F451977

General Info

Members Datasets Scaffolds Average Seq Length
479 189 958 125

Family's Representative Sequence

Representative Sequence 3300001976|JGI24752J21851_1013268|JGI24752J21851_10132681
Length 154
Sequence MTLAGEHAGGSRAASSRHFSGCKGFTACHPDSVNYIIGMSMLPVSAKIPTARYGIGEMVRHRLLDFRGVIFDVDPEFANSDEWYEAIPEAMRPAKDQPFYHLLAENAESSYVAYVSQQNLVADXEGEPIDHPAIGTLFEGFDGQRYKLKPEHRH

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
180 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
185 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
186 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
187 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1013268 3300001976 Bacteria 1076
2 JGI24740J21852_10012080 3300001979 Bacteria 3264
3 JGI24737J22298_10048800 3300001990 Bacteria 1288
4 JGI24737J22298_10121001 3300001990 Bacteria 773
5 JGI24743J22301_10065132 3300001991 Bacteria 754
6 JGI24735J21928_10008939 3300002067 Bacteria 3231
7 JGI24033J26618_1019751 3300002155 Bacteria 855
8 JGI24034J26672_10013728 3300002239 Bacteria 1231
9 JGI24742J22300_10015850 3300002244 Bacteria 1269
10 Ga0065712_10769388 3300005290 Bacteria 522
11 Ga0070658_10209009 3300005327 Bacteria 1648
12 Ga0070658_11392976 3300005327 Bacteria 608
13 Ga0070676_10241941 3300005328 Bacteria 1200
14 Ga0070683_100004397 3300005329 Bacteria 11603
15 Ga0070683_100040142 3300005329 Bacteria 4301
16 Ga0070683_100110630 3300005329 Bacteria 2591
17 Ga0070683_100669820 3300005329 Bacteria 993
18 Ga0070690_100287213 3300005330 Bacteria 1175
19 Ga0070670_100023925 3300005331 Bacteria 5255
20 Ga0070670_100024885 3300005331 Bacteria 5150
21 Ga0070670_100758756 3300005331 Bacteria 874
22 Ga0070677_10611872 3300005333 Bacteria 604
23 Ga0070666_10001345 3300005335 Bacteria 14906
24 Ga0070666_10242545 3300005335 Bacteria 1274
25 Ga0070680_100111596 3300005336 Bacteria 2276
26 Ga0070680_100600587 3300005336 Bacteria 944
27 Ga0070682_100010870 3300005337 Bacteria 5181
28 Ga0070660_100003459 3300005339 Bacteria 10870
29 Ga0070660_100137336 3300005339 Bacteria 1959
30 Ga0070660_100208845 3300005339 Bacteria 1584
31 Ga0070660_101045352 3300005339 Bacteria 690
32 Ga0070660_101066291 3300005339 Bacteria 683
33 Ga0070660_101282342 3300005339 Bacteria 621
34 Ga0070689_100450916 3300005340 Bacteria 1094
35 Ga0070691_10001271 3300005341 Bacteria 10654
36 Ga0070661_100026154 3300005344 Bacteria 4195
37 Ga0070661_100097649 3300005344 Bacteria 2181
38 Ga0070692_10011897 3300005345 Bacteria 4012
39 Ga0070692_10014491 3300005345 Bacteria 3705
40 Ga0070668_100095650 3300005347 Bacteria 2347
41 Ga0070671_100009295 3300005355 Bacteria 7893
42 Ga0070671_100050754 3300005355 Bacteria 3450
43 Ga0070674_100001328 3300005356 Bacteria 13027
44 Ga0070674_100263028 3300005356 Bacteria 1360
45 Ga0070674_100739143 3300005356 Bacteria 844
46 Ga0070673_100334266 3300005364 Bacteria 1341
47 Ga0070659_100030281 3300005366 Bacteria 4188
48 Ga0070659_100050419 3300005366 Bacteria 3272
49 Ga0070659_100288010 3300005366 Bacteria 1367
50 Ga0070659_100299068 3300005366 Bacteria 1341
51 Ga0070667_100768051 3300005367 Bacteria 894
52 Ga0070714_100051428 3300005435 Bacteria 3512
53 Ga0070663_100165445 3300005455 Bacteria 1705
54 Ga0070663_100286021 3300005455 Bacteria 1315
55 Ga0070663_100286870 3300005455 Bacteria 1313
56 Ga0070663_100391103 3300005455 Bacteria 1134
57 Ga0070663_100727485 3300005455 Bacteria 845
58 Ga0070678_100239124 3300005456 Bacteria 1518
59 Ga0070662_100007666 3300005457 Bacteria 7001
60 Ga0070662_100021549 3300005457 Bacteria 4401
61 Ga0070662_100133736 3300005457 Bacteria 1915
62 Ga0070662_100434553 3300005457 Bacteria 1088
63 Ga0070662_100655823 3300005457 Bacteria 885
64 Ga0070681_10690211 3300005458 Bacteria 936
65 Ga0070681_11554703 3300005458 Bacteria 586
66 Ga0068867_100677612 3300005459 Bacteria 907
67 Ga0070685_10944656 3300005466 Bacteria 644
68 Ga0070679_100053823 3300005530 Bacteria 4006
69 Ga0070679_100988106 3300005530 Bacteria 786
70 Ga0070679_101041661 3300005530 Bacteria 762
71 Ga0070684_100123251 3300005535 Bacteria 2333
72 Ga0070684_100239837 3300005535 Bacteria 1656
73 Ga0070684_101614964 3300005535 Bacteria 611
74 Ga0068853_100182891 3300005539 Bacteria 1901
75 Ga0068853_100187039 3300005539 Bacteria 1880
76 Ga0068853_100336127 3300005539 Bacteria 1403
77 Ga0068853_101427898 3300005539 Bacteria 669
78 Ga0070672_100042039 3300005543 Bacteria 3517
79 Ga0070672_100605521 3300005543 Bacteria 954
80 Ga0070672_101900764 3300005543 Bacteria 536
81 Ga0070686_101480745 3300005544 Bacteria 571
82 Ga0070693_100021678 3300005547 Bacteria 3405
83 Ga0070665_100047936 3300005548 Bacteria 4289
84 Ga0070665_102565631 3300005548 Bacteria 511
85 Ga0068855_100084297 3300005563 Bacteria 3680
86 Ga0068855_100606032 3300005563 Bacteria 1180
87 Ga0068855_102096185 3300005563 Bacteria 569
88 Ga0070664_100031184 3300005564 Bacteria 4451
89 Ga0070664_100108145 3300005564 Bacteria 2424
90 Ga0070664_101055452 3300005564 Bacteria 764
91 Ga0070664_101227133 3300005564 Bacteria 708
92 Ga0068857_100224024 3300005577 Bacteria 1718
93 Ga0068857_100238742 3300005577 Bacteria 1663
94 Ga0068857_100919255 3300005577 Bacteria 839
95 Ga0068857_101122885 3300005577 Bacteria 759
96 Ga0068854_100044068 3300005578 Bacteria 3165
97 Ga0068854_100256087 3300005578 Bacteria 1399
98 Ga0068854_100281406 3300005578 Bacteria 1339
99 Ga0068854_100634146 3300005578 Bacteria 916
100 Ga0068854_101549935 3300005578 Bacteria 603
101 Ga0068856_100291653 3300005614 Bacteria 1648
102 Ga0068856_100444356 3300005614 Bacteria 1317
103 Ga0068856_101442050 3300005614 Bacteria 703
104 Ga0068856_101704766 3300005614 Bacteria 642
105 Ga0068852_100001401 3300005616 Bacteria 16228
106 Ga0068852_100167421 3300005616 Bacteria 2057
107 Ga0068852_100577694 3300005616 Bacteria 1126
108 Ga0068852_101402957 3300005616 Bacteria 720
109 Ga0068859_100156604 3300005617 Bacteria 2355
110 Ga0068864_100001679 3300005618 Bacteria 18210
111 Ga0068864_100066129 3300005618 Bacteria 3137
112 Ga0068851_10498983 3300005834 Bacteria 730
113 Ga0068870_10063755 3300005840 Bacteria 1988
114 Ga0068870_11165066 3300005840 Bacteria 557
115 Ga0068863_100250271 3300005841 Bacteria 1711
116 Ga0068858_100004811 3300005842 Bacteria 13231
117 Ga0068858_101277753 3300005842 Bacteria 722
118 Ga0068862_100014936 3300005844 Bacteria 6450
119 Ga0068865_100279022 3300006881 Bacteria 1330
120 Ga0097620_100156610 3300006931 Bacteria 2355
121 Ga0105240_10064179 3300009093 Bacteria 4564
122 Ga0105240_11611351 3300009093 Bacteria 679
123 Ga0105240_12316616 3300009093 Bacteria 556
124 Ga0105243_10006820 3300009148 Bacteria 8803
125 Ga0105243_10134369 3300009148 Bacteria 2103
126 Ga0105241_10189032 3300009174 Bacteria 1713
127 Ga0105241_11073153 3300009174 Bacteria 757
128 Ga0105248_10003813 3300009177 Bacteria 16715
129 Ga0105248_10007459 3300009177 Bacteria 12000
130 Ga0105248_10155626 3300009177 Bacteria 2579
131 Ga0105237_10104445 3300009545 Bacteria 2825
132 Ga0105237_12045061 3300009545 Bacteria 582
133 Ga0105238_10031752 3300009551 Bacteria 5374
134 Ga0105238_11101285 3300009551 Bacteria 817
135 Ga0105249_10244877 3300009553 Bacteria 1774
136 Ga0105239_10363617 3300010375 Bacteria 1634
137 Ga0105239_10372387 3300010375 Bacteria 1614
138 Ga0157373_10009328 3300013100 Bacteria 7252
139 Ga0157373_10015994 3300013100 Bacteria 5477
140 Ga0157373_10027660 3300013100 Bacteria 4091
141 Ga0157373_10070251 3300013100 Bacteria 2475
142 Ga0157373_10840342 3300013100 Bacteria 679
143 Ga0157373_11045474 3300013100 Bacteria 611
144 Ga0157371_10023874 3300013102 Bacteria 4469
145 Ga0157371_10055901 3300013102 Bacteria 2799
146 Ga0157371_10144217 3300013102 Bacteria 1696
147 Ga0157371_10186602 3300013102 Bacteria 1484
148 Ga0157371_10216959 3300013102 Bacteria 1374
149 Ga0157371_10224944 3300013102 Bacteria 1348
150 Ga0157371_10947297 3300013102 Bacteria 655
151 Ga0157370_10211218 3300013104 Bacteria 1799
152 Ga0157370_10224763 3300013104 Bacteria 1738
153 Ga0157370_10254307 3300013104 Bacteria 1625
154 Ga0157370_11494499 3300013104 Bacteria 607
155 Ga0157369_10012875 3300013105 Bacteria 9482
156 Ga0157369_10122996 3300013105 Bacteria 2752
157 Ga0157369_10161229 3300013105 Bacteria 2367
158 Ga0157369_10197296 3300013105 Bacteria 2113
159 Ga0157369_10981414 3300013105 Bacteria 865
160 Ga0157369_11404566 3300013105 Bacteria 711
161 Ga0157378_11536517 3300013297 Bacteria 711
162 Ga0157378_11677674 3300013297 Bacteria 682
163 Ga0157378_12191177 3300013297 Bacteria 604
164 Ga0163162_12087966 3300013306 Bacteria 650
165 Ga0157372_10101927 3300013307 Bacteria 3278
166 Ga0157372_10532874 3300013307 Bacteria 1369
167 Ga0157372_11400023 3300013307 Bacteria 806
168 Ga0157372_11538981 3300013307 Bacteria 766
169 Ga0163163_10172863 3300014325 Bacteria 2207
170 Ga0157380_10041906 3300014326 Bacteria 3575
171 Ga0163161_10372113 3300017792 Bacteria 1140
172 Ga0206353_11156886 3300020082 Bacteria 678
173 Ga0224712_10007886 3300022467 Bacteria 3122
174 Ga0207682_10035834 3300025893 Bacteria 2006
175 Ga0207688_10012950 3300025901 Bacteria 4533
176 Ga0207688_10254978 3300025901 Bacteria 1063
177 Ga0207688_10681534 3300025901 Bacteria 650
178 Ga0207680_10002269 3300025903 Bacteria 8959
179 Ga0207680_10453484 3300025903 Bacteria 910
180 Ga0207680_11036718 3300025903 Bacteria 587
181 Ga0207680_11037272 3300025903 Bacteria 587
182 Ga0207647_10010701 3300025904 Bacteria 6462
183 Ga0207647_10016182 3300025904 Bacteria 5091
184 Ga0207647_10022996 3300025904 Bacteria 4132
185 Ga0207647_10036856 3300025904 Bacteria 3105
186 Ga0207647_10190632 3300025904 Bacteria 1188
187 Ga0207647_10558154 3300025904 Bacteria 635
188 Ga0207645_10087036 3300025907 Bacteria 2007
189 Ga0207643_10023915 3300025908 Bacteria 3371
190 Ga0207705_10000033 3300025909 Bacteria 223997
191 Ga0207705_10002340 3300025909 Bacteria 14652
192 Ga0207705_10017972 3300025909 Bacteria 5057
193 Ga0207705_10023973 3300025909 Bacteria 4354
194 Ga0207705_10024631 3300025909 Bacteria 4294
195 Ga0207705_10034348 3300025909 Bacteria 3625
196 Ga0207705_10853088 3300025909 Bacteria 706
197 Ga0207654_10331568 3300025911 Bacteria 1043
198 Ga0207707_10035668 3300025912 Bacteria 4349
199 Ga0207707_11204912 3300025912 Bacteria 613
200 Ga0207695_10038620 3300025913 Bacteria 5138
201 Ga0207695_10163828 3300025913 Bacteria 2153
202 Ga0207671_10125186 3300025914 Bacteria 1968
203 Ga0207660_10055151 3300025917 Bacteria 2839
204 Ga0207660_10079645 3300025917 Bacteria 2403
205 Ga0207660_10198198 3300025917 Bacteria 1567
206 Ga0207657_10000088 3300025919 Bacteria 88065
207 Ga0207657_10004712 3300025919 Bacteria 14390
208 Ga0207657_10036683 3300025919 Bacteria 4386
209 Ga0207657_10166607 3300025919 Bacteria 1787
210 Ga0207657_10302090 3300025919 Bacteria 1268
211 Ga0207657_10356497 3300025919 Bacteria 1153
212 Ga0207657_10741225 3300025919 Bacteria 761
213 Ga0207649_10029952 3300025920 Bacteria 3218
214 Ga0207649_10077303 3300025920 Bacteria 2144
215 Ga0207649_10533980 3300025920 Bacteria 896
216 Ga0207652_10137674 3300025921 Bacteria 2181
217 Ga0207652_10406600 3300025921 Bacteria 1228
218 Ga0207652_10869284 3300025921 Bacteria 798
219 Ga0207681_10112057 3300025923 Bacteria 1986
220 Ga0207694_10040255 3300025924 Bacteria 3597
221 Ga0207650_10196661 3300025925 Bacteria 1613
222 Ga0207650_10540684 3300025925 Bacteria 976
223 Ga0207650_10595286 3300025925 Bacteria 930
224 Ga0207650_11263653 3300025925 Bacteria 628
225 Ga0207650_11423100 3300025925 Bacteria 590
226 Ga0207644_10002962 3300025931 Bacteria 10936
227 Ga0207644_10354865 3300025931 Bacteria 1191
228 Ga0207690_10004362 3300025932 Bacteria 8352
229 Ga0207690_10005050 3300025932 Bacteria 7791
230 Ga0207690_10009605 3300025932 Bacteria 5744
231 Ga0207690_10276945 3300025932 Bacteria 1305
232 Ga0207690_10551858 3300025932 Bacteria 937
233 Ga0207690_10721733 3300025932 Bacteria 820
234 Ga0207690_10998157 3300025932 Bacteria 696
235 Ga0207706_10001436 3300025933 Bacteria 23850
236 Ga0207706_10010618 3300025933 Bacteria 8413
237 Ga0207706_10192762 3300025933 Bacteria 1788
238 Ga0207706_10257345 3300025933 Bacteria 1524
239 Ga0207706_10358852 3300025933 Bacteria 1266
240 Ga0207706_10385861 3300025933 Bacteria 1215
241 Ga0207706_10888802 3300025933 Bacteria 753
242 Ga0207686_11215481 3300025934 Bacteria 617
243 Ga0207670_10386677 3300025936 Bacteria 1116
244 Ga0207669_10011993 3300025937 Bacteria 4243
245 Ga0207704_10422432 3300025938 Bacteria 1057
246 Ga0207704_10789368 3300025938 Bacteria 792
247 Ga0207691_10037481 3300025940 Bacteria 4490
248 Ga0207691_10734440 3300025940 Bacteria 832
249 Ga0207711_10001655 3300025941 Bacteria 20553
250 Ga0207711_10020611 3300025941 Bacteria 5501
251 Ga0207661_10045438 3300025944 Bacteria 3476
252 Ga0207661_10100745 3300025944 Bacteria 2425
253 Ga0207661_10108627 3300025944 Bacteria 2342
254 Ga0207661_10257817 3300025944 Bacteria 1552
255 Ga0207661_10596770 3300025944 Bacteria 1013
256 Ga0207679_10006623 3300025945 Bacteria 7329
257 Ga0207679_10113856 3300025945 Bacteria 2141
258 Ga0207679_10292270 3300025945 Bacteria 1401
259 Ga0207679_10554716 3300025945 Bacteria 1031
260 Ga0207679_10891928 3300025945 Bacteria 813
261 Ga0207667_10008097 3300025949 Bacteria 12529
262 Ga0207667_10074317 3300025949 Bacteria 3531
263 Ga0207667_10289931 3300025949 Bacteria 1672
264 Ga0207667_10741339 3300025949 Bacteria 982
265 Ga0207651_10224963 3300025960 Bacteria 1519
266 Ga0207651_10281125 3300025960 Bacteria 1375
267 Ga0207640_10010432 3300025981 Bacteria 5234
268 Ga0207640_11034909 3300025981 Bacteria 724
269 Ga0207640_11291653 3300025981 Bacteria 651
270 Ga0207658_10017304 3300025986 Bacteria 4965
271 Ga0207658_10059608 3300025986 Bacteria 2845
272 Ga0207658_10929735 3300025986 Bacteria 792
273 Ga0207677_10013786 3300026023 Bacteria 4694
274 Ga0207703_10003778 3300026035 Bacteria 12587
275 Ga0207703_11862788 3300026035 Bacteria 578
276 Ga0207639_10004082 3300026041 Bacteria 9850
277 Ga0207639_10224852 3300026041 Bacteria 1623
278 Ga0207639_11147121 3300026041 Bacteria 729
279 Ga0207639_11440161 3300026041 Bacteria 647
280 Ga0207678_10030112 3300026067 Bacteria 4739
281 Ga0207678_10039363 3300026067 Bacteria 4104
282 Ga0207678_10087904 3300026067 Bacteria 2656
283 Ga0207678_10127219 3300026067 Bacteria 2173
284 Ga0207678_10273222 3300026067 Bacteria 1450
285 Ga0207678_10984236 3300026067 Bacteria 746
286 Ga0207708_10206377 3300026075 Bacteria 1569
287 Ga0207702_10014106 3300026078 Bacteria 6636
288 Ga0207702_10016642 3300026078 Bacteria 6086
289 Ga0207702_10042129 3300026078 Bacteria 3829
290 Ga0207702_10115747 3300026078 Bacteria 2391
291 Ga0207641_10071086 3300026088 Bacteria 2992
292 Ga0207648_10246754 3300026089 Bacteria 1591
293 Ga0207676_10054464 3300026095 Bacteria 3135
294 Ga0207676_11065156 3300026095 Bacteria 798
295 Ga0207674_10000638 3300026116 Bacteria 45617
296 Ga0207674_10004818 3300026116 Bacteria 16165
297 Ga0207674_10079734 3300026116 Bacteria 3277
298 Ga0207683_10099012 3300026121 Bacteria 2602
299 Ga0207698_10003797 3300026142 Bacteria 9137
300 Ga0207698_10007133 3300026142 Bacteria 6998
301 Ga0207698_10183477 3300026142 Bacteria 1856
302 Ga0207698_10353765 3300026142 Bacteria 1388
303 Ga0207698_10356794 3300026142 Bacteria 1383
304 Ga0207698_10786430 3300026142 Bacteria 953
305 Ga0209974_10175442 3300027876 Bacteria 783
306 Ga0207428_10663402 3300027907 Bacteria 748
307 Ga0268266_10048798 3300028379 Bacteria 3629
308 Ga0268266_11814877 3300028379 Bacteria 584
309 Ga0316177_1172957 3300030731 Bacteria 522
310 Ga0307408_100069056 3300031548 Bacteria 2604
311 Ga0307408_100139169 3300031548 Bacteria 1903
312 Ga0307408_101067669 3300031548 Bacteria 747
313 Ga0307405_10009922 3300031731 Bacteria 4904
314 Ga0307405_10025316 3300031731 Bacteria 3404
315 Ga0307405_10733599 3300031731 Bacteria 821
316 Ga0307405_11510647 3300031731 Bacteria 590
317 Ga0307413_10005320 3300031824 Bacteria 5729
318 Ga0307413_10053647 3300031824 Bacteria 2441
319 Ga0307413_10272851 3300031824 Bacteria 1267
320 Ga0307413_10306008 3300031824 Bacteria 1207
321 Ga0307410_10005204 3300031852 Bacteria 6854
322 Ga0307410_10007105 3300031852 Bacteria 6106
323 Ga0307410_10011558 3300031852 Bacteria 5054
324 Ga0307410_10116806 3300031852 Bacteria 1939
325 Ga0307410_10149248 3300031852 Bacteria 1738
326 Ga0307406_10035483 3300031901 Bacteria 3067
327 Ga0307406_10080452 3300031901 Bacteria 2163
328 Ga0307407_10009376 3300031903 Bacteria 4555
329 Ga0307407_10022925 3300031903 Bacteria 3248
330 Ga0307407_10148087 3300031903 Bacteria 1522
331 Ga0307407_10331365 3300031903 Bacteria 1071
332 Ga0307412_10019962 3300031911 Bacteria 4069
333 Ga0307412_10123312 3300031911 Bacteria 1869
334 Ga0307412_10549891 3300031911 Bacteria 969
335 Ga0307412_10815757 3300031911 Bacteria 811
336 Ga0307409_100023148 3300031995 Bacteria 4297
337 Ga0307409_100023250 3300031995 Bacteria 4290
338 Ga0307409_100286936 3300031995 Bacteria 1524
339 Ga0307409_101204924 3300031995 Bacteria 780
340 Ga0307409_101719577 3300031995 Bacteria 656
341 Ga0307409_101942904 3300031995 Bacteria 618
342 Ga0307409_102434517 3300031995 Bacteria 552
343 Ga0307416_100018556 3300032002 Bacteria 4904
344 Ga0307416_100081251 3300032002 Bacteria 2739
345 Ga0307416_100161381 3300032002 Bacteria 2072
346 Ga0307416_100549648 3300032002 Bacteria 1228
347 Ga0307416_101850575 3300032002 Bacteria 707
348 Ga0307416_103325895 3300032002 Bacteria 538
349 Ga0307414_10009558 3300032004 Bacteria 5579
350 Ga0307414_10015765 3300032004 Bacteria 4572
351 Ga0307414_10238759 3300032004 Bacteria 1503
352 Ga0307414_10276227 3300032004 Bacteria 1409
353 Ga0307414_10479660 3300032004 Bacteria 1096
354 Ga0307411_10010289 3300032005 Bacteria 4976
355 Ga0307411_10019181 3300032005 Bacteria 3944
356 Ga0307411_10113673 3300032005 Bacteria 1943
357 Ga0307411_10142620 3300032005 Bacteria 1768
358 Ga0307411_10280165 3300032005 Bacteria 1326
359 Ga0307411_10383578 3300032005 Bacteria 1156
360 Ga0307415_100015451 3300032126 Bacteria 4521
361 Ga0307415_100037878 3300032126 Bacteria 3173
362 Ga0307415_100279234 3300032126 Bacteria 1372
363 Ga0395899_0000230 3300037312 Bacteria 76090
364 Ga0395899_0008689 3300037312 Bacteria 7820
365 Ga0395899_0049260 3300037312 Bacteria 3132
366 Ga0395899_0057177 3300037312 Bacteria 2880
367 Ga0395899_0057751 3300037312 Bacteria 2863
368 Ga0395899_0111942 3300037312 Bacteria 1961
369 Ga0395899_0112789 3300037312 Bacteria 1953
370 Ga0395900_0000124 3300037418 Bacteria 133210
371 Ga0395900_0000666 3300037418 Bacteria 45776
372 Ga0395900_0004212 3300037418 Bacteria 15265
373 Ga0395900_0030307 3300037418 Bacteria 5554
374 Ga0395900_0084123 3300037418 Bacteria 3268
375 Ga0395900_0123244 3300037418 Bacteria 2658
376 Ga0395900_0142182 3300037418 Bacteria 2456
377 Ga0395900_0169920 3300037418 Bacteria 2220
378 Ga0395900_0264523 3300037418 Bacteria 1716
379 Ga0395900_0398257 3300037418 Bacteria 1341
380 Ga0395900_0490996 3300037418 Bacteria 1179
381 Ga0395900_0515922 3300037418 Bacteria 1144
382 Ga0395900_1261293 3300037418 Bacteria 653
383 Ga0395898_0040267 3300037466 Bacteria 4621
384 Ga0395898_0061663 3300037466 Bacteria 3643
385 Ga0395898_0115041 3300037466 Bacteria 2577
386 Ga0395898_0346575 3300037466 Bacteria 1416
387 Ga0395898_0442669 3300037466 Bacteria 1238
388 Ga0395898_1012098 3300037466 Bacteria 766
389 Ga0395898_1015049 3300037466 Bacteria 765
390 Ga0395905_0011364 3300037471 Bacteria 8609
391 Ga0395905_0021132 3300037471 Bacteria 6162
392 Ga0395905_0021878 3300037471 Bacteria 6048
393 Ga0395905_0026980 3300037471 Bacteria 5416
394 Ga0395905_0031488 3300037471 Bacteria 4994
395 Ga0395905_0044052 3300037471 Bacteria 4187
396 Ga0395905_0067404 3300037471 Bacteria 3352
397 Ga0395905_0114121 3300037471 Bacteria 2538
398 Ga0395905_0131704 3300037471 Bacteria 2352
399 Ga0395905_0454175 3300037471 Bacteria 1179
400 Ga0395905_0625527 3300037471 Bacteria 978
401 Ga0395905_0868433 3300037471 Bacteria 805
402 Ga0395905_0887767 3300037471 Bacteria 794
403 Ga0395901_0000031 3300038443 Bacteria 241733
404 Ga0395901_0001383 3300038443 Bacteria 25376
405 Ga0395901_0031386 3300038443 Bacteria 5479
406 Ga0395901_0040437 3300038443 Bacteria 4830
407 Ga0395901_0075642 3300038443 Bacteria 3512
408 Ga0395901_0160825 3300038443 Bacteria 2358
409 Ga0395901_0161720 3300038443 Bacteria 2351
410 Ga0395901_0178274 3300038443 Bacteria 2228
411 Ga0395901_0186322 3300038443 Bacteria 2176
412 Ga0395901_0345886 3300038443 Bacteria 1535
413 Ga0395901_0548048 3300038443 Bacteria 1172
414 Ga0451802_0128336 3300041460 Bacteria 1082
415 Ga0439433_0153825 3300041999 Bacteria 593
416 Ga0439441_028666 3300042001 Bacteria 1068
417 Ga0439445_0037324 3300042004 Bacteria 1281
418 Ga0439432_005832 3300042006 Bacteria 4419
419 Ga0439432_118422 3300042006 Bacteria 785
420 Ga0439432_189271 3300042006 Bacteria 598
421 Ga0439449_0105488 3300042007 Bacteria 1043
422 Ga0439449_0255568 3300042007 Bacteria 659
423 Ga0466969_0002494 3300044656 Bacteria 9830
424 Ga0466965_0233189 3300044683 Bacteria 984
425 Ga0466966_0009373 3300044684 Bacteria 6480
426 Ga0466966_0060241 3300044684 Bacteria 2396
427 Ga0466961_0056290 3300044693 Bacteria 2505
428 Ga0466961_0106216 3300044693 Bacteria 1767
429 Ga0466963_0032317 3300044694 Bacteria 3388
430 Ga0466963_0119388 3300044694 Bacteria 1813
431 Ga0466963_0600101 3300044694 Bacteria 778
432 Ga0466964_0036494 3300044706 Bacteria 1971
433 Ga0466971_0037099 3300044719 Bacteria 2185
434 Ga0466970_0011799 3300044765 Bacteria 4456
435 Ga0466970_0161548 3300044765 Bacteria 1239
436 Ga0466957_0041477 3300044842 Bacteria 2783
437 Ga0466957_0414703 3300044842 Bacteria 923
438 Ga0466959_0021913 3300045049 Bacteria 4719
439 Ga0466959_0293213 3300045049 Bacteria 1115
440 Ga0466958_0000063 3300045836 Bacteria 32014
441 Ga0466958_0015557 3300045836 Bacteria 4362
442 Ga0466958_0171464 3300045836 Bacteria 1374
443 Ga0466958_0528138 3300045836 Bacteria 766
444 Ga0466967_0270214 3300045976 Bacteria 1629
445 Ga0466967_0276621 3300045976 Bacteria 1610
446 Ga0495642_0030731 3300046528 Bacteria 2150
447 Ga0495621_0010615 3300046539 Bacteria 2824
448 Ga0495633_0503003 3300046558 Bacteria 546
449 Ga0495669_0004330 3300046684 Bacteria 5858
450 Ga0495669_0368873 3300046684 Bacteria 694
451 Ga0495677_0004517 3300047445 Bacteria 5329
452 Ga0496100_0734258 3300048903 Bacteria 772
453 Ga0496102_0651898 3300048905 Bacteria 976
454 Ga0496103_0208450 3300048906 Bacteria 1257
455 Ga0496105_0293425 3300048908 Bacteria 1309
456 Ga0496105_0841836 3300048908 Bacteria 695
457 Ga0496107_0383402 3300048910 Bacteria 1046
458 Ga0496107_0565108 3300048910 Bacteria 842
459 Ga0496108_0004395 3300048911 Bacteria 11347
460 Ga0496108_0331775 3300048911 Bacteria 1327
461 Ga0496109_0002921 3300048912 Bacteria 14284
462 Ga0496110_0352626 3300048913 Bacteria 1340
463 Ga0496112_0107910 3300048915 Bacteria 2754
464 Ga0496113_0057949 3300048916 Bacteria 2913
465 Ga0501298_028561 3300049521 Bacteria 1083
466 Ga0501201_026725 3300049651 Bacteria 639
467 Ga0501223_063360 3300049663 Bacteria 724
468 Ga0501235_094615 3300049669 Bacteria 724
469 Ga0501258_022432 3300049687 Bacteria 751
470 Ga0501225_0026693 3300049705 Bacteria 1588
471 Ga0501267_061160 3300049764 Bacteria 509
472 Ga0501268_021840 3300049765 Bacteria 1101
473 Ga0501268_090223 3300049765 Bacteria 644
474 Ga0501270_004368 3300049767 Bacteria 1583
475 Ga0501270_156496 3300049767 Bacteria 523
476 Ga0501273_028295 3300049770 Bacteria 788
477 Ga0501273_075791 3300049770 Bacteria 552
478 nmdc:mga0rr50_462383_c1 3300050513 Bacteria 1076
479 Ga0466962_0000633 3300061719 Bacteria 15617
480 JGI24752J21851_1013268
481 JGI24740J21852_10012080
482 JGI24737J22298_10048800
483 JGI24737J22298_10121001
484 JGI24743J22301_10065132
485 JGI24735J21928_10008939
486 JGI24033J26618_1019751
487 JGI24034J26672_10013728
488 JGI24742J22300_10015850
489 Ga0065712_10769388
490 Ga0070658_10209009
491 Ga0070658_11392976
492 Ga0070676_10241941
493 Ga0070683_100004397
494 Ga0070683_100040142
495 Ga0070683_100110630
496 Ga0070683_100669820
497 Ga0070690_100287213
498 Ga0070670_100023925
499 Ga0070670_100024885
500 Ga0070670_100758756
501 Ga0070677_10611872
502 Ga0070666_10001345
503 Ga0070666_10242545
504 Ga0070680_100111596
505 Ga0070680_100600587
506 Ga0070682_100010870
507 Ga0070660_100003459
508 Ga0070660_100137336
509 Ga0070660_100208845
510 Ga0070660_101045352
511 Ga0070660_101066291
512 Ga0070660_101282342
513 Ga0070689_100450916
514 Ga0070691_10001271
515 Ga0070661_100026154
516 Ga0070661_100097649
517 Ga0070692_10011897
518 Ga0070692_10014491
519 Ga0070668_100095650
520 Ga0070671_100009295
521 Ga0070671_100050754
522 Ga0070674_100001328
523 Ga0070674_100263028
524 Ga0070674_100739143
525 Ga0070673_100334266
526 Ga0070659_100030281
527 Ga0070659_100050419
528 Ga0070659_100288010
529 Ga0070659_100299068
530 Ga0070667_100768051
531 Ga0070714_100051428
532 Ga0070663_100165445
533 Ga0070663_100286021
534 Ga0070663_100286870
535 Ga0070663_100391103
536 Ga0070663_100727485
537 Ga0070678_100239124
538 Ga0070662_100007666
539 Ga0070662_100021549
540 Ga0070662_100133736
541 Ga0070662_100434553
542 Ga0070662_100655823
543 Ga0070681_10690211
544 Ga0070681_11554703
545 Ga0068867_100677612
546 Ga0070685_10944656
547 Ga0070679_100053823
548 Ga0070679_100988106
549 Ga0070679_101041661
550 Ga0070684_100123251
551 Ga0070684_100239837
552 Ga0070684_101614964
553 Ga0068853_100182891
554 Ga0068853_100187039
555 Ga0068853_100336127
556 Ga0068853_101427898
557 Ga0070672_100042039
558 Ga0070672_100605521
559 Ga0070672_101900764
560 Ga0070686_101480745
561 Ga0070693_100021678
562 Ga0070665_100047936
563 Ga0070665_102565631
564 Ga0068855_100084297
565 Ga0068855_100606032
566 Ga0068855_102096185
567 Ga0070664_100031184
568 Ga0070664_100108145
569 Ga0070664_101055452
570 Ga0070664_101227133
571 Ga0068857_100224024
572 Ga0068857_100238742
573 Ga0068857_100919255
574 Ga0068857_101122885
575 Ga0068854_100044068
576 Ga0068854_100256087
577 Ga0068854_100281406
578 Ga0068854_100634146
579 Ga0068854_101549935
580 Ga0068856_100291653
581 Ga0068856_100444356
582 Ga0068856_101442050
583 Ga0068856_101704766
584 Ga0068852_100001401
585 Ga0068852_100167421
586 Ga0068852_100577694
587 Ga0068852_101402957
588 Ga0068859_100156604
589 Ga0068864_100001679
590 Ga0068864_100066129
591 Ga0068851_10498983
592 Ga0068870_10063755
593 Ga0068870_11165066
594 Ga0068863_100250271
595 Ga0068858_100004811
596 Ga0068858_101277753
597 Ga0068862_100014936
598 Ga0068865_100279022
599 Ga0097620_100156610
600 Ga0105240_10064179
601 Ga0105240_11611351
602 Ga0105240_12316616
603 Ga0105243_10006820
604 Ga0105243_10134369
605 Ga0105241_10189032
606 Ga0105241_11073153
607 Ga0105248_10003813
608 Ga0105248_10007459
609 Ga0105248_10155626
610 Ga0105237_10104445
611 Ga0105237_12045061
612 Ga0105238_10031752
613 Ga0105238_11101285
614 Ga0105249_10244877
615 Ga0105239_10363617
616 Ga0105239_10372387
617 Ga0157373_10009328
618 Ga0157373_10015994
619 Ga0157373_10027660
620 Ga0157373_10070251
621 Ga0157373_10840342
622 Ga0157373_11045474
623 Ga0157371_10023874
624 Ga0157371_10055901
625 Ga0157371_10144217
626 Ga0157371_10186602
627 Ga0157371_10216959
628 Ga0157371_10224944
629 Ga0157371_10947297
630 Ga0157370_10211218
631 Ga0157370_10224763
632 Ga0157370_10254307
633 Ga0157370_11494499
634 Ga0157369_10012875
635 Ga0157369_10122996
636 Ga0157369_10161229
637 Ga0157369_10197296
638 Ga0157369_10981414
639 Ga0157369_11404566
640 Ga0157378_11536517
641 Ga0157378_11677674
642 Ga0157378_12191177
643 Ga0163162_12087966
644 Ga0157372_10101927
645 Ga0157372_10532874
646 Ga0157372_11400023
647 Ga0157372_11538981
648 Ga0163163_10172863
649 Ga0157380_10041906
650 Ga0163161_10372113
651 Ga0206353_11156886
652 Ga0224712_10007886
653 Ga0207682_10035834
654 Ga0207688_10012950
655 Ga0207688_10254978
656 Ga0207688_10681534
657 Ga0207680_10002269
658 Ga0207680_10453484
659 Ga0207680_11036718
660 Ga0207680_11037272
661 Ga0207647_10010701
662 Ga0207647_10016182
663 Ga0207647_10022996
664 Ga0207647_10036856
665 Ga0207647_10190632
666 Ga0207647_10558154
667 Ga0207645_10087036
668 Ga0207643_10023915
669 Ga0207705_10000033
670 Ga0207705_10002340
671 Ga0207705_10017972
672 Ga0207705_10023973
673 Ga0207705_10024631
674 Ga0207705_10034348
675 Ga0207705_10853088
676 Ga0207654_10331568
677 Ga0207707_10035668
678 Ga0207707_11204912
679 Ga0207695_10038620
680 Ga0207695_10163828
681 Ga0207671_10125186
682 Ga0207660_10055151
683 Ga0207660_10079645
684 Ga0207660_10198198
685 Ga0207657_10000088
686 Ga0207657_10004712
687 Ga0207657_10036683
688 Ga0207657_10166607
689 Ga0207657_10302090
690 Ga0207657_10356497
691 Ga0207657_10741225
692 Ga0207649_10029952
693 Ga0207649_10077303
694 Ga0207649_10533980
695 Ga0207652_10137674
696 Ga0207652_10406600
697 Ga0207652_10869284
698 Ga0207681_10112057
699 Ga0207694_10040255
700 Ga0207650_10196661
701 Ga0207650_10540684
702 Ga0207650_10595286
703 Ga0207650_11263653
704 Ga0207650_11423100
705 Ga0207644_10002962
706 Ga0207644_10354865
707 Ga0207690_10004362
708 Ga0207690_10005050
709 Ga0207690_10009605
710 Ga0207690_10276945
711 Ga0207690_10551858
712 Ga0207690_10721733
713 Ga0207690_10998157
714 Ga0207706_10001436
715 Ga0207706_10010618
716 Ga0207706_10192762
717 Ga0207706_10257345
718 Ga0207706_10358852
719 Ga0207706_10385861
720 Ga0207706_10888802
721 Ga0207686_11215481
722 Ga0207670_10386677
723 Ga0207669_10011993
724 Ga0207704_10422432
725 Ga0207704_10789368
726 Ga0207691_10037481
727 Ga0207691_10734440
728 Ga0207711_10001655
729 Ga0207711_10020611
730 Ga0207661_10045438
731 Ga0207661_10100745
732 Ga0207661_10108627
733 Ga0207661_10257817
734 Ga0207661_10596770
735 Ga0207679_10006623
736 Ga0207679_10113856
737 Ga0207679_10292270
738 Ga0207679_10554716
739 Ga0207679_10891928
740 Ga0207667_10008097
741 Ga0207667_10074317
742 Ga0207667_10289931
743 Ga0207667_10741339
744 Ga0207651_10224963
745 Ga0207651_10281125
746 Ga0207640_10010432
747 Ga0207640_11034909
748 Ga0207640_11291653
749 Ga0207658_10017304
750 Ga0207658_10059608
751 Ga0207658_10929735
752 Ga0207677_10013786
753 Ga0207703_10003778
754 Ga0207703_11862788
755 Ga0207639_10004082
756 Ga0207639_10224852
757 Ga0207639_11147121
758 Ga0207639_11440161
759 Ga0207678_10030112
760 Ga0207678_10039363
761 Ga0207678_10087904
762 Ga0207678_10127219
763 Ga0207678_10273222
764 Ga0207678_10984236
765 Ga0207708_10206377
766 Ga0207702_10014106
767 Ga0207702_10016642
768 Ga0207702_10042129
769 Ga0207702_10115747
770 Ga0207641_10071086
771 Ga0207648_10246754
772 Ga0207676_10054464
773 Ga0207676_11065156
774 Ga0207674_10000638
775 Ga0207674_10004818
776 Ga0207674_10079734
777 Ga0207683_10099012
778 Ga0207698_10003797
779 Ga0207698_10007133
780 Ga0207698_10183477
781 Ga0207698_10353765
782 Ga0207698_10356794
783 Ga0207698_10786430
784 Ga0209974_10175442
785 Ga0207428_10663402
786 Ga0268266_10048798
787 Ga0268266_11814877
788 Ga0316177_1172957
789 Ga0307408_100069056
790 Ga0307408_100139169
791 Ga0307408_101067669
792 Ga0307405_10009922
793 Ga0307405_10025316
794 Ga0307405_10733599
795 Ga0307405_11510647
796 Ga0307413_10005320
797 Ga0307413_10053647
798 Ga0307413_10272851
799 Ga0307413_10306008
800 Ga0307410_10005204
801 Ga0307410_10007105
802 Ga0307410_10011558
803 Ga0307410_10116806
804 Ga0307410_10149248
805 Ga0307406_10035483
806 Ga0307406_10080452
807 Ga0307407_10009376
808 Ga0307407_10022925
809 Ga0307407_10148087
810 Ga0307407_10331365
811 Ga0307412_10019962
812 Ga0307412_10123312
813 Ga0307412_10549891
814 Ga0307412_10815757
815 Ga0307409_100023148
816 Ga0307409_100023250
817 Ga0307409_100286936
818 Ga0307409_101204924
819 Ga0307409_101719577
820 Ga0307409_101942904
821 Ga0307409_102434517
822 Ga0307416_100018556
823 Ga0307416_100081251
824 Ga0307416_100161381
825 Ga0307416_100549648
826 Ga0307416_101850575
827 Ga0307416_103325895
828 Ga0307414_10009558
829 Ga0307414_10015765
830 Ga0307414_10238759
831 Ga0307414_10276227
832 Ga0307414_10479660
833 Ga0307411_10010289
834 Ga0307411_10019181
835 Ga0307411_10113673
836 Ga0307411_10142620
837 Ga0307411_10280165
838 Ga0307411_10383578
839 Ga0307415_100015451
840 Ga0307415_100037878
841 Ga0307415_100279234
842 Ga0395899_0000230
843 Ga0395899_0008689
844 Ga0395899_0049260
845 Ga0395899_0057177
846 Ga0395899_0057751
847 Ga0395899_0111942
848 Ga0395899_0112789
849 Ga0395900_0000124
850 Ga0395900_0000666
851 Ga0395900_0004212
852 Ga0395900_0030307
853 Ga0395900_0084123
854 Ga0395900_0123244
855 Ga0395900_0142182
856 Ga0395900_0169920
857 Ga0395900_0264523
858 Ga0395900_0398257
859 Ga0395900_0490996
860 Ga0395900_0515922
861 Ga0395900_1261293
862 Ga0395898_0040267
863 Ga0395898_0061663
864 Ga0395898_0115041
865 Ga0395898_0346575
866 Ga0395898_0442669
867 Ga0395898_1012098
868 Ga0395898_1015049
869 Ga0395905_0011364
870 Ga0395905_0021132
871 Ga0395905_0021878
872 Ga0395905_0026980
873 Ga0395905_0031488
874 Ga0395905_0044052
875 Ga0395905_0067404
876 Ga0395905_0114121
877 Ga0395905_0131704
878 Ga0395905_0454175
879 Ga0395905_0625527
880 Ga0395905_0868433
881 Ga0395905_0887767
882 Ga0395901_0000031
883 Ga0395901_0001383
884 Ga0395901_0031386
885 Ga0395901_0040437
886 Ga0395901_0075642
887 Ga0395901_0160825
888 Ga0395901_0161720
889 Ga0395901_0178274
890 Ga0395901_0186322
891 Ga0395901_0345886
892 Ga0395901_0548048
893 Ga0451802_0128336
894 Ga0439433_0153825
895 Ga0439441_028666
896 Ga0439445_0037324
897 Ga0439432_005832
898 Ga0439432_118422
899 Ga0439432_189271
900 Ga0439449_0105488
901 Ga0439449_0255568
902 Ga0466969_0002494
903 Ga0466965_0233189
904 Ga0466966_0009373
905 Ga0466966_0060241
906 Ga0466961_0056290
907 Ga0466961_0106216
908 Ga0466963_0032317
909 Ga0466963_0119388
910 Ga0466963_0600101
911 Ga0466964_0036494
912 Ga0466971_0037099
913 Ga0466970_0011799
914 Ga0466970_0161548
915 Ga0466957_0041477
916 Ga0466957_0414703
917 Ga0466959_0021913
918 Ga0466959_0293213
919 Ga0466958_0000063
920 Ga0466958_0015557
921 Ga0466958_0171464
922 Ga0466958_0528138
923 Ga0466967_0270214
924 Ga0466967_0276621
925 Ga0495642_0030731
926 Ga0495621_0010615
927 Ga0495633_0503003
928 Ga0495669_0004330
929 Ga0495669_0368873
930 Ga0495677_0004517
931 Ga0496100_0734258
932 Ga0496102_0651898
933 Ga0496103_0208450
934 Ga0496105_0293425
935 Ga0496105_0841836
936 Ga0496107_0383402
937 Ga0496107_0565108
938 Ga0496108_0004395
939 Ga0496108_0331775
940 Ga0496109_0002921
941 Ga0496110_0352626
942 Ga0496112_0107910
943 Ga0496113_0057949
944 Ga0501298_028561
945 Ga0501201_026725
946 Ga0501223_063360
947 Ga0501235_094615
948 Ga0501258_022432
949 Ga0501225_0026693
950 Ga0501267_061160
951 Ga0501268_021840
952 Ga0501268_090223
953 Ga0501270_004368
954 Ga0501270_156496
955 Ga0501273_028295
956 Ga0501273_075791
957 nmdc:mga0rr50_462383_c1
958 Ga0466962_0000633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08755

YccV-like

Hemimethylated DNA-binding protein YccV like

51

145

0.94

Map