10456019 3300011119 Unclassified 1076
179 Ga0157373_10404748 3300013100 Bacteria 978
180 Ga0157369_10122037 3300013105 Bacteria 2764
181 Ga0157369_11036901 3300013105 Unclassified 839
182 Ga0157374_10000016 3300013296 Bacteria 293656
183 Ga0157378_10014061 3300013297 Bacteria 7007
184 Ga0157378_10033701 3300013297 Bacteria 4529
185 Ga0157378_10112940 3300013297 Bacteria 2493
186 Ga0157378_10162879 3300013297 Bacteria 2087
187 Ga0157372_10002494 3300013307 Bacteria 19954
188 Ga0157375_10012076 3300013308 Bacteria 7650
189 Ga0157375_10141759 3300013308 Bacteria 2531
190 Ga0157375_10384238 3300013308 Bacteria 1571
191 Ga0163163_10078302 3300014325 Bacteria 3302
192 Ga0163163_10944703 3300014325 Bacteria 925
193 Ga0157380_10001115 3300014326 Bacteria 17333
194 Ga0157380_10179720 3300014326 Unclassified 1858
195 Ga0157377_10000004 3300014745 Bacteria 430019
196 Ga0157377_10000370 3300014745 Bacteria 20086
197 Ga0157377_10029340 3300014745 Bacteria 2969
198 Ga0157377_10040702 3300014745 Bacteria 2575
199 Ga0157379_10002731 3300014968 Bacteria 14883
200 Ga0157379_10535279 3300014968 Unclassified 1089
201 Ga0157379_10986586 3300014968 Bacteria 803
202 Ga0157379_11826483 3300014968 Bacteria 598
203 Ga0157376_10014517 3300014969 Bacteria 5916
204 Ga0157376_10235447 3300014969 Bacteria 1703
205 Ga0157376_10539701 3300014969 Bacteria 1152
206 Ga0182007_10005838 3300015262 Bacteria 5351
207 Ga0206356_10093483 3300020070 Bacteria 1944
208 Ga0213873_10000001 3300021358 Bacteria 1657979
209 Ga0213876_10000037 3300021384 Bacteria 185653
210 Ga0213876_10196462 3300021384 Bacteria 1072
211 Ga0213876_10453038 3300021384 Bacteria 683
212 Ga0209784_100445 3300025224 Bacteria 17752
213 Ga0209566_100540 3300025225 Bacteria 25625
214 Ga0209674_100239 3300025226 Bacteria 46704
215 Ga0209646_1000019 3300025246 Bacteria 475248
216 Ga0209026_1001789 3300025250 Bacteria 8888
217 Ga0209677_109649 3300025253 Bacteria 1702
218 Ga0209148_1000193 3300025254 Bacteria 115649
219 Ga0209759_1007353 3300025256 Bacteria 3552
220 Ga0207642_10061811 3300025899 Bacteria 1743
221 Ga0207642_10177927 3300025899 Bacteria 1157
222 Ga0207680_10536047 3300025903 Bacteria 835
223 Ga0207685_10072149 3300025905 Bacteria 1403
224 Ga0207685_10138464 3300025905 Bacteria 1089
225 Ga0207685_10161520 3300025905 Unclassified 1023
226 Ga0207684_10208621 3300025910 Unclassified 1685
227 Ga0207654_10367812 3300025911 Bacteria 993
228 Ga0207707_10035518 3300025912 Bacteria 4359
229 Ga0207707_10049938 3300025912 Bacteria 3645
230 Ga0207695_10002741 3300025913 Bacteria 25691
231 Ga0207695_10114320 3300025913 Bacteria 2674
232 Ga0207695_10361681 3300025913 Bacteria 1338
233 Ga0207695_11366490 3300025913 Bacteria 589
234 Ga0207693_10182731 3300025915 Bacteria 1650
235 Ga0207662_10036229 3300025918 Bacteria 2883
236 Ga0207662_10066153 3300025918 Unclassified 2178
237 Ga0207649_10244724 3300025920 Bacteria 1289
238 Ga0207652_10048166 3300025921 Bacteria 3643
239 Ga0207646_10000008 3300025922 Bacteria 457143
240 Ga0207646_10000009 3300025922 Bacteria 453146
241 Ga0207646_10039414 3300025922 Bacteria 4253
242 Ga0207646_10083926 3300025922 Bacteria 2849
243 Ga0207646_10096059 3300025922 Unclassified 2655
244 Ga0207681_10140874 3300025923 Bacteria 1796
245 Ga0207681_10141334 3300025923 Bacteria 1793
246 Ga0207694_10000001 3300025924 Bacteria 4078485
247 Ga0207659_10106883 3300025926 Bacteria 2120
248 Ga0207687_10029174 3300025927 Bacteria 3709
249 Ga0207664_10228189 3300025929 Bacteria 1618
250 Ga0207690_10043033 3300025932 Bacteria 2970
251 Ga0207706_10057099 3300025933 Bacteria 3440
252 Ga0207686_10005807 3300025934 Bacteria 6621
253 Ga0207686_10012358 3300025934 Bacteria 4694
254 Ga0207686_10095196 3300025934 Unclassified 1976
255 Ga0207709_11136254 3300025935 Unclassified 642
256 Ga0207670_10001935 3300025936 Bacteria 10844
257 Ga0207670_10036697 3300025936 Bacteria 3189
258 Ga0207670_10496975 3300025936 Bacteria 990
259 Ga0207669_10061268 3300025937 Bacteria 2311
260 Ga0207704_10016704 3300025938 Bacteria 3781
261 Ga0207665_10031370 3300025939 Bacteria 3516
262 Ga0207665_10285094 3300025939 Bacteria 1230
263 Ga0207691_10129122 3300025940 Bacteria 2234
264 Ga0207711_10011400 3300025941 Bacteria 7387
265 Ga0207689_10023053 3300025942 Bacteria 5228
266 Ga0207689_10429129 3300025942 Bacteria 1103
267 Ga0207689_10745038 3300025942 Bacteria 827
268 Ga0207689_11064401 3300025942 Unclassified 682
269 Ga0207689_11397776 3300025942 Bacteria 587
270 Ga0207679_10365875 3300025945 Bacteria 1261
271 Ga0207667_10059302 3300025949 Bacteria 4008
272 Ga0207651_10005368 3300025960 Bacteria 6573
273 Ga0207651_10893443 3300025960 Bacteria 791
274 Ga0207640_10183493 3300025981 Bacteria 1571
275 Ga0207640_10350571 3300025981 Bacteria 1186
276 Ga0207640_10574974 3300025981 Bacteria 950
277 Ga0207658_10037525 3300025986 Bacteria 3483
278 Ga0207677_10028768 3300026023 Bacteria 3522
279 Ga0207677_10260619 3300026023 Bacteria 1413
280 Ga0207703_10000653 3300026035 Bacteria 34790
281 Ga0207703_10051202 3300026035 Bacteria 3345
282 Ga0207708_10000205 3300026075 Bacteria 46835
283 Ga0207708_10051601 3300026075 Bacteria 3132
284 Ga0207641_10024080 3300026088 Bacteria 5017
285 Ga0207641_10858726 3300026088 Bacteria 900
286 Ga0207648_10029086 3300026089 Bacteria 4900
287 Ga0207648_10118791 3300026089 Bacteria 2324
288 Ga0207676_10461878 3300026095 Bacteria 1199
289 Ga0207674_10672682 3300026116 Bacteria 999
290 Ga0207675_100023087 3300026118 Bacteria 5785
291 Ga0207675_100109627 3300026118 Bacteria 2605
292 Ga0207683_10106774 3300026121 Bacteria 2504
293 Ga0209974_10178203 3300027876 Unclassified 777
294 Ga0268264_10273356 3300028381 Bacteria 1579
295 Ga0268264_10669501 3300028381 Unclassified 1028
296 Ga0265337_1003140 3300028556 Bacteria 7276
297 Ga0265326_10041067 3300028558 Unclassified 1313
298 Ga0265319_1001058 3300028563 Bacteria 17178
299 Ga0265334_10007070 3300028573 Bacteria 4818
300 Ga0265318_10003596 3300028577 Bacteria 7756
301 Ga0265336_10029292 3300028666 Unclassified 1718
302 Ga0265338_10002442 3300028800 Bacteria 27879
303 Ga0316579_10008919 3300031691 Bacteria 4203
304 Ga0316578_10000028 3300031728 Bacteria 29590
305 Ga0316577_10452227 3300031733 Bacteria 730
306 Ga0307406_11118641 3300031901 Bacteria 681
307 Ga0316580_10005824 3300032139 Bacteria 3618
308 Ga0373926_0020471 3300035083 Bacteria 2285
309 Ga0373926_0024417 3300035083 Bacteria 2105
310 Ga0373944_0014715 3300035089 Bacteria 2187
311 Ga0373944_0128136 3300035089 Bacteria 880
312 Ga0373923_0130326 3300035111 Bacteria 1130
313 Ga0373936_0016217 3300035113 Bacteria 2864
314 Ga0373945_0011626 3300035116 Bacteria 2912
315 Ga0373945_0272675 3300035116 Unclassified 719
316 Ga0373943_0022248 3300035170 Bacteria 2935
317 Ga0373946_0021598 3300035171 Bacteria 2497
318 Ga0373946_0083716 3300035171 Bacteria 1401
319 Ga0373924_0030450 3300035410 Bacteria 2164
320 Ga0373924_0087058 3300035410 Bacteria 1333
321 Ga0373931_0036839 3300035691 Bacteria 2552
322 Ga0373935_0254885 3300035692 Bacteria 1229
323 Ga0373935_0340742 3300035692 Archaea 1067
324 Ga0373935_0530771 3300035692 Bacteria 856
325 Ga0373927_0183839 3300035695 Bacteria 1371
326 Ga0373927_0282857 3300035695 Bacteria 1091
327 Ga0373927_0318223 3300035695 Bacteria 1024
328 Ga0373933_0101668 3300035724 Bacteria 1784
329 Ga0373933_0862220 3300035724 Bacteria 596
330 Ga0373947_0005621 3300035725 Bacteria 7310
331 Ga0373947_0327590 3300035725 Bacteria 1025
332 Ga0316582_0448326 3300036647 Bacteria 889
333 Ga0316584_0001573 3300036712 Bacteria 13855
334 Ga0316584_0229722 3300036712 Bacteria 1361
335 Ga0373925_0121378 3300037068 Bacteria 2029
336 Ga0373925_0137206 3300037068 Bacteria 1912
337 Ga0373925_0156545 3300037068 Bacteria 1792
338 Ga0373925_0278562 3300037068 Bacteria 1346
339 Ga0373925_0283238 3300037068 Bacteria 1335
340 Ga0373925_1292351 3300037068 Bacteria 599
341 Ga0395898_0023625 3300037466 Bacteria 6209
342 Ga0316581_0000750 3300037588 Bacteria 6678
343 Ga0436365_0605606 3300039437 Bacteria 64934
344 Ga0436365_0614489 3300039437 Bacteria 1049
345 Ga0436362_0969073 3300039453 Bacteria 64846
346 Ga0439439_0110689 3300041406 Bacteria 761
347 Ga0451789_0858393 3300041443 Bacteria 608
348 Ga0451791_0530658 3300041451 Bacteria 991
349 Ga0451797_0660528 3300041453 Bacteria 1359
350 Ga0451798_1167771 3300041458 Bacteria 537
351 Ga0451807_0717071 3300041486 Bacteria 939
352 Ga0451807_1974645 3300041486 Bacteria 709
353 Ga0451843_0622708 3300041509 Bacteria 1262
354 Ga0451577_0115501 3300042876 Bacteria 2403
355 Ga0466986_0041101 3300044650 Bacteria 3181
356 Ga0466969_0110339 3300044656 Bacteria 1288
357 Ga0466972_0008336 3300044658 Bacteria 5194
358 Ga0466978_0053880 3300044671 Bacteria 2508
359 Ga0466965_0025797 3300044683 Bacteria 2847
360 Ga0466966_0009512 3300044684 Bacteria 6436
361 Ga0466966_0344770 3300044684 Bacteria 895
362 Ga0466966_0441235 3300044684 Bacteria 782
363 Ga0466961_0000202 3300044693 Bacteria 40048
364 Ga0466961_0011894 3300044693 Bacteria 5562
365 Ga0466963_0135831 3300044694 Bacteria 1701
366 Ga0466964_0000540 3300044706 Bacteria 11854
367 Ga0466964_0002827 3300044706 Bacteria 6254
368 Ga0453684_0269827 3300044712 Bacteria 1945
369 Ga0453684_1140159 3300044712 Archaea 822
370 Ga0466971_0000526 3300044719 Bacteria 15165
371 Ga0466968_0005795 3300044735 Bacteria 4634
372 Ga0466968_0027309 3300044735 Bacteria 2348
373 Ga0466970_0023594 3300044765 Bacteria 3213
374 Ga0466957_0013473 3300044842 Bacteria 4742
375 Ga0466957_0022269 3300044842 Bacteria 3736
376 Ga0466957_0066922 3300044842 Bacteria 2216
377 Ga0466959_0019887 3300045049 Bacteria 4941
378 Ga0466959_0025213 3300045049 Bacteria 4405
379 Ga0466959_0144632 3300045049 Bacteria 1678
380 Ga0466959_0283960 3300045049 Bacteria 1136
381 Ga0466959_0412480 3300045049 Bacteria 917
382 Ga0451576_0001930 3300045051 Bacteria 33143
383 Ga0451576_0306990 3300045051 Unclassified 1660
384 Ga0466958_0041528 3300045836 Bacteria 2767
385 Ga0466967_0682779 3300045976 Bacteria 1016
386 Ga0495592_0346802 3300046454 Bacteria 953
387 Ga0495603_0004928 3300046455 Bacteria 7990
388 Ga0495603_0097317 3300046455 Bacteria 1719
389 Ga0495653_0364226 3300046463 Unclassified 927
390 Ga0495580_0006001 3300046472 Bacteria 9944
391 Ga0495580_0006052 3300046472 Bacteria 9902
392 Ga0495580_0930648 3300046472 Bacteria 557
393 Ga0495582_0060610 3300046473 Bacteria 2088
394 Ga0495582_0537113 3300046473 Unclassified 676
395 Ga0495639_0007478 3300046475 Bacteria 4690
396 Ga0495639_0554051 3300046475 Bacteria 589
397 Ga0495594_0033209 3300046499 Unclassified 2804
398 Ga0495594_0033879 3300046499 Bacteria 2778
399 Ga0495628_0001254 3300046516 Bacteria 23214
400 Ga0495628_0283034 3300046516 Bacteria 1231
401 Ga0495630_0226180 3300046517 Bacteria 1429
402 Ga0495630_1181979 3300046517 Bacteria 578
403 Ga0495666_0037155 3300046526 Bacteria 2370
404 Ga0495665_0038212 3300046531 Bacteria 2560
405 Ga0495586_0005860 3300046535 Bacteria 6566
406 Ga0495587_0184444 3300046536 Bacteria 1182
407 Ga0495667_0204987 3300046559 Bacteria 1261
408 Ga0495634_0471151 3300046642 Unclassified 739
409 Ga0495635_0023912 3300046663 Bacteria 4258
410 Ga0495635_0313819 3300046663 Unclassified 1050
411 Ga0495588_0021564 3300046674 Bacteria 3175
412 Ga0495588_0219102 3300046674 Bacteria 1005
413 Ga0495657_0010941 3300046675 Bacteria 6805
414 Ga0495647_0003537 3300046681 Bacteria 5005
415 Ga0495658_0112294 3300046683 Bacteria 1640
416 Ga0495613_0776767 3300046689 Bacteria 626
417 Ga0495671_0038329 3300046692 Bacteria 2422
418 Ga0495600_0181356 3300046809 Bacteria 1357
419 Ga0495581_0011311 3300047315 Bacteria 5162
420 Ga0495581_0082126 3300047315 Bacteria 1866
421 Ga0495581_0277459 3300047315 Bacteria 980
422 Ga0495581_0342426 3300047315 Bacteria 873
423 Ga0495581_0775423 3300047315 Unclassified 551
424 Ga0495636_0392384 3300047318 Bacteria 660
425 Ga0495676_0085887 3300047321 Bacteria 2369
426 Ga0495680_0095186 3300047322 Bacteria 2227
427 Ga0495684_0008354 3300047471 Bacteria 8021
428 Ga0496101_1459266 3300048904 Bacteria 533
429 Ga0496125_0053414 3300048928 Bacteria 3312
430 Ga0496126_0508364 3300048929 Bacteria 962
431 Ga0501031_0012400 3300049568 Bacteria 5558
432 Ga0501031_0638525 3300049568 Bacteria 684
433 Ga0501032_0092351 3300049569 Bacteria 2008
434 Ga0501036_1493181 3300049572 Bacteria 547
435 Ga0501037_0419517 3300049573 Bacteria 916
436 Ga0501037_0952002 3300049573 Unclassified 561
437 Ga0501039_0007824 3300049575 Bacteria 8148
438 Ga0501041_0008815 3300049577 Bacteria 5938
439 Ga0501042_0011521 3300049578 Bacteria 5971
440 Ga0501042_0285628 3300049578 Bacteria 1192
441 Ga0501046_0005984 3300049580 Bacteria 10828
442 Ga0501047_0454052 3300049581 Bacteria 1111
443 Ga0501048_0100070 3300049582 Bacteria 2045
444 Ga0501070_1086891 3300049586 Bacteria 617
445 Ga0501071_0572729 3300049587 Bacteria 868
446 Ga0501072_0349061 3300049588 Bacteria 1175
447 Ga0501073_0001571 3300049589 Bacteria 16936
448 Ga0501077_0130145 3300049593 Bacteria 1596
449 Ga0501079_0412478 3300049741 Bacteria 1060
450 Ga0501035_0135321 3300049822 Bacteria 2146
451 Ga0501044_0836160 3300049823 Bacteria 798
452 nmdc:mga05p37_1386572_c1 3300050507 Bacteria 709
453 nmdc:mga09592_682574_c1 3300050508 Bacteria 875
454 nmdc:mga09592_694354_c1 3300050508 Unclassified 866
455 nmdc:mga0qj67_24168_c1 3300050509 Bacteria 4682
456 nmdc:mga06r32_1776_c2 3300050510 Bacteria 18602
457 nmdc:mga06r32_544347_c1 3300050510 Unclassified 1135
458 nmdc:mga06r32_879217_c1 3300050510 Bacteria 853
459 nmdc:mga08y16_25228_c1 3300050511 Bacteria 6268
460 nmdc:mga0n895_163095_c1 3300050512 Bacteria 1507
461 nmdc:mga0n895_30592_c1 3300050512 Bacteria 5147
462 nmdc:mga0n895_307_c1 3300050512 Bacteria 32508
463 nmdc:mga08x19_135772_c1 3300050514 Bacteria 1658
464 nmdc:mga08x19_425663_c1 3300050514 Bacteria 933
465 nmdc:mga08x19_5329_c1 3300050514 Bacteria 7602
466 nmdc:mga0a205_3356_c1 3300050515 Bacteria 14254
467 nmdc:mga0a205_76057_c1 3300050515 Bacteria 3244
468 Ga0495601_0009485 3300053077 Bacteria 5760
469 Ga0495595_0158274 3300053084 Bacteria 1117
470 Ga0495595_0417307 3300053084 Bacteria 681
471 Ga0495619_0022099 3300053085 Bacteria 4067
472 Ga0495619_0190587 3300053085 Unclassified 1419
473 Ga0500556_0000152 3300053104 Bacteria 57878
474 Ga0500616_0000032 3300053153 Bacteria 403673
475 Ga0501084_0723940 3300054114 Bacteria 839
476 Ga0466962_0009122 3300061719 Bacteria 4751
477 Ga0466962_0085106 3300061719 Bacteria 1514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0392384 Ga0495636_0392384_231_620 129
2 3300047315 Ga0495581_0775423 Ga0495581_0775423_17_427 136
3 3300009093 Ga0105240_10033173 Ga0105240_100331736 138
4 3300013307 Ga0157372_10002494 Ga0157372_1000249416 138
5 3300046663 Ga0495635_0313819 Ga0495635_0313819_589_1038 138
6 3300025905 Ga0207685_10161520 Ga0207685_101615202 145
7 3300007265 Ga0099794_10599872 Ga0099794_105998721 146
8 3300005354 Ga0070675_100245141 Ga0070675_1002451412 147
9 3300005365 Ga0070688_100043702 Ga0070688_1000437023 147
10 3300005466 Ga0070685_10604878 Ga0070685_106048781 147
11 3300005544 Ga0070686_100007508 Ga0070686_1000075085 147
12 3300006237 Ga0097621_100019691 Ga0097621_1000196914 147
13 3300006358 Ga0068871_100063686 Ga0068871_1000636863 147
14 3300009176 Ga0105242_10036636 Ga0105242_100366362 147
15 3300013308 Ga0157375_10012076 Ga0157375_100120764 147
16 3300014968 Ga0157379_11826483 Ga0157379_118264831 147
17 3300014969 Ga0157376_10014517 Ga0157376_100145176 147
18 3300025926 Ga0207659_10106883 Ga0207659_101068833 147
19 3300025934 Ga0207686_10012358 Ga0207686_100123584 147
20 3300046455 Ga0495603_0097317 Ga0495603_0097317_974_1453 147
21 3300046642 Ga0495634_0471151 Ga0495634_0471151_68_547 147
22 3300046683 Ga0495658_0112294 Ga0495658_0112294_1111_1590 147
23 3300047315 Ga0495581_0342426 Ga0495581_0342426_300_779 147
24 3300005445 Ga0070708_100132641 Ga0070708_1001326412 148
25 3300005459 Ga0068867_100004274 Ga0068867_10000427410 148
26 3300005467 Ga0070706_100394328 Ga0070706_1003943282 148
27 3300005468 Ga0070707_100481476 Ga0070707_1004814761 148
28 3300005471 Ga0070698_100153800 Ga0070698_1001538002 148
29 3300005518 Ga0070699_100488718 Ga0070699_1004887182 148
30 3300005536 Ga0070697_100293505 Ga0070697_1002935051 148
31 3300006163 Ga0070715_10738832 Ga0070715_107388321 148
32 3300006173 Ga0070716_100047265 Ga0070716_1000472651 148
33 3300009147 Ga0114129_10428110 Ga0114129_104281101 148
34 3300009148 Ga0105243_11493934 Ga0105243_114939341 148
35 3300009176 Ga0105242_10039058 Ga0105242_100390582 148
36 3300009177 Ga0105248_10000669 Ga0105248_1000066913 148
37 3300009551 Ga0105238_10645018 Ga0105238_106450182 148
38 3300014326 Ga0157380_10179720 Ga0157380_101797202 148
39 3300025905 Ga0207685_10072149 Ga0207685_100721492 148
40 3300025910 Ga0207684_10208621 Ga0207684_102086213 148
41 3300025922 Ga0207646_10096059 Ga0207646_100960593 148
42 3300050509 nmdc:mga0qj67_24168_c1 nmdc:mga0qj67_24168_c1_1667_2146 148
43 3300005437 Ga0070710_10925054 Ga0070710_109250541 149
44 3300005444 Ga0070694_100175923 Ga0070694_1001759232 149
45 3300005468 Ga0070707_100000020 Ga0070707_10000002020 149
46 3300005471 Ga0070698_100716754 Ga0070698_1007167542 149
47 3300005536 Ga0070697_100916282 Ga0070697_1009162821 149
48 3300014326 Ga0157380_10001115 Ga0157380_1000111514 149
49 3300054114 Ga0501084_0723940 Ga0501084_0723940_12_494 149
50 3300005330 Ga0070690_100005668 Ga0070690_1000056682 150
51 3300005340 Ga0070689_100000971 Ga0070689_1000009716 150
52 3300005341 Ga0070691_10016825 Ga0070691_100168252 150
53 3300005343 Ga0070687_100036645 Ga0070687_1000366452 150
54 3300005365 Ga0070688_100000351 Ga0070688_10000035120 150
55 3300005438 Ga0070701_10000349 Ga0070701_100003495 150
56 3300005440 Ga0070705_100834726 Ga0070705_1008347262 150
57 3300005441 Ga0070700_100002242 Ga0070700_1000022425 150
58 3300005466 Ga0070685_10000043 Ga0070685_100000435 150
59 3300005468 Ga0070707_100534283 Ga0070707_1005342832 150
60 3300005518 Ga0070699_100175411 Ga0070699_1001754111 150
61 3300005544 Ga0070686_100001492 Ga0070686_1000014928 150
62 3300005617 Ga0068859_100024468 Ga0068859_1000244682 150
63 3300005718 Ga0068866_10032823 Ga0068866_100328232 150
64 3300005719 Ga0068861_100184033 Ga0068861_1001840333 150
65 3300005843 Ga0068860_100472979 Ga0068860_1004729792 150
66 3300006931 Ga0097620_100024467 Ga0097620_1000244672 150
67 3300025899 Ga0207642_10061811 Ga0207642_100618112 150
68 3300025918 Ga0207662_10066153 Ga0207662_100661532 150
69 3300025934 Ga0207686_10095196 Ga0207686_100951962 150
70 3300025935 Ga0207709_11136254 Ga0207709_111362541 150
71 3300025936 Ga0207670_10036697 Ga0207670_100366973 150
72 3300025941 Ga0207711_10011400 Ga0207711_100114003 150
73 3300026075 Ga0207708_10000205 Ga0207708_100002058 150
74 3300026089 Ga0207648_10118791 Ga0207648_101187912 150
75 3300026118 Ga0207675_100109627 Ga0207675_1001096273 150
76 3300028381 Ga0268264_10669501 Ga0268264_106695012 150
77 3300005336 Ga0070680_100153636 Ga0070680_1001536363 151
78 3300005440 Ga0070705_100339691 Ga0070705_1003396911 151
79 3300005444 Ga0070694_100168093 Ga0070694_1001680932 151
80 3300005471 Ga0070698_100338200 Ga0070698_1003382003 151
81 3300005518 Ga0070699_100908575 Ga0070699_1009085752 151
82 3300005536 Ga0070697_100028751 Ga0070697_1000287513 151
83 3300005549 Ga0070704_100008895 Ga0070704_1000088956 151
84 3300005549 Ga0070704_100553053 Ga0070704_1005530532 151
85 3300025912 Ga0207707_10049938 Ga0207707_100499384 151
86 3300025922 Ga0207646_10000008 Ga0207646_10000008384 151
87 3300025922 Ga0207646_10000009 Ga0207646_1000000972 151
88 3300035111 Ga0373923_0130326 Ga0373923_0130326_605_1093 151
89 3300035410 Ga0373924_0030450 Ga0373924_0030450_1220_1708 151
90 3300035692 Ga0373935_0340742 Ga0373935_0340742_331_819 151
91 3300035724 Ga0373933_0101668 Ga0373933_0101668_116_604 151
92 3300037068 Ga0373925_0137206 Ga0373925_0137206_718_1206 151
93 3300046454 Ga0495592_0346802 Ga0495592_0346802_266_754 151
94 3300046463 Ga0495653_0364226 Ga0495653_0364226_391_879 151
95 3300046499 Ga0495594_0033209 Ga0495594_0033209_395_883 151
96 3300046517 Ga0495630_0226180 Ga0495630_0226180_882_1370 151
97 3300046536 Ga0495587_0184444 Ga0495587_0184444_78_566 151
98 3300046559 Ga0495667_0204987 Ga0495667_0204987_632_1120 151
99 3300046663 Ga0495635_0023912 Ga0495635_0023912_666_1154 151
100 3300046674 Ga0495588_0219102 Ga0495588_0219102_56_556 151
101 3300046675 Ga0495657_0010941 Ga0495657_0010941_763_1251 151
102 3300046689 Ga0495613_0776767 Ga0495613_0776767_128_616 151
103 3300046809 Ga0495600_0181356 Ga0495600_0181356_237_725 151
104 3300047315 Ga0495581_0011311 Ga0495581_0011311_4272_4760 151
105 3300047322 Ga0495680_0095186 Ga0495680_0095186_785_1273 151
106 3300053077 Ga0495601_0009485 Ga0495601_0009485_1622_2110 151
107 3300053084 Ga0495595_0158274 Ga0495595_0158274_80_568 151
108 3300053084 Ga0495595_0417307 Ga0495595_0417307_26_514 151
109 3300053085 Ga0495619_0022099 Ga0495619_0022099_1214_1702 151
110 3300053085 Ga0495619_0190587 Ga0495619_0190587_804_1292 151
111 3300049568 Ga0501031_0012400 Ga0501031_0012400_5055_5546 152
112 3300049569 Ga0501032_0092351 Ga0501032_0092351_810_1301 152
113 3300049573 Ga0501037_0419517 Ga0501037_0419517_238_729 152
114 3300049575 Ga0501039_0007824 Ga0501039_0007824_930_1421 152
115 3300049577 Ga0501041_0008815 Ga0501041_0008815_373_864 152
116 3300049578 Ga0501042_0011521 Ga0501042_0011521_4614_5105 152
117 3300049580 Ga0501046_0005984 Ga0501046_0005984_6020_6511 152
118 3300049582 Ga0501048_0100070 Ga0501048_0100070_670_1161 152
119 3300049593 Ga0501077_0130145 Ga0501077_0130145_349_840 152
120 3300049822 Ga0501035_0135321 Ga0501035_0135321_906_1397 152
121 3300005295 Ga0065707_10089909 Ga0065707_100899091 153
122 3300005330 Ga0070690_100558940 Ga0070690_1005589401 153
123 3300005334 Ga0068869_100008574 Ga0068869_1000085742 153
124 3300005338 Ga0068868_100714452 Ga0068868_1007144522 153
125 3300005545 Ga0070695_100814977 Ga0070695_1008149771 153
126 3300005615 Ga0070702_100931215 Ga0070702_1009312152 153
127 3300005618 Ga0068864_100109514 Ga0068864_1001095142 153
128 3300005842 Ga0068858_100215700 Ga0068858_1002157003 153
129 3300005843 Ga0068860_100049535 Ga0068860_1000495352 153
130 3300006163 Ga0070715_10284868 Ga0070715_102848682 153
131 3300006852 Ga0075433_10004298 Ga0075433_1000429814 153
132 3300006871 Ga0075434_100004987 Ga0075434_10000498716 153
133 3300006914 Ga0075436_100030597 Ga0075436_1000305973 153
134 3300007076 Ga0075435_100000533 Ga0075435_1000005332 153
135 3300009094 Ga0111539_10024047 Ga0111539_100240478 153
136 3300009147 Ga0114129_11256243 Ga0114129_112562432 153
137 3300014745 Ga0157377_10040702 Ga0157377_100407023 153
138 3300025905 Ga0207685_10138464 Ga0207685_101384642 153
139 3300025942 Ga0207689_10745038 Ga0207689_107450382 153
140 3300025942 Ga0207689_11064401 Ga0207689_110644011 153
141 3300026023 Ga0207677_10260619 Ga0207677_102606192 153
142 3300027876 Ga0209974_10178203 Ga0209974_101782032 153
143 3300035083 Ga0373926_0020471 Ga0373926_0020471_758_1219 153
144 3300035089 Ga0373944_0014715 Ga0373944_0014715_870_1331 153
145 3300035113 Ga0373936_0016217 Ga0373936_0016217_738_1199 153
146 3300035116 Ga0373945_0011626 Ga0373945_0011626_1349_1810 153
147 3300035170 Ga0373943_0022248 Ga0373943_0022248_1410_1871 153
148 3300035171 Ga0373946_0021598 Ga0373946_0021598_1408_1869 153
149 3300035410 Ga0373924_0087058 Ga0373924_0087058_394_855 153
150 3300035692 Ga0373935_0530771 Ga0373935_0530771_33_494 153
151 3300035695 Ga0373927_0318223 Ga0373927_0318223_363_824 153
152 3300035725 Ga0373947_0005621 Ga0373947_0005621_6585_7046 153
153 3300037068 Ga0373925_0156545 Ga0373925_0156545_33_494 153
154 3300037068 Ga0373925_0278562 Ga0373925_0278562_853_1314 153
155 3300042876 Ga0451577_0115501 Ga0451577_0115501_641_1102 153
156 3300045051 Ga0451576_0001930 Ga0451576_0001930_3459_3920 153
157 3300046455 Ga0495603_0004928 Ga0495603_0004928_3586_4047 153
158 3300046472 Ga0495580_0006052 Ga0495580_0006052_7964_8425 153
159 3300046473 Ga0495582_0060610 Ga0495582_0060610_686_1147 153
160 3300046475 Ga0495639_0007478 Ga0495639_0007478_1603_2064 153
161 3300046499 Ga0495594_0033879 Ga0495594_0033879_705_1166 153
162 3300046517 Ga0495630_1181979 Ga0495630_1181979_62_523 153
163 3300046526 Ga0495666_0037155 Ga0495666_0037155_235_696 153
164 3300046531 Ga0495665_0038212 Ga0495665_0038212_1347_1808 153
165 3300046535 Ga0495586_0005860 Ga0495586_0005860_5236_5697 153
166 3300046674 Ga0495588_0021564 Ga0495588_0021564_608_1069 153
167 3300046681 Ga0495647_0003537 Ga0495647_0003537_3423_3884 153
168 3300047315 Ga0495581_0082126 Ga0495581_0082126_562_1023 153
169 3300047321 Ga0495676_0085887 Ga0495676_0085887_767_1228 153
170 3300049568 Ga0501031_0638525 Ga0501031_0638525_85_546 153
171 3300049572 Ga0501036_1493181 Ga0501036_1493181_37_531 153
172 3300049573 Ga0501037_0952002 Ga0501037_0952002_29_523 153
173 3300049578 Ga0501042_0285628 Ga0501042_0285628_243_704 153
174 3300049587 Ga0501071_0572729 Ga0501071_0572729_189_650 153
175 3300049588 Ga0501072_0349061 Ga0501072_0349061_604_1065 153
176 3300049741 Ga0501079_0412478 Ga0501079_0412478_488_982 153
177 3300050510 nmdc:mga06r32_879217_c1 nmdc:mga06r32_879217_c1_165_626 153
178 3300050511 nmdc:mga08y16_25228_c1 nmdc:mga08y16_25228_c1_2412_2873 153
179 3300050512 nmdc:mga0n895_307_c1 nmdc:mga0n895_307_c1_1771_2232 153
180 3300050514 nmdc:mga08x19_5329_c1 nmdc:mga08x19_5329_c1_3514_3975 153
181 3300050515 nmdc:mga0a205_3356_c1 nmdc:mga0a205_3356_c1_9989_10450 153
182 3300005330 Ga0070690_100739181 Ga0070690_1007391812 154
183 3300005334 Ga0068869_100267329 Ga0068869_1002673292 154
184 3300005341 Ga0070691_10287392 Ga0070691_102873921 154
185 3300005444 Ga0070694_100175915 Ga0070694_1001759153 154
186 3300005445 Ga0070708_100410717 Ga0070708_1004107172 154
187 3300005467 Ga0070706_100169922 Ga0070706_1001699222 154
188 3300005468 Ga0070707_100345885 Ga0070707_1003458852 154
189 3300005530 Ga0070679_100110217 Ga0070679_1001102173 154
190 3300005545 Ga0070695_100080718 Ga0070695_1000807183 154
191 3300005546 Ga0070696_100046668 Ga0070696_1000466682 154
192 3300005547 Ga0070693_100282702 Ga0070693_1002827022 154
193 3300005549 Ga0070704_100384843 Ga0070704_1003848432 154
194 3300005615 Ga0070702_100008885 Ga0070702_1000088854 154
195 3300006173 Ga0070716_100424203 Ga0070716_1004242031 154
196 3300006871 Ga0075434_100026137 Ga0075434_1000261374 154
197 3300007076 Ga0075435_100154764 Ga0075435_1001547641 154
198 3300009098 Ga0105245_10759368 Ga0105245_107593682 154
199 3300009176 Ga0105242_10275821 Ga0105242_102758211 154
200 3300013297 Ga0157378_10162879 Ga0157378_101628794 154
201 3300025922 Ga0207646_10083926 Ga0207646_100839262 154
202 3300025939 Ga0207665_10031370 Ga0207665_100313701 154
203 3300025942 Ga0207689_11397776 Ga0207689_113977761 154
204 3300025960 Ga0207651_10893443 Ga0207651_108934432 154
205 3300035116 Ga0373945_0272675 Ga0373945_0272675_197_685 154
206 3300035695 Ga0373927_0183839 Ga0373927_0183839_354_842 154
207 3300050514 nmdc:mga08x19_425663_c1 nmdc:mga08x19_425663_c1_92_580 154
208 3300050515 nmdc:mga0a205_76057_c1 nmdc:mga0a205_76057_c1_1119_1607 154
209 3300014325 Ga0163163_10078302 Ga0163163_100783024 155
210 3300014325 Ga0163163_10944703 Ga0163163_109447032 155
211 3300014968 Ga0157379_10535279 Ga0157379_105352792 155
212 3300041406 Ga0439439_0110689 Ga0439439_0110689_33_500 155
213 3300046692 Ga0495671_0038329 Ga0495671_0038329_1517_1984 155
214 3300050512 nmdc:mga0n895_30592_c1 nmdc:mga0n895_30592_c1_3221_3709 155
215 3300053104 Ga0500556_0000152 Ga0500556_0000152_43047_43514 155
216 iso_pu_bacteria 2734482258 2735818043 155
217 3300035692 Ga0373935_0254885 Ga0373935_0254885_115_585 156
218 3300037068 Ga0373925_0121378 Ga0373925_0121378_1301_1771 156
219 3300046473 Ga0495582_0537113 Ga0495582_0537113_169_639 156
220 3300005438 Ga0070701_10004286 Ga0070701_100042866 157
221 3300005548 Ga0070665_101206750 Ga0070665_1012067501 157
222 3300006844 Ga0075428_100059879 Ga0075428_1000598792 157
223 3300006847 Ga0075431_100001900 Ga0075431_1000019004 157
224 3300006847 Ga0075431_100363592 Ga0075431_1003635922 157
225 3300009093 Ga0105240_10063832 Ga0105240_100638324 157
226 3300010159 Ga0099796_10025635 Ga0099796_100256351 157
227 3300013105 Ga0157369_11036901 Ga0157369_110369011 157
228 3300021384 Ga0213876_10196462 Ga0213876_101964622 157
229 3300025913 Ga0207695_10114320 Ga0207695_101143202 157
230 3300025913 Ga0207695_10361681 Ga0207695_103616812 157
231 3300039437 Ga0436365_0614489 Ga0436365_0614489_283_756 157
232 3300048904 Ga0496101_1459266 Ga0496101_1459266_50_523 157
233 3300048929 Ga0496126_0508364 Ga0496126_0508364_117_590 157
234 3300049581 Ga0501047_0454052 Ga0501047_0454052_266_739 157
235 3300050508 nmdc:mga09592_682574_c1 nmdc:mga09592_682574_c1_16_489 157
236 3300050510 nmdc:mga06r32_1776_c2 nmdc:mga06r32_1776_c2_17131_17604 157
237 3300050510 nmdc:mga06r32_544347_c1 nmdc:mga06r32_544347_c1_632_1105 157
238 3300005345 Ga0070692_10065793 Ga0070692_100657931 158
239 3300005458 Ga0070681_10052307 Ga0070681_100523074 158
240 3300005468 Ga0070707_100044642 Ga0070707_1000446425 158
241 3300005530 Ga0070679_100064698 Ga0070679_1000646981 158
242 3300006844 Ga0075428_100010352 Ga0075428_10001035214 158
243 3300006914 Ga0075436_100149118 Ga0075436_1001491183 158
244 3300009036 Ga0105244_10309203 Ga0105244_103092032 158
245 3300009093 Ga0105240_10175752 Ga0105240_101757524 158
246 3300009093 Ga0105240_10761152 Ga0105240_107611522 158
247 3300009545 Ga0105237_10229452 Ga0105237_102294522 158
248 3300013105 Ga0157369_10122037 Ga0157369_101220373 158
249 3300013297 Ga0157378_10014061 Ga0157378_100140616 158
250 3300013308 Ga0157375_10384238 Ga0157375_103842381 158
251 3300020070 Ga0206356_10093483 Ga0206356_100934832 158
252 3300021358 Ga0213873_10000001 Ga0213873_1000000166 158
253 3300021384 Ga0213876_10000037 Ga0213876_1000003766 158
254 3300025912 Ga0207707_10035518 Ga0207707_100355184 158
255 3300025913 Ga0207695_11366490 Ga0207695_113664901 158
256 3300025915 Ga0207693_10182731 Ga0207693_101827312 158
257 3300025921 Ga0207652_10048166 Ga0207652_100481661 158
258 3300025922 Ga0207646_10039414 Ga0207646_100394145 158
259 3300025929 Ga0207664_10228189 Ga0207664_102281892 158
260 3300025949 Ga0207667_10059302 Ga0207667_100593025 158
261 3300025981 Ga0207640_10183493 Ga0207640_101834932 158
262 3300031733 Ga0316577_10452227 Ga0316577_104522271 158
263 3300037466 Ga0395898_0023625 Ga0395898_0023625_3408_3884 158
264 3300039437 Ga0436365_0605606 Ga0436365_0605606_49185_49661 158
265 3300039453 Ga0436362_0969073 Ga0436362_0969073_49185_49661 158
266 3300041451 Ga0451791_0530658 Ga0451791_0530658_381_878 158
267 3300044684 Ga0466966_0344770 Ga0466966_0344770_40_516 158
268 3300044684 Ga0466966_0441235 Ga0466966_0441235_195_671 158
269 3300044842 Ga0466957_0066922 Ga0466957_0066922_1172_1648 158
270 3300045049 Ga0466959_0144632 Ga0466959_0144632_758_1234 158
271 3300045049 Ga0466959_0283960 Ga0466959_0283960_375_851 158
272 3300045049 Ga0466959_0412480 Ga0466959_0412480_120_596 158
273 3300046516 Ga0495628_0001254 Ga0495628_0001254_4258_4734 158
274 3300047471 Ga0495684_0008354 Ga0495684_0008354_926_1402 158
275 3300050512 nmdc:mga0n895_163095_c1 nmdc:mga0n895_163095_c1_934_1416 158
276 3300050514 nmdc:mga08x19_135772_c1 nmdc:mga08x19_135772_c1_238_720 158
277 3300053153 Ga0500616_0000032 Ga0500616_0000032_258954_259430 158
278 3300006163 Ga0070715_10243447 Ga0070715_102434471 159
279 3300009551 Ga0105238_10000002 Ga0105238_10000002354 159
280 3300011119 Ga0105246_10456019 Ga0105246_104560192 159
281 3300013296 Ga0157374_10000016 Ga0157374_1000001657 159
282 3300014745 Ga0157377_10000004 Ga0157377_1000000414 159
283 3300014968 Ga0157379_10002731 Ga0157379_100027315 159
284 3300014969 Ga0157376_10235447 Ga0157376_102354474 159
285 3300025924 Ga0207694_10000001 Ga0207694_10000001355 159
286 3300025942 Ga0207689_10429129 Ga0207689_104291292 159
287 3300025981 Ga0207640_10350571 Ga0207640_103505712 159
288 3300026088 Ga0207641_10858726 Ga0207641_108587262 159
289 3300028556 Ga0265337_1003140 Ga0265337_10031406 159
290 3300028558 Ga0265326_10041067 Ga0265326_100410671 159
291 3300028563 Ga0265319_1001058 Ga0265319_100105814 159
292 3300028573 Ga0265334_10007070 Ga0265334_100070702 159
293 3300028577 Ga0265318_10003596 Ga0265318_100035969 159
294 3300028666 Ga0265336_10029292 Ga0265336_100292922 159
295 3300028800 Ga0265338_10002442 Ga0265338_100024425 159
296 3300035083 Ga0373926_0024417 Ga0373926_0024417_750_1229 159
297 3300035089 Ga0373944_0128136 Ga0373944_0128136_224_703 159
298 3300035171 Ga0373946_0083716 Ga0373946_0083716_687_1166 159
299 3300035695 Ga0373927_0282857 Ga0373927_0282857_417_896 159
300 3300035725 Ga0373947_0327590 Ga0373947_0327590_270_749 159
301 3300037068 Ga0373925_0283238 Ga0373925_0283238_306_785 159
302 3300037068 Ga0373925_1292351 Ga0373925_1292351_55_534 159
303 3300041458 Ga0451798_1167771 Ga0451798_1167771_23_502 159
304 3300044712 Ga0453684_0269827 Ga0453684_0269827_699_1178 159
305 3300046472 Ga0495580_0006001 Ga0495580_0006001_4690_5169 159
306 3300005343 Ga0070687_100434628 Ga0070687_1004346282 160
307 3300006847 Ga0075431_100605655 Ga0075431_1006056551 160
308 3300006847 Ga0075431_101906686 Ga0075431_1019066861 160
309 3300006880 Ga0075429_101080133 Ga0075429_1010801331 160
310 3300035724 Ga0373933_0862220 Ga0373933_0862220_56_538 160
311 3300046472 Ga0495580_0930648 Ga0495580_0930648_28_510 160
312 3300046475 Ga0495639_0554051 Ga0495639_0554051_89_571 160
313 3300047315 Ga0495581_0277459 Ga0495581_0277459_99_581 160
314 3300049586 Ga0501070_1086891 Ga0501070_1086891_90_572 160
315 3300049589 Ga0501073_0001571 Ga0501073_0001571_8805_9287 160
316 3300005719 Ga0068861_100251193 Ga0068861_1002511932 161
317 3300006237 Ga0097621_100599083 Ga0097621_1005990832 161
318 3300006358 Ga0068871_101258514 Ga0068871_1012585141 161
319 3300006880 Ga0075429_100453403 Ga0075429_1004534031 161
320 3300036712 Ga0316584_0229722 Ga0316584_0229722_831_1316 161
321 3300046516 Ga0495628_0283034 Ga0495628_0283034_553_1041 161
322 3300050508 nmdc:mga09592_694354_c1 nmdc:mga09592_694354_c1_72_557 161
323 3300005334 Ga0068869_100063718 Ga0068869_1000637183 162
324 3300005336 Ga0070680_100333559 Ga0070680_1003335592 162
325 3300005338 Ga0068868_100190230 Ga0068868_1001902301 162
326 3300005340 Ga0070689_100029158 Ga0070689_1000291587 162
327 3300005341 Ga0070691_10060368 Ga0070691_100603682 162
328 3300005343 Ga0070687_100040518 Ga0070687_1000405182 162
329 3300005347 Ga0070668_100037422 Ga0070668_1000374222 162
330 3300005353 Ga0070669_100045261 Ga0070669_1000452614 162
331 3300005353 Ga0070669_100697335 Ga0070669_1006973351 162
332 3300005354 Ga0070675_100452689 Ga0070675_1004526892 162
333 3300005356 Ga0070674_100042003 Ga0070674_1000420032 162
334 3300005367 Ga0070667_100082113 Ga0070667_1000821134 162
335 3300005438 Ga0070701_10006464 Ga0070701_100064644 162
336 3300005441 Ga0070700_100062770 Ga0070700_1000627702 162
337 3300005455 Ga0070663_100037876 Ga0070663_1000378763 162
338 3300005543 Ga0070672_100464421 Ga0070672_1004644212 162
339 3300005544 Ga0070686_100063119 Ga0070686_1000631192 162
340 3300005548 Ga0070665_100219835 Ga0070665_1002198352 162
341 3300005549 Ga0070704_100842424 Ga0070704_1008424242 162
342 3300005564 Ga0070664_100166085 Ga0070664_1001660853 162
343 3300005577 Ga0068857_100407068 Ga0068857_1004070682 162
344 3300005578 Ga0068854_100033675 Ga0068854_1000336753 162
345 3300005615 Ga0070702_100131498 Ga0070702_1001314982 162
346 3300005617 Ga0068859_100006485 Ga0068859_1000064855 162
347 3300005718 Ga0068866_10009348 Ga0068866_100093482 162
348 3300005719 Ga0068861_100049632 Ga0068861_1000496324 162
349 3300005840 Ga0068870_10132430 Ga0068870_101324302 162
350 3300005841 Ga0068863_100212388 Ga0068863_1002123882 162
351 3300005842 Ga0068858_100034035 Ga0068858_1000340354 162
352 3300005843 Ga0068860_100029701 Ga0068860_1000297017 162
353 3300005844 Ga0068862_100822284 Ga0068862_1008222842 162
354 3300006173 Ga0070716_100343224 Ga0070716_1003432242 162
355 3300006237 Ga0097621_100290652 Ga0097621_1002906522 162
356 3300006358 Ga0068871_100209161 Ga0068871_1002091612 162
357 3300006881 Ga0068865_100007196 Ga0068865_1000071967 162
358 3300006931 Ga0097620_100006485 Ga0097620_10000648516 162
359 3300009098 Ga0105245_10154318 Ga0105245_101543182 162
360 3300009148 Ga0105243_10048068 Ga0105243_100480685 162
361 3300009177 Ga0105248_10129555 Ga0105248_101295552 162
362 3300009553 Ga0105249_10741254 Ga0105249_107412542 162
363 3300013308 Ga0157375_10141759 Ga0157375_101417592 162
364 3300014745 Ga0157377_10029340 Ga0157377_100293402 162
365 3300014969 Ga0157376_10539701 Ga0157376_105397012 162
366 3300025899 Ga0207642_10177927 Ga0207642_101779272 162
367 3300025903 Ga0207680_10536047 Ga0207680_105360472 162
368 3300025923 Ga0207681_10140874 Ga0207681_101408742 162
369 3300025923 Ga0207681_10141334 Ga0207681_101413342 162
370 3300025933 Ga0207706_10057099 Ga0207706_100570992 162
371 3300025937 Ga0207669_10061268 Ga0207669_100612683 162
372 3300025938 Ga0207704_10016704 Ga0207704_100167042 162
373 3300025940 Ga0207691_10129122 Ga0207691_101291223 162
374 3300025942 Ga0207689_10023053 Ga0207689_100230537 162
375 3300025945 Ga0207679_10365875 Ga0207679_103658752 162
376 3300025981 Ga0207640_10574974 Ga0207640_105749742 162
377 3300025986 Ga0207658_10037525 Ga0207658_100375252 162
378 3300026023 Ga0207677_10028768 Ga0207677_100287682 162
379 3300026035 Ga0207703_10051202 Ga0207703_100512027 162
380 3300026075 Ga0207708_10051601 Ga0207708_100516013 162
381 3300026088 Ga0207641_10024080 Ga0207641_100240802 162
382 3300026089 Ga0207648_10029086 Ga0207648_100290867 162
383 3300026095 Ga0207676_10461878 Ga0207676_104618782 162
384 3300026116 Ga0207674_10672682 Ga0207674_106726822 162
385 3300026118 Ga0207675_100023087 Ga0207675_1000230877 162
386 3300026121 Ga0207683_10106774 Ga0207683_101067742 162
387 3300028381 Ga0268264_10273356 Ga0268264_102733562 162
388 3300031691 Ga0316579_10008919 Ga0316579_100089193 162
389 3300031728 Ga0316578_10000028 Ga0316578_100000285 162
390 3300032139 Ga0316580_10005824 Ga0316580_100058244 162
391 3300035691 Ga0373931_0036839 Ga0373931_0036839_665_1153 162
392 3300036647 Ga0316582_0448326 Ga0316582_0448326_198_689 162
393 3300036712 Ga0316584_0001573 Ga0316584_0001573_5467_5958 162
394 3300037588 Ga0316581_0000750 Ga0316581_0000750_3472_3963 162
395 3300044684 Ga0466966_0009512 Ga0466966_0009512_5895_6383 162
396 3300044693 Ga0466961_0011894 Ga0466961_0011894_1414_1902 162
397 3300044706 Ga0466964_0000540 Ga0466964_0000540_8010_8498 162
398 3300044712 Ga0453684_1140159 Ga0453684_1140159_44_532 162
399 3300044719 Ga0466971_0000526 Ga0466971_0000526_13404_13892 162
400 3300044735 Ga0466968_0005795 Ga0466968_0005795_659_1147 162
401 3300044842 Ga0466957_0013473 Ga0466957_0013473_2742_3230 162
402 3300045049 Ga0466959_0025213 Ga0466959_0025213_3736_4224 162
403 3300045051 Ga0451576_0306990 Ga0451576_0306990_423_911 162
404 3300045836 Ga0466958_0041528 Ga0466958_0041528_217_705 162
405 3300049823 Ga0501044_0836160 Ga0501044_0836160_254_745 162
406 3300061719 Ga0466962_0009122 Ga0466962_0009122_3904_4392 162
407 3300005365 Ga0070688_100472534 Ga0070688_1004725342 163
408 3300025920 Ga0207649_10244724 Ga0207649_102447243 163
409 3300041443 Ga0451789_0858393 Ga0451789_0858393_45_542 163
410 3300041453 Ga0451797_0660528 Ga0451797_0660528_343_840 163
411 3300041486 Ga0451807_0717071 Ga0451807_0717071_245_742 163
412 3300041486 Ga0451807_1974645 Ga0451807_1974645_128_625 163
413 3300041509 Ga0451843_0622708 Ga0451843_0622708_653_1150 163
414 3300005329 Ga0070683_100715545 Ga0070683_1007155452 164
415 3300005337 Ga0070682_100000004 Ga0070682_10000000422 164
416 3300005340 Ga0070689_100004116 Ga0070689_10000411615 164
417 3300005364 Ga0070673_100036870 Ga0070673_1000368704 164
418 3300005441 Ga0070700_100000023 Ga0070700_10000002320 164
419 3300005471 Ga0070698_100058912 Ga0070698_1000589124 164
420 3300005840 Ga0068870_10191430 Ga0068870_101914301 164
421 3300005842 Ga0068858_100000126 Ga0068858_10000012666 164
422 3300007076 Ga0075435_101018430 Ga0075435_1010184302 164
423 3300009098 Ga0105245_10025088 Ga0105245_100250882 164
424 3300009147 Ga0114129_10308809 Ga0114129_103088093 164
425 3300009147 Ga0114129_10901323 Ga0114129_109013232 164
426 3300009176 Ga0105242_10006488 Ga0105242_100064882 164
427 3300013297 Ga0157378_10033701 Ga0157378_100337012 164
428 3300013297 Ga0157378_10112940 Ga0157378_101129403 164
429 3300014745 Ga0157377_10000370 Ga0157377_1000037018 164
430 3300014968 Ga0157379_10986586 Ga0157379_109865862 164
431 3300021384 Ga0213876_10453038 Ga0213876_104530382 164
432 3300025927 Ga0207687_10029174 Ga0207687_100291742 164
433 3300025934 Ga0207686_10005807 Ga0207686_100058072 164
434 3300025936 Ga0207670_10001935 Ga0207670_1000193518 164
435 3300025936 Ga0207670_10496975 Ga0207670_104969752 164
436 3300025939 Ga0207665_10285094 Ga0207665_102850942 164
437 3300025960 Ga0207651_10005368 Ga0207651_100053688 164
438 3300026035 Ga0207703_10000653 Ga0207703_1000065320 164
439 3300031901 Ga0307406_11118641 Ga0307406_111186412 164
440 3300050507 nmdc:mga05p37_1386572_c1 nmdc:mga05p37_1386572_c1_56_556 164
441 iso_pu_bacteria 2596583598 2597032308 164
442 3300005365 Ga0070688_100569937 Ga0070688_1005699372 166
443 3300025918 Ga0207662_10036229 Ga0207662_100362293 166
444 3300002705 JGI25156J39149_1002962 JGI25156J39149_10029623 168
445 3300002738 JGI25154J39366_1002233 JGI25154J39366_10022332 168
446 3300003751 Ga0055538_1003408 Ga0055538_10034082 168
447 3300003756 Ga0055533_1002564 Ga0055533_10025644 168
448 3300003762 Ga0055542_1000961 Ga0055542_10009614 168
449 3300003841 Ga0055541_1001800 Ga0055541_10018004 168
450 3300005366 Ga0070659_100008608 Ga0070659_1000086084 168
451 3300009093 Ga0105240_10329382 Ga0105240_103293823 168
452 3300013100 Ga0157373_10404748 Ga0157373_104047482 168
453 3300015262 Ga0182007_10005838 Ga0182007_100058385 168
454 3300025224 Ga0209784_100445 Ga0209784_1004455 168
455 3300025225 Ga0209566_100540 Ga0209566_10054020 168
456 3300025226 Ga0209674_100239 Ga0209674_10023911 168
457 3300025246 Ga0209646_1000019 Ga0209646_100001957 168
458 3300025250 Ga0209026_1001789 Ga0209026_10017895 168
459 3300025253 Ga0209677_109649 Ga0209677_1096492 168
460 3300025254 Ga0209148_1000193 Ga0209148_100019328 168
461 3300025256 Ga0209759_1007353 Ga0209759_10073534 168
462 3300025911 Ga0207654_10367812 Ga0207654_103678122 168
463 3300025913 Ga0207695_10002741 Ga0207695_100027419 168
464 3300025932 Ga0207690_10043033 Ga0207690_100430334 168
465 3300044650 Ga0466986_0041101 Ga0466986_0041101_1725_2231 168
466 3300044656 Ga0466969_0110339 Ga0466969_0110339_488_994 168
467 3300044658 Ga0466972_0008336 Ga0466972_0008336_3502_4008 168
468 3300044671 Ga0466978_0053880 Ga0466978_0053880_1129_1635 168
469 3300044683 Ga0466965_0025797 Ga0466965_0025797_689_1195 168
470 3300044693 Ga0466961_0000202 Ga0466961_0000202_3527_4033 168
471 3300044694 Ga0466963_0135831 Ga0466963_0135831_925_1431 168
472 3300044706 Ga0466964_0002827 Ga0466964_0002827_2248_2754 168
473 3300044735 Ga0466968_0027309 Ga0466968_0027309_1482_1988 168
474 3300044765 Ga0466970_0023594 Ga0466970_0023594_1654_2160 168
475 3300044842 Ga0466957_0022269 Ga0466957_0022269_241_747 168
476 3300045049 Ga0466959_0019887 Ga0466959_0019887_1507_2013 168
477 3300045976 Ga0466967_0682779 Ga0466967_0682779_489_995 168
478 3300048928 Ga0496125_0053414 Ga0496125_0053414_782_1288 168
479 3300061719 Ga0466962_0085106 Ga0466962_0085106_924_1430 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

34

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l12-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9981 4 161
5l12-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9977 4 161
3mbm-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytosine and fol fragment 717, imidazo[2,1-b][1,3]thiazol-6-ylmethanol 0.997 4 161
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.9966 4 162
3ieq-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine 0.9965 4 161
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9831 4 162 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.971 4 162 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9705 6 162 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9661 6 161 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9643 5 164 3.30.1330.50
ID Description Score Start End GO Terms
AF-B3QV82-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 1 7 162 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1X0TGZ5-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9997 6 162 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1C5XT00-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.999 6 159 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518
AF-A0A2G6J275-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.9988 6 159 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518
AF-F6B567-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9985 7 162 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.21 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map