F451958

General Info

Members Datasets Scaffolds Average Seq Length
478 191 477 343

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_93200_c1|nmdc:mga06r32_93200_c1_865_1995
Length 376
Sequence MVLIFKNNLKISFSKNLIMLCKAYFCPLGMQAKNIFSRIMNWELWPFYVLYFPIGFVWFWYCLKARSFWFFSSSNPTITFGGFEGESKKEMYDQLPPSSYPKTIYVLHDLPFDQVKKKVVENGFQYPFIVKPDVGMKGILFRKIDNDEQLRKYHERIPVEYIVQELIDMPVELSVFYYRHPTQQKGTISGLIQKELLEVYGDGKSTLWELILAHPRAKYRLEEMKHRHEHRLQRVLPKDKHFYLSYAGNHNRGARFIDLHHLADEKLHKVFDDLSHYTNKFYYGRYDIKCMSLDDLKEGKNYSILEFNGCGAEPNHIYDAGLSLGQAYREILKHWKALYQISKHNHENGTPYWSFTRGRDFLRQAKRHFRMLEKYD

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
180 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 0
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10034817 3300003203 Bacteria 1844
2 rootH1_10204152 3300003323 Bacteria 1341
3 Ga0065707_10097497 3300005295 Bacteria 3169
4 Ga0070658_10014938 3300005327 Bacteria 6218
5 Ga0070658_10035406 3300005327 Bacteria 4021
6 Ga0070658_10135397 3300005327 Bacteria 2055
7 Ga0070676_10008849 3300005328 Bacteria 5437
8 Ga0070683_100000211 3300005329 Bacteria 39486
9 Ga0070683_100008951 3300005329 Bacteria 8532
10 Ga0070683_100150586 3300005329 Bacteria 2206
11 Ga0070683_100175638 3300005329 Bacteria 2033
12 Ga0070683_100267330 3300005329 Bacteria 1627
13 Ga0070670_100059876 3300005331 Bacteria 3268
14 Ga0068869_100084065 3300005334 Unclassified 2382
15 Ga0070666_10018002 3300005335 Bacteria 4534
16 Ga0070680_100029490 3300005336 Bacteria 4407
17 Ga0070680_100063713 3300005336 Bacteria 3020
18 Ga0070682_100000839 3300005337 Bacteria 17934
19 Ga0070682_100010328 3300005337 Bacteria 5298
20 Ga0070682_100023486 3300005337 Bacteria 3660
21 Ga0068868_100006735 3300005338 Bacteria 8157
22 Ga0068868_100022247 3300005338 Bacteria 4783
23 Ga0068868_100038859 3300005338 Bacteria 3694
24 Ga0068868_100175144 3300005338 Unclassified 1778
25 Ga0070660_100036738 3300005339 Bacteria 3712
26 Ga0070660_100046555 3300005339 Bacteria 3325
27 Ga0070660_100084642 3300005339 Bacteria 2493
28 Ga0070660_100108028 3300005339 Bacteria 2211
29 Ga0070660_100238857 3300005339 Bacteria 1480
30 Ga0070689_100040741 3300005340 Bacteria 3562
31 Ga0070689_100067798 3300005340 Unclassified 2782
32 Ga0070661_100006697 3300005344 Bacteria 7947
33 Ga0070661_100024352 3300005344 Unclassified 4342
34 Ga0070661_100110934 3300005344 Bacteria 2048
35 Ga0070668_100013664 3300005347 Bacteria 6062
36 Ga0070668_100052593 3300005347 Bacteria 3139
37 Ga0070669_100002091 3300005353 Bacteria 14439
38 Ga0070669_100038970 3300005353 Bacteria 3451
39 Ga0070669_100140391 3300005353 Bacteria 1862
40 Ga0070675_100070064 3300005354 Bacteria 2906
41 Ga0070671_100174229 3300005355 Unclassified 1820
42 Ga0070671_100209185 3300005355 Bacteria 1654
43 Ga0070674_100074879 3300005356 Bacteria 2403
44 Ga0070673_100007156 3300005364 Bacteria 7331
45 Ga0070673_100011359 3300005364 Bacteria 6077
46 Ga0070673_100014508 3300005364 Bacteria 5492
47 Ga0070673_100039356 3300005364 Bacteria 3617
48 Ga0070673_100058672 3300005364 Unclassified 3044
49 Ga0070673_100178773 3300005364 Bacteria 1815
50 Ga0070688_100006223 3300005365 Bacteria 6359
51 Ga0070688_100047324 3300005365 Bacteria 2667
52 Ga0070688_100108902 3300005365 Unclassified 1839
53 Ga0070659_100009607 3300005366 Bacteria 7109
54 Ga0070659_100016082 3300005366 Bacteria 5613
55 Ga0070659_100036241 3300005366 Unclassified 3844
56 Ga0070667_100022473 3300005367 Bacteria 5231
57 Ga0070667_100061418 3300005367 Unclassified 3182
58 Ga0070667_100302291 3300005367 Unclassified 1441
59 Ga0070662_100002963 3300005457 Bacteria 10548
60 Ga0070662_100046564 3300005457 Bacteria 3116
61 Ga0070662_100075043 3300005457 Bacteria 2503
62 Ga0070662_100100635 3300005457 Bacteria 2187
63 Ga0070681_10042587 3300005458 Bacteria 4549
64 Ga0070681_10058368 3300005458 Bacteria 3838
65 Ga0070681_10078835 3300005458 Bacteria 3251
66 Ga0070681_10083510 3300005458 Bacteria 3147
67 Ga0070681_10090375 3300005458 Bacteria 3013
68 Ga0070681_10285944 3300005458 Unclassified 1559
69 Ga0068867_100012907 3300005459 Bacteria 5911
70 Ga0068867_100026915 3300005459 Unclassified 4132
71 Ga0068867_100033160 3300005459 Bacteria 3738
72 Ga0068867_100226148 3300005459 Unclassified 1510
73 Ga0070698_100002098 3300005471 Bacteria 22130
74 Ga0070679_100000723 3300005530 Bacteria 28502
75 Ga0070679_100001843 3300005530 Bacteria 19045
76 Ga0070679_100011352 3300005530 Bacteria 8489
77 Ga0070679_100122118 3300005530 Bacteria 2589
78 Ga0070679_100122541 3300005530 Bacteria 2584
79 Ga0070684_100000568 3300005535 Bacteria 25497
80 Ga0070684_100006331 3300005535 Bacteria 9149
81 Ga0070684_100006999 3300005535 Bacteria 8761
82 Ga0070684_100025026 3300005535 Bacteria 5012
83 Ga0068853_100032600 3300005539 Bacteria 4414
84 Ga0068853_100039686 3300005539 Bacteria 4016
85 Ga0068853_100040732 3300005539 Bacteria 3965
86 Ga0068853_100060886 3300005539 Unclassified 3263
87 Ga0068853_100123171 3300005539 Bacteria 2315
88 Ga0068853_100149788 3300005539 Bacteria 2100
89 Ga0068853_100180012 3300005539 Bacteria 1917
90 Ga0070672_100049424 3300005543 Unclassified 3272
91 Ga0070672_100056638 3300005543 Bacteria 3075
92 Ga0070672_100099984 3300005543 Bacteria 2352
93 Ga0070672_100114552 3300005543 Unclassified 2201
94 Ga0070686_100315828 3300005544 Bacteria 1163
95 Ga0070665_100203365 3300005548 Unclassified 1981
96 Ga0068855_100004190 3300005563 Bacteria 17595
97 Ga0068855_100053098 3300005563 Bacteria 4769
98 Ga0068855_100165088 3300005563 Bacteria 2511
99 Ga0070664_100003902 3300005564 Bacteria 12033
100 Ga0070664_100008242 3300005564 Bacteria 8425
101 Ga0068857_100019417 3300005577 Bacteria 5967
102 Ga0068857_100067965 3300005577 Unclassified 3172
103 Ga0068857_100084201 3300005577 Bacteria 2841
104 Ga0068857_100200554 3300005577 Bacteria 1819
105 Ga0068854_100010782 3300005578 Bacteria 5930
106 Ga0068854_100102963 3300005578 Bacteria 2143
107 Ga0068856_100021551 3300005614 Bacteria 6263
108 Ga0068856_100074051 3300005614 Bacteria 3371
109 Ga0068856_100381536 3300005614 Bacteria 1429
110 Ga0068852_100000563 3300005616 Bacteria 24454
111 Ga0068852_100046492 3300005616 Bacteria 3699
112 Ga0068859_100009061 3300005617 Bacteria 10051
113 Ga0068859_100012192 3300005617 Bacteria 8641
114 Ga0068859_100014826 3300005617 Bacteria 7828
115 Ga0068859_100029379 3300005617 Bacteria 5516
116 Ga0068859_100085891 3300005617 Bacteria 3192
117 Ga0068859_100121868 3300005617 Bacteria 2674
118 Ga0068859_100193662 3300005617 Unclassified 2117
119 Ga0068859_100321544 3300005617 Bacteria 1641
120 Ga0068864_100208268 3300005618 Unclassified 1799
121 Ga0068864_100319060 3300005618 Bacteria 1459
122 Ga0068866_10077129 3300005718 Bacteria 1779
123 Ga0068866_10167678 3300005718 Bacteria 1286
124 Ga0068861_100003838 3300005719 Bacteria 10031
125 Ga0068861_100015284 3300005719 Bacteria 5406
126 Ga0068861_100018566 3300005719 Bacteria 4954
127 Ga0068861_100039890 3300005719 Bacteria 3508
128 Ga0068861_100081633 3300005719 Unclassified 2532
129 Ga0068851_10039335 3300005834 Unclassified 2375
130 Ga0068870_10010630 3300005840 Bacteria 4236
131 Ga0068870_10062134 3300005840 Unclassified 2010
132 Ga0068870_10104884 3300005840 Bacteria 1604
133 Ga0068863_100148941 3300005841 Unclassified 2239
134 Ga0068858_100020473 3300005842 Bacteria 6183
135 Ga0068858_100056539 3300005842 Unclassified 3626
136 Ga0068860_100061503 3300005843 Bacteria 3568
137 Ga0068860_100180018 3300005843 Bacteria 2043
138 Ga0068860_100442974 3300005843 Bacteria 1291
139 Ga0068862_100008262 3300005844 Bacteria 8611
140 Ga0068862_100033405 3300005844 Bacteria 4349
141 Ga0068862_100066279 3300005844 Bacteria 3111
142 Ga0081539_10001245 3300005985 Bacteria 45262
143 Ga0075366_10043379 3300006195 Bacteria 2664
144 Ga0075366_10084244 3300006195 Bacteria 1900
145 Ga0097621_100016613 3300006237 Bacteria 5568
146 Ga0097621_100302369 3300006237 Bacteria 1413
147 Ga0068871_100026639 3300006358 Bacteria 4513
148 Ga0068871_100050289 3300006358 Bacteria 3371
149 Ga0075428_100002349 3300006844 Bacteria 20539
150 Ga0075428_100204297 3300006844 Bacteria 2135
151 Ga0075430_100013143 3300006846 Bacteria 7053
152 Ga0075431_100035126 3300006847 Bacteria 5162
153 Ga0075429_100004013 3300006880 Bacteria 12599
154 Ga0075429_100180427 3300006880 Bacteria 1850
155 Ga0068865_100021051 3300006881 Bacteria 4238
156 Ga0068865_100036227 3300006881 Bacteria 3325
157 Ga0097620_100009061 3300006931 Bacteria 10051
158 Ga0097620_100012190 3300006931 Bacteria 8641
159 Ga0097620_100014825 3300006931 Bacteria 7828
160 Ga0097620_100029379 3300006931 Bacteria 5516
161 Ga0097620_100085883 3300006931 Bacteria 3192
162 Ga0097620_100121868 3300006931 Bacteria 2674
163 Ga0097620_100193686 3300006931 Unclassified 2117
164 Ga0097620_100321549 3300006931 Bacteria 1641
165 Ga0105240_10488342 3300009093 Bacteria 1371
166 Ga0111539_10003454 3300009094 Bacteria 20812
167 Ga0111539_10110494 3300009094 Bacteria 3226
168 Ga0105247_10003642 3300009101 Bacteria 10008
169 Ga0105241_10129031 3300009174 Bacteria 2045
170 Ga0105242_10016017 3300009176 Bacteria 5824
171 Ga0105242_10028031 3300009176 Bacteria 4480
172 Ga0105242_10037252 3300009176 Bacteria 3906
173 Ga0105242_10117490 3300009176 Bacteria 2277
174 Ga0105242_10365256 3300009176 Bacteria 1337
175 Ga0105237_10066269 3300009545 Bacteria 3606
176 Ga0105249_10004716 3300009553 Bacteria 11769
177 Ga0105249_10010856 3300009553 Bacteria 8004
178 Ga0105249_10116693 3300009553 Bacteria 2531
179 Ga0105249_10406848 3300009553 Bacteria 1392
180 Ga0105239_10064401 3300010375 Bacteria 4024
181 Ga0105239_10074626 3300010375 Bacteria 3729
182 Ga0105239_10105555 3300010375 Unclassified 3120
183 Ga0105246_10008960 3300011119 Bacteria 6160
184 Ga0157373_10005431 3300013100 Bacteria 9573
185 Ga0157373_10021980 3300013100 Bacteria 4629
186 Ga0157373_10023654 3300013100 Bacteria 4453
187 Ga0157373_10079707 3300013100 Unclassified 2310
188 Ga0157371_10000932 3300013102 Bacteria 32766
189 Ga0157371_10003421 3300013102 Bacteria 14416
190 Ga0157371_10003608 3300013102 Bacteria 13948
191 Ga0157371_10003924 3300013102 Bacteria 13232
192 Ga0157371_10022360 3300013102 Bacteria 4635
193 Ga0157371_10033448 3300013102 Bacteria 3694
194 Ga0157371_10064172 3300013102 Bacteria 2602
195 Ga0157371_10098152 3300013102 Bacteria 2077
196 Ga0157371_10115620 3300013102 Bacteria 1905
197 Ga0157371_10136068 3300013102 Unclassified 1750
198 Ga0157371_10287110 3300013102 Bacteria 1189
199 Ga0157370_10001951 3300013104 Bacteria 25406
200 Ga0157370_10001963 3300013104 Bacteria 25346
201 Ga0157370_10003393 3300013104 Bacteria 18718
202 Ga0157370_10151079 3300013104 Bacteria 2161
203 Ga0157370_10213567 3300013104 Unclassified 1788
204 Ga0157370_10388776 3300013104 Unclassified 1284
205 Ga0157370_10482858 3300013104 Bacteria 1138
206 Ga0157369_10025473 3300013105 Bacteria 6568
207 Ga0157369_10059506 3300013105 Bacteria 4119
208 Ga0157369_10084258 3300013105 Bacteria 3398
209 Ga0157369_10094153 3300013105 Bacteria 3197
210 Ga0157369_10183628 3300013105 Bacteria 2200
211 Ga0157369_10365155 3300013105 Bacteria 1499
212 Ga0157374_10008376 3300013296 Bacteria 8829
213 Ga0157374_10014583 3300013296 Bacteria 6879
214 Ga0157374_10024342 3300013296 Bacteria 5427
215 Ga0157374_10115391 3300013296 Bacteria 2587
216 Ga0157374_10133988 3300013296 Bacteria 2400
217 Ga0157374_10138216 3300013296 Bacteria 2363
218 Ga0157374_10138301 3300013296 Bacteria 2362
219 Ga0157378_10076110 3300013297 Unclassified 3023
220 Ga0163162_10004586 3300013306 Bacteria 13309
221 Ga0163162_10059108 3300013306 Unclassified 3865
222 Ga0157372_10070768 3300013307 Bacteria 3926
223 Ga0157372_10101571 3300013307 Bacteria 3283
224 Ga0157372_10111735 3300013307 Bacteria 3130
225 Ga0157372_10111875 3300013307 Unclassified 3128
226 Ga0157372_10294196 3300013307 Bacteria 1888
227 Ga0157372_10367893 3300013307 Bacteria 1675
228 Ga0157372_10589570 3300013307 Unclassified 1296
229 Ga0157375_10005137 3300013308 Bacteria 11365
230 Ga0157375_10083868 3300013308 Bacteria 3233
231 Ga0157375_10227773 3300013308 Unclassified 2023
232 Ga0157375_10591467 3300013308 Bacteria 1269
233 Ga0163163_10013146 3300014325 Bacteria 7565
234 Ga0163163_10067486 3300014325 Unclassified 3556
235 Ga0163163_10154595 3300014325 Unclassified 2338
236 Ga0163163_10370851 3300014325 Unclassified 1488
237 Ga0157380_10025275 3300014326 Bacteria 4502
238 Ga0157380_10039474 3300014326 Bacteria 3672
239 Ga0157380_10113199 3300014326 Bacteria 2284
240 Ga0157377_10003164 3300014745 Bacteria 7422
241 Ga0157377_10003472 3300014745 Bacteria 7142
242 Ga0157379_10061033 3300014968 Bacteria 3371
243 Ga0157376_10041114 3300014969 Bacteria 3783
244 Ga0163161_10010065 3300017792 Bacteria 6545
245 Ga0163161_10086782 3300017792 Bacteria 2310
246 Ga0163161_10125675 3300017792 Bacteria 1931
247 Ga0207697_10023296 3300025315 Unclassified 2535
248 Ga0207656_10025035 3300025321 Unclassified 2420
249 Ga0207682_10025539 3300025893 Bacteria 2343
250 Ga0207642_10010665 3300025899 Bacteria 3250
251 Ga0207642_10023623 3300025899 Bacteria 2459
252 Ga0207642_10117925 3300025899 Bacteria 1364
253 Ga0207710_10036557 3300025900 Unclassified 2165
254 Ga0207688_10055057 3300025901 Bacteria 2232
255 Ga0207688_10092956 3300025901 Bacteria 1734
256 Ga0207647_10006080 3300025904 Bacteria 8796
257 Ga0207647_10122675 3300025904 Unclassified 1531
258 Ga0207647_10176917 3300025904 Bacteria 1241
259 Ga0207645_10008320 3300025907 Bacteria 7246
260 Ga0207645_10008581 3300025907 Bacteria 7119
261 Ga0207645_10020979 3300025907 Bacteria 4267
262 Ga0207645_10088355 3300025907 Unclassified 1992
263 Ga0207643_10004789 3300025908 Bacteria 7250
264 Ga0207643_10023686 3300025908 Bacteria 3387
265 Ga0207643_10074084 3300025908 Bacteria 1963
266 Ga0207705_10003539 3300025909 Bacteria 11893
267 Ga0207705_10023722 3300025909 Bacteria 4377
268 Ga0207705_10076115 3300025909 Bacteria 2439
269 Ga0207705_10078713 3300025909 Bacteria 2400
270 Ga0207705_10223887 3300025909 Bacteria 1429
271 Ga0207654_10035846 3300025911 Bacteria 2767
272 Ga0207707_10072204 3300025912 Bacteria 3008
273 Ga0207707_10242729 3300025912 Unclassified 1566
274 Ga0207695_10042677 3300025913 Bacteria 4840
275 Ga0207660_10028247 3300025917 Bacteria 3836
276 Ga0207660_10084884 3300025917 Bacteria 2334
277 Ga0207657_10012205 3300025919 Bacteria 8489
278 Ga0207657_10062733 3300025919 Bacteria 3180
279 Ga0207657_10065191 3300025919 Bacteria 3106
280 Ga0207657_10078741 3300025919 Bacteria 2774
281 Ga0207657_10108985 3300025919 Bacteria 2289
282 Ga0207657_10116109 3300025919 Bacteria 2206
283 Ga0207649_10005653 3300025920 Bacteria 6769
284 Ga0207649_10039137 3300025920 Bacteria 2873
285 Ga0207652_10000546 3300025921 Bacteria 38083
286 Ga0207652_10000697 3300025921 Bacteria 32555
287 Ga0207652_10001189 3300025921 Bacteria 23425
288 Ga0207652_10017232 3300025921 Bacteria 5910
289 Ga0207652_10413662 3300025921 Bacteria 1216
290 Ga0207681_10028136 3300025923 Bacteria 3640
291 Ga0207681_10122513 3300025923 Bacteria 1909
292 Ga0207681_10160457 3300025923 Bacteria 1694
293 Ga0207650_10052379 3300025925 Bacteria 3023
294 Ga0207650_10255965 3300025925 Unclassified 1419
295 Ga0207659_10066957 3300025926 Bacteria 2608
296 Ga0207644_10150092 3300025931 Bacteria 1803
297 Ga0207644_10251164 3300025931 Unclassified 1411
298 Ga0207690_10015077 3300025932 Bacteria 4679
299 Ga0207690_10050106 3300025932 Unclassified 2786
300 Ga0207690_10239662 3300025932 Bacteria 1396
301 Ga0207706_10022666 3300025933 Bacteria 5636
302 Ga0207686_10001727 3300025934 Bacteria 12163
303 Ga0207686_10027849 3300025934 Bacteria 3314
304 Ga0207670_10022239 3300025936 Bacteria 3927
305 Ga0207670_10038548 3300025936 Bacteria 3122
306 Ga0207670_10043689 3300025936 Unclassified 2961
307 Ga0207669_10187472 3300025937 Bacteria 1489
308 Ga0207669_10309630 3300025937 Unclassified 1204
309 Ga0207704_10036651 3300025938 Bacteria 2824
310 Ga0207691_10007169 3300025940 Bacteria 10754
311 Ga0207691_10055970 3300025940 Bacteria 3594
312 Ga0207691_10112716 3300025940 Bacteria 2417
313 Ga0207691_10129221 3300025940 Bacteria 2233
314 Ga0207691_10133069 3300025940 Unclassified 2195
315 Ga0207691_10184685 3300025940 Unclassified 1821
316 Ga0207689_10010494 3300025942 Bacteria 7978
317 Ga0207689_10013015 3300025942 Bacteria 7104
318 Ga0207689_10043720 3300025942 Bacteria 3703
319 Ga0207689_10047343 3300025942 Bacteria 3551
320 Ga0207689_10064671 3300025942 Bacteria 3009
321 Ga0207689_10090649 3300025942 Bacteria 2512
322 Ga0207661_10003519 3300025944 Bacteria 10883
323 Ga0207661_10013659 3300025944 Bacteria 5929
324 Ga0207661_10029870 3300025944 Unclassified 4191
325 Ga0207661_10064891 3300025944 Bacteria 2962
326 Ga0207661_10131880 3300025944 Bacteria 2141
327 Ga0207661_10254553 3300025944 Bacteria 1562
328 Ga0207667_10058892 3300025949 Bacteria 4026
329 Ga0207667_10060111 3300025949 Bacteria 3978
330 Ga0207667_10087799 3300025949 Bacteria 3217
331 Ga0207667_10103782 3300025949 Bacteria 2932
332 Ga0207651_10012448 3300025960 Bacteria 4816
333 Ga0207651_10077021 3300025960 Bacteria 2386
334 Ga0207651_10211176 3300025960 Unclassified 1562
335 Ga0207712_10066953 3300025961 Bacteria 2569
336 Ga0207712_10068905 3300025961 Bacteria 2537
337 Ga0207712_10346175 3300025961 Bacteria 1234
338 Ga0207668_10022072 3300025972 Bacteria 4069
339 Ga0207668_10065618 3300025972 Bacteria 2570
340 Ga0207668_10245671 3300025972 Bacteria 1451
341 Ga0207640_10359544 3300025981 Bacteria 1172
342 Ga0207658_10104504 3300025986 Bacteria 2226
343 Ga0207658_10145790 3300025986 Unclassified 1922
344 Ga0207658_10189757 3300025986 Bacteria 1707
345 Ga0207677_10043827 3300026023 Unclassified 2977
346 Ga0207677_10051822 3300026023 Bacteria 2784
347 Ga0207677_10075912 3300026023 Bacteria 2391
348 Ga0207677_10137939 3300026023 Unclassified 1863
349 Ga0207703_10028962 3300026035 Bacteria 4370
350 Ga0207703_10347956 3300026035 Bacteria 1364
351 Ga0207703_10400238 3300026035 Bacteria 1274
352 Ga0207639_10041374 3300026041 Unclassified 3447
353 Ga0207639_10053613 3300026041 Bacteria 3078
354 Ga0207639_10080415 3300026041 Bacteria 2578
355 Ga0207678_10008521 3300026067 Bacteria 9034
356 Ga0207708_10084134 3300026075 Bacteria 2446
357 Ga0207702_10055438 3300026078 Bacteria 3361
358 Ga0207641_10023102 3300026088 Bacteria 5123
359 Ga0207641_10110982 3300026088 Bacteria 2431
360 Ga0207641_10155261 3300026088 Bacteria 2076
361 Ga0207648_10002952 3300026089 Bacteria 17989
362 Ga0207648_10003655 3300026089 Bacteria 16101
363 Ga0207648_10006979 3300026089 Bacteria 11173
364 Ga0207648_10046998 3300026089 Bacteria 3784
365 Ga0207676_10138322 3300026095 Bacteria 2081
366 Ga0207676_10144436 3300026095 Bacteria 2042
367 Ga0207676_10152850 3300026095 Unclassified 1990
368 Ga0207674_10001890 3300026116 Bacteria 26652
369 Ga0207674_10004509 3300026116 Bacteria 16740
370 Ga0207674_10024037 3300026116 Bacteria 6517
371 Ga0207674_10044776 3300026116 Unclassified 4557
372 Ga0207674_10106245 3300026116 Bacteria 2785
373 Ga0207674_10121843 3300026116 Unclassified 2575
374 Ga0207675_100000359 3300026118 Bacteria 43729
375 Ga0207675_100008546 3300026118 Bacteria 9630
376 Ga0207675_100020892 3300026118 Bacteria 6104
377 Ga0207675_100062813 3300026118 Bacteria 3470
378 Ga0207675_100077748 3300026118 Bacteria 3109
379 Ga0207675_100110239 3300026118 Bacteria 2597
380 Ga0207683_10001842 3300026121 Bacteria 18744
381 Ga0207683_10075537 3300026121 Bacteria 2982
382 Ga0207683_10137141 3300026121 Bacteria 2203
383 Ga0207698_10013319 3300026142 Bacteria 5422
384 Ga0207698_10036983 3300026142 Bacteria 3590
385 Ga0207698_10084807 3300026142 Bacteria 2570
386 Ga0207698_10126464 3300026142 Bacteria 2175
387 Ga0207698_10133506 3300026142 Bacteria 2125
388 Ga0207428_10074585 3300027907 Bacteria 2660
389 Ga0207428_10101001 3300027907 Bacteria 2229
390 Ga0268266_10036019 3300028379 Bacteria 4210
391 Ga0268266_10099400 3300028379 Bacteria 2561
392 Ga0268266_10113813 3300028379 Bacteria 2400
393 Ga0268265_10004817 3300028380 Bacteria 9303
394 Ga0268265_10442332 3300028380 Bacteria 1212
395 Ga0268264_10006791 3300028381 Bacteria 9615
396 Ga0268264_10076822 3300028381 Bacteria 2842
397 Ga0268264_10107338 3300028381 Bacteria 2439
398 Ga0307513_10200947 3300031456 Bacteria 1834
399 Ga0307413_10043532 3300031824 Bacteria 2647
400 Ga0307406_10149211 3300031901 Unclassified 1666
401 Ga0395899_0001590 3300037312 Bacteria 19085
402 Ga0395899_0098873 3300037312 Bacteria 2108
403 Ga0395899_0311789 3300037312 Bacteria 1062
404 Ga0395900_0004139 3300037418 Bacteria 15441
405 Ga0395900_0005994 3300037418 Bacteria 12692
406 Ga0395900_0102716 3300037418 Bacteria 2936
407 Ga0395898_0001279 3300037466 Bacteria 37056
408 Ga0395898_0041168 3300037466 Bacteria 4564
409 Ga0395898_0049581 3300037466 Bacteria 4113
410 Ga0395898_0170838 3300037466 Bacteria 2078
411 Ga0395905_0005471 3300037471 Bacteria 12952
412 Ga0395905_0169705 3300037471 Bacteria 2049
413 Ga0395905_0329229 3300037471 Bacteria 1418
414 Ga0395901_0004694 3300038443 Bacteria 13783
415 Ga0395901_0007368 3300038443 Bacteria 11099
416 Ga0395901_0116887 3300038443 Bacteria 2802
417 Ga0439441_003317 3300042001 Unclassified 2364
418 Ga0453683_0039870 3300044673 Unclassified 2951
419 Ga0453683_0308200 3300044673 Bacteria 1013
420 Ga0453684_0133328 3300044712 Bacteria 2978
421 Ga0453684_0167923 3300044712 Bacteria 2589
422 Ga0495650_0034129 3300046471 Unclassified 2257
423 Ga0495608_0016709 3300046511 Bacteria 5077
424 Ga0495628_0064270 3300046516 Bacteria 2873
425 Ga0495630_0025276 3300046517 Bacteria 4390
426 Ga0495640_0086995 3300046533 Bacteria 2068
427 Ga0495598_0087091 3300046537 Unclassified 1012
428 Ga0495668_0001051 3300046616 Bacteria 29297
429 Ga0495634_0086022 3300046642 Bacteria 2048
430 Ga0495635_0035766 3300046663 Bacteria 3444
431 Ga0495646_0034961 3300046680 Bacteria 3118
432 Ga0495674_0132895 3300047319 Bacteria 2096
433 Ga0495672_0007681 3300047320 Bacteria 8082
434 Ga0495672_0018066 3300047320 Bacteria 4695
435 Ga0495680_0064105 3300047322 Bacteria 2819
436 Ga0495686_0039754 3300047472 Bacteria 3002
437 Ga0495686_0159717 3300047472 Unclassified 1318
438 Ga0501031_0029299 3300049568 Bacteria 3591
439 Ga0501032_0006173 3300049569 Bacteria 8820
440 Ga0501032_0046898 3300049569 Bacteria 2920
441 Ga0501034_0000017 3300049571 Bacteria 285938
442 Ga0501034_0174542 3300049571 Bacteria 2115
443 Ga0501034_0302011 3300049571 Bacteria 1537
444 Ga0501036_0011056 3300049572 Bacteria 7463
445 Ga0501037_0006584 3300049573 Bacteria 8498
446 Ga0501038_0016450 3300049574 Bacteria 6704
447 Ga0501038_0209450 3300049574 Bacteria 1560
448 Ga0501039_0040623 3300049575 Bacteria 3590
449 Ga0501039_0094611 3300049575 Bacteria 2329
450 Ga0501043_0004526 3300049579 Bacteria 11298
451 Ga0501043_0060263 3300049579 Bacteria 2979
452 Ga0501046_0003983 3300049580 Bacteria 13485
453 Ga0501046_0024453 3300049580 Bacteria 4955
454 Ga0501047_0257604 3300049581 Bacteria 1592
455 Ga0501048_0046639 3300049582 Bacteria 3093
456 Ga0501070_0021578 3300049586 Bacteria 5403
457 Ga0501070_0052241 3300049586 Bacteria 3392
458 Ga0501073_0000371 3300049589 Bacteria 30293
459 Ga0501074_0016939 3300049590 Bacteria 5286
460 Ga0501251_001149 3300049681 Bacteria 2443
461 Ga0501257_006945 3300049686 Unclassified 2521
462 Ga0501259_000124 3300049688 Bacteria 11295
463 Ga0501245_001763 3300049708 Bacteria 2841
464 Ga0501079_0102993 3300049741 Bacteria 2214
465 Ga0501080_0087094 3300049742 Bacteria 2901
466 Ga0501266_000169 3300049763 Bacteria 8335
467 Ga0501035_0071677 3300049822 Bacteria 3067
468 Ga0501035_0259659 3300049822 Bacteria 1473
469 Ga0501044_0101383 3300049823 Bacteria 2896
470 Ga0501044_0149490 3300049823 Bacteria 2319
471 nmdc:mga09592_141298_c1 3300050508 Bacteria 2076
472 nmdc:mga09592_84060_c1 3300050508 Unclassified 2714
473 nmdc:mga06r32_93200_c1 3300050510 Bacteria 2946
474 nmdc:mga08y16_3350_c1 3300050511 Bacteria 16593
475 Ga0495619_0059311 3300053085 Bacteria 2542
476 Ga0500568_0000562 3300053139 Bacteria 27303
477 Ga0500611_000092 3300053727 Bacteria 25966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100052593 Ga0070668_1000525932 290
2 3300005617 Ga0068859_100321544 Ga0068859_1003215442 290
3 3300005843 Ga0068860_100061503 Ga0068860_1000615032 290
4 3300005844 Ga0068862_100033405 Ga0068862_1000334052 290
5 3300006931 Ga0097620_100321549 Ga0097620_1003215492 290
6 3300025942 Ga0207689_10064671 Ga0207689_100646712 290
7 3300025986 Ga0207658_10104504 Ga0207658_101045043 290
8 3300026088 Ga0207641_10155261 Ga0207641_101552612 290
9 3300005327 Ga0070658_10035406 Ga0070658_100354062 298
10 3300005327 Ga0070658_10135397 Ga0070658_101353973 298
11 3300005329 Ga0070683_100267330 Ga0070683_1002673303 298
12 3300005530 Ga0070679_100000723 Ga0070679_1000007239 298
13 3300005563 Ga0068855_100165088 Ga0068855_1001650883 298
14 3300005617 Ga0068859_100009061 Ga0068859_1000090618 298
15 3300006931 Ga0097620_100009061 Ga0097620_1000090614 298
16 3300025919 Ga0207657_10065191 Ga0207657_100651913 298
17 3300025921 Ga0207652_10000546 Ga0207652_100005469 298
18 3300037471 Ga0395905_0329229 Ga0395905_0329229_501_1397 298
19 3300028380 Ga0268265_10442332 Ga0268265_104423322 307
20 3300005347 Ga0070668_100013664 Ga0070668_1000136647 309
21 3300005718 Ga0068866_10167678 Ga0068866_101676782 309
22 3300005719 Ga0068861_100003838 Ga0068861_1000038382 309
23 3300005843 Ga0068860_100180018 Ga0068860_1001800182 309
24 3300025899 Ga0207642_10117925 Ga0207642_101179251 309
25 3300025942 Ga0207689_10010494 Ga0207689_100104944 309
26 3300025972 Ga0207668_10022072 Ga0207668_100220725 309
27 3300025972 Ga0207668_10245671 Ga0207668_102456712 309
28 3300044673 Ga0453683_0308200 Ga0453683_0308200_35_964 309
29 3300005336 Ga0070680_100063713 Ga0070680_1000637132 313
30 3300005339 Ga0070660_100238857 Ga0070660_1002388572 313
31 3300005458 Ga0070681_10058368 Ga0070681_100583682 313
32 3300005530 Ga0070679_100122118 Ga0070679_1001221182 313
33 3300005614 Ga0068856_100381536 Ga0068856_1003815361 313
34 3300013102 Ga0157371_10064172 Ga0157371_100641721 313
35 3300025909 Ga0207705_10023722 Ga0207705_100237222 313
36 3300025912 Ga0207707_10072204 Ga0207707_100722043 313
37 3300025917 Ga0207660_10028247 Ga0207660_100282473 313
38 3300025919 Ga0207657_10116109 Ga0207657_101161091 313
39 3300025921 Ga0207652_10000697 Ga0207652_100006975 313
40 3300025949 Ga0207667_10060111 Ga0207667_100601113 313
41 3300026067 Ga0207678_10008521 Ga0207678_100085215 313
42 3300037312 Ga0395899_0098873 Ga0395899_0098873_799_1839 313
43 3300037466 Ga0395898_0049581 Ga0395898_0049581_1392_2432 313
44 3300038443 Ga0395901_0116887 Ga0395901_0116887_1268_2308 313
45 3300013105 Ga0157369_10025473 Ga0157369_100254732 317
46 3300013307 Ga0157372_10111735 Ga0157372_101117352 317
47 3300026116 Ga0207674_10121843 Ga0207674_101218432 317
48 3300005367 Ga0070667_100302291 Ga0070667_1003022911 319
49 3300005544 Ga0070686_100315828 Ga0070686_1003158281 319
50 3300013104 Ga0157370_10001951 Ga0157370_1000195112 319
51 3300013307 Ga0157372_10111875 Ga0157372_101118751 319
52 3300028381 Ga0268264_10006791 Ga0268264_100067913 319
53 3300037312 Ga0395899_0001590 Ga0395899_0001590_11893_12852 319
54 3300037312 Ga0395899_0311789 Ga0395899_0311789_49_1008 319
55 3300037418 Ga0395900_0004139 Ga0395900_0004139_6106_7065 319
56 3300037418 Ga0395900_0005994 Ga0395900_0005994_1457_2416 319
57 3300037466 Ga0395898_0001279 Ga0395898_0001279_22155_23114 319
58 3300038443 Ga0395901_0004694 Ga0395901_0004694_4419_5378 319
59 3300013306 Ga0163162_10004586 Ga0163162_1000458612 320
60 3300046537 Ga0495598_0087091 Ga0495598_0087091_38_1000 320
61 3300005618 Ga0068864_100208268 Ga0068864_1002082682 331
62 3300025961 Ga0207712_10066953 Ga0207712_100669532 331
63 3300026095 Ga0207676_10138322 Ga0207676_101383221 331
64 3300009101 Ga0105247_10003642 Ga0105247_100036428 332
65 3300014325 Ga0163163_10154595 Ga0163163_101545953 332
66 3300005337 Ga0070682_100000839 Ga0070682_1000008395 334
67 3300005539 Ga0068853_100149788 Ga0068853_1001497882 334
68 3300006195 Ga0075366_10043379 Ga0075366_100433792 334
69 3300026041 Ga0207639_10053613 Ga0207639_100536133 334
70 3300005329 Ga0070683_100008951 Ga0070683_1000089518 335
71 3300005338 Ga0068868_100022247 Ga0068868_1000222475 335
72 3300005354 Ga0070675_100070064 Ga0070675_1000700642 335
73 3300005457 Ga0070662_100075043 Ga0070662_1000750432 335
74 3300005458 Ga0070681_10042587 Ga0070681_100425874 335
75 3300005458 Ga0070681_10285944 Ga0070681_102859442 335
76 3300005535 Ga0070684_100025026 Ga0070684_1000250263 335
77 3300005614 Ga0068856_100074051 Ga0068856_1000740512 335
78 3300006358 Ga0068871_100050289 Ga0068871_1000502891 335
79 3300013104 Ga0157370_10388776 Ga0157370_103887761 335
80 3300013105 Ga0157369_10059506 Ga0157369_100595062 335
81 3300013296 Ga0157374_10133988 Ga0157374_101339882 335
82 3300025912 Ga0207707_10242729 Ga0207707_102427292 335
83 3300025919 Ga0207657_10012205 Ga0207657_100122052 335
84 3300025949 Ga0207667_10103782 Ga0207667_101037823 335
85 3300026078 Ga0207702_10055438 Ga0207702_100554382 335
86 3300026121 Ga0207683_10075537 Ga0207683_100755373 335
87 3300005617 Ga0068859_100193662 Ga0068859_1001936623 336
88 3300006931 Ga0097620_100193686 Ga0097620_1001936863 336
89 3300025900 Ga0207710_10036557 Ga0207710_100365572 336
90 3300006195 Ga0075366_10084244 Ga0075366_100842441 337
91 3300009553 Ga0105249_10116693 Ga0105249_101166932 337
92 3300050508 nmdc:mga09592_141298_c1 nmdc:mga09592_141298_c1_25_1038 337
93 3300013104 Ga0157370_10482858 Ga0157370_104828581 338
94 3300025944 Ga0207661_10064891 Ga0207661_100648912 338
95 3300003323 rootH1_10204152 rootH1_102041521 345
96 3300005295 Ga0065707_10097497 Ga0065707_100974972 345
97 3300005328 Ga0070676_10008849 Ga0070676_100088495 345
98 3300005329 Ga0070683_100000211 Ga0070683_10000021133 345
99 3300005331 Ga0070670_100059876 Ga0070670_1000598763 345
100 3300005334 Ga0068869_100084065 Ga0068869_1000840653 345
101 3300005335 Ga0070666_10018002 Ga0070666_100180024 345
102 3300005338 Ga0068868_100006735 Ga0068868_1000067357 345
103 3300005338 Ga0068868_100038859 Ga0068868_1000388596 345
104 3300005340 Ga0070689_100040741 Ga0070689_1000407414 345
105 3300005340 Ga0070689_100067798 Ga0070689_1000677983 345
106 3300005344 Ga0070661_100006697 Ga0070661_1000066976 345
107 3300005344 Ga0070661_100024352 Ga0070661_1000243525 345
108 3300005353 Ga0070669_100002091 Ga0070669_1000020917 345
109 3300005353 Ga0070669_100140391 Ga0070669_1001403912 345
110 3300005355 Ga0070671_100174229 Ga0070671_1001742291 345
111 3300005356 Ga0070674_100074879 Ga0070674_1000748792 345
112 3300005364 Ga0070673_100007156 Ga0070673_1000071562 345
113 3300005364 Ga0070673_100011359 Ga0070673_1000113593 345
114 3300005364 Ga0070673_100014508 Ga0070673_1000145085 345
115 3300005364 Ga0070673_100058672 Ga0070673_1000586723 345
116 3300005364 Ga0070673_100178773 Ga0070673_1001787732 345
117 3300005365 Ga0070688_100006223 Ga0070688_1000062231 345
118 3300005365 Ga0070688_100047324 Ga0070688_1000473242 345
119 3300005365 Ga0070688_100108902 Ga0070688_1001089022 345
120 3300005366 Ga0070659_100036241 Ga0070659_1000362412 345
121 3300005367 Ga0070667_100022473 Ga0070667_1000224738 345
122 3300005367 Ga0070667_100061418 Ga0070667_1000614182 345
123 3300005457 Ga0070662_100002963 Ga0070662_1000029637 345
124 3300005457 Ga0070662_100046564 Ga0070662_1000465644 345
125 3300005457 Ga0070662_100100635 Ga0070662_1001006352 345
126 3300005459 Ga0068867_100012907 Ga0068867_1000129072 345
127 3300005459 Ga0068867_100026915 Ga0068867_1000269155 345
128 3300005459 Ga0068867_100033160 Ga0068867_1000331603 345
129 3300005459 Ga0068867_100226148 Ga0068867_1002261481 345
130 3300005471 Ga0070698_100002098 Ga0070698_10000209816 345
131 3300005535 Ga0070684_100000568 Ga0070684_10000056825 345
132 3300005535 Ga0070684_100006999 Ga0070684_10000699911 345
133 3300005539 Ga0068853_100039686 Ga0068853_1000396863 345
134 3300005539 Ga0068853_100060886 Ga0068853_1000608864 345
135 3300005543 Ga0070672_100056638 Ga0070672_1000566383 345
136 3300005543 Ga0070672_100099984 Ga0070672_1000999843 345
137 3300005543 Ga0070672_100114552 Ga0070672_1001145522 345
138 3300005548 Ga0070665_100203365 Ga0070665_1002033653 345
139 3300005564 Ga0070664_100003902 Ga0070664_1000039027 345
140 3300005577 Ga0068857_100019417 Ga0068857_1000194172 345
141 3300005577 Ga0068857_100067965 Ga0068857_1000679654 345
142 3300005577 Ga0068857_100084201 Ga0068857_1000842013 345
143 3300005578 Ga0068854_100010782 Ga0068854_1000107826 345
144 3300005617 Ga0068859_100012192 Ga0068859_1000121925 345
145 3300005617 Ga0068859_100014826 Ga0068859_1000148267 345
146 3300005617 Ga0068859_100029379 Ga0068859_1000293796 345
147 3300005617 Ga0068859_100085891 Ga0068859_1000858914 345
148 3300005617 Ga0068859_100121868 Ga0068859_1001218683 345
149 3300005618 Ga0068864_100319060 Ga0068864_1003190601 345
150 3300005718 Ga0068866_10077129 Ga0068866_100771291 345
151 3300005719 Ga0068861_100015284 Ga0068861_1000152846 345
152 3300005719 Ga0068861_100018566 Ga0068861_1000185664 345
153 3300005719 Ga0068861_100039890 Ga0068861_1000398902 345
154 3300005719 Ga0068861_100081633 Ga0068861_1000816332 345
155 3300005840 Ga0068870_10010630 Ga0068870_100106306 345
156 3300005840 Ga0068870_10062134 Ga0068870_100621342 345
157 3300005840 Ga0068870_10104884 Ga0068870_101048843 345
158 3300005841 Ga0068863_100148941 Ga0068863_1001489412 345
159 3300005842 Ga0068858_100020473 Ga0068858_1000204732 345
160 3300005843 Ga0068860_100442974 Ga0068860_1004429741 345
161 3300005844 Ga0068862_100008262 Ga0068862_1000082629 345
162 3300005844 Ga0068862_100066279 Ga0068862_1000662793 345
163 3300006237 Ga0097621_100016613 Ga0097621_1000166133 345
164 3300006237 Ga0097621_100302369 Ga0097621_1003023692 345
165 3300006358 Ga0068871_100026639 Ga0068871_1000266392 345
166 3300006844 Ga0075428_100002349 Ga0075428_10000234919 345
167 3300006844 Ga0075428_100204297 Ga0075428_1002042972 345
168 3300006846 Ga0075430_100013143 Ga0075430_1000131433 345
169 3300006847 Ga0075431_100035126 Ga0075431_1000351267 345
170 3300006880 Ga0075429_100004013 Ga0075429_10000401313 345
171 3300006880 Ga0075429_100180427 Ga0075429_1001804272 345
172 3300006881 Ga0068865_100021051 Ga0068865_1000210512 345
173 3300006881 Ga0068865_100036227 Ga0068865_1000362272 345
174 3300006931 Ga0097620_100012190 Ga0097620_1000121905 345
175 3300006931 Ga0097620_100014825 Ga0097620_1000148253 345
176 3300006931 Ga0097620_100029379 Ga0097620_1000293795 345
177 3300006931 Ga0097620_100085883 Ga0097620_1000858834 345
178 3300006931 Ga0097620_100121868 Ga0097620_1001218683 345
179 3300009094 Ga0111539_10003454 Ga0111539_1000345420 345
180 3300009094 Ga0111539_10110494 Ga0111539_101104942 345
181 3300009174 Ga0105241_10129031 Ga0105241_101290313 345
182 3300009176 Ga0105242_10016017 Ga0105242_100160176 345
183 3300009176 Ga0105242_10028031 Ga0105242_100280312 345
184 3300009176 Ga0105242_10037252 Ga0105242_100372524 345
185 3300009176 Ga0105242_10117490 Ga0105242_101174903 345
186 3300009176 Ga0105242_10365256 Ga0105242_103652561 345
187 3300009553 Ga0105249_10004716 Ga0105249_100047167 345
188 3300009553 Ga0105249_10010856 Ga0105249_100108563 345
189 3300009553 Ga0105249_10406848 Ga0105249_104068482 345
190 3300010375 Ga0105239_10074626 Ga0105239_100746262 345
191 3300010375 Ga0105239_10105555 Ga0105239_101055552 345
192 3300011119 Ga0105246_10008960 Ga0105246_100089602 345
193 3300013100 Ga0157373_10023654 Ga0157373_100236542 345
194 3300013296 Ga0157374_10008376 Ga0157374_100083765 345
195 3300013296 Ga0157374_10014583 Ga0157374_100145832 345
196 3300013296 Ga0157374_10024342 Ga0157374_100243425 345
197 3300013296 Ga0157374_10138216 Ga0157374_101382163 345
198 3300013296 Ga0157374_10138301 Ga0157374_101383013 345
199 3300013297 Ga0157378_10076110 Ga0157378_100761102 345
200 3300013306 Ga0163162_10059108 Ga0163162_100591085 345
201 3300013308 Ga0157375_10005137 Ga0157375_100051372 345
202 3300013308 Ga0157375_10083868 Ga0157375_100838683 345
203 3300013308 Ga0157375_10227773 Ga0157375_102277732 345
204 3300013308 Ga0157375_10591467 Ga0157375_105914671 345
205 3300014325 Ga0163163_10013146 Ga0163163_100131462 345
206 3300014325 Ga0163163_10370851 Ga0163163_103708512 345
207 3300014326 Ga0157380_10025275 Ga0157380_100252754 345
208 3300014326 Ga0157380_10039474 Ga0157380_100394743 345
209 3300014326 Ga0157380_10113199 Ga0157380_101131992 345
210 3300014745 Ga0157377_10003164 Ga0157377_100031648 345
211 3300014745 Ga0157377_10003472 Ga0157377_100034722 345
212 3300014968 Ga0157379_10061033 Ga0157379_100610334 345
213 3300014969 Ga0157376_10041114 Ga0157376_100411143 345
214 3300017792 Ga0163161_10010065 Ga0163161_100100657 345
215 3300017792 Ga0163161_10086782 Ga0163161_100867823 345
216 3300025315 Ga0207697_10023296 Ga0207697_100232962 345
217 3300025893 Ga0207682_10025539 Ga0207682_100255392 345
218 3300025899 Ga0207642_10010665 Ga0207642_100106654 345
219 3300025901 Ga0207688_10055057 Ga0207688_100550572 345
220 3300025901 Ga0207688_10092956 Ga0207688_100929562 345
221 3300025904 Ga0207647_10122675 Ga0207647_101226751 345
222 3300025907 Ga0207645_10008320 Ga0207645_100083205 345
223 3300025907 Ga0207645_10008581 Ga0207645_100085813 345
224 3300025907 Ga0207645_10020979 Ga0207645_100209793 345
225 3300025907 Ga0207645_10088355 Ga0207645_100883552 345
226 3300025908 Ga0207643_10004789 Ga0207643_100047892 345
227 3300025908 Ga0207643_10023686 Ga0207643_100236864 345
228 3300025920 Ga0207649_10005653 Ga0207649_100056536 345
229 3300025923 Ga0207681_10028136 Ga0207681_100281362 345
230 3300025923 Ga0207681_10122513 Ga0207681_101225132 345
231 3300025925 Ga0207650_10052379 Ga0207650_100523794 345
232 3300025926 Ga0207659_10066957 Ga0207659_100669573 345
233 3300025931 Ga0207644_10150092 Ga0207644_101500922 345
234 3300025931 Ga0207644_10251164 Ga0207644_102511641 345
235 3300025932 Ga0207690_10050106 Ga0207690_100501063 345
236 3300025933 Ga0207706_10022666 Ga0207706_100226662 345
237 3300025934 Ga0207686_10001727 Ga0207686_100017279 345
238 3300025934 Ga0207686_10027849 Ga0207686_100278492 345
239 3300025936 Ga0207670_10022239 Ga0207670_100222394 345
240 3300025936 Ga0207670_10038548 Ga0207670_100385482 345
241 3300025936 Ga0207670_10043689 Ga0207670_100436892 345
242 3300025937 Ga0207669_10187472 Ga0207669_101874721 345
243 3300025937 Ga0207669_10309630 Ga0207669_103096301 345
244 3300025938 Ga0207704_10036651 Ga0207704_100366512 345
245 3300025940 Ga0207691_10007169 Ga0207691_100071693 345
246 3300025940 Ga0207691_10112716 Ga0207691_101127163 345
247 3300025940 Ga0207691_10129221 Ga0207691_101292213 345
248 3300025940 Ga0207691_10133069 Ga0207691_101330692 345
249 3300025940 Ga0207691_10184685 Ga0207691_101846852 345
250 3300025942 Ga0207689_10013015 Ga0207689_100130157 345
251 3300025942 Ga0207689_10043720 Ga0207689_100437203 345
252 3300025942 Ga0207689_10047343 Ga0207689_100473436 345
253 3300025942 Ga0207689_10090649 Ga0207689_100906493 345
254 3300025944 Ga0207661_10003519 Ga0207661_100035199 345
255 3300025944 Ga0207661_10013659 Ga0207661_100136596 345
256 3300025944 Ga0207661_10029870 Ga0207661_100298704 345
257 3300025960 Ga0207651_10012448 Ga0207651_100124484 345
258 3300025960 Ga0207651_10077021 Ga0207651_100770213 345
259 3300025961 Ga0207712_10068905 Ga0207712_100689053 345
260 3300025961 Ga0207712_10346175 Ga0207712_103461751 345
261 3300025972 Ga0207668_10065618 Ga0207668_100656183 345
262 3300025986 Ga0207658_10189757 Ga0207658_101897572 345
263 3300026023 Ga0207677_10043827 Ga0207677_100438273 345
264 3300026023 Ga0207677_10051822 Ga0207677_100518222 345
265 3300026023 Ga0207677_10137939 Ga0207677_101379392 345
266 3300026035 Ga0207703_10347956 Ga0207703_103479561 345
267 3300026035 Ga0207703_10400238 Ga0207703_104002382 345
268 3300026041 Ga0207639_10041374 Ga0207639_100413744 345
269 3300026041 Ga0207639_10080415 Ga0207639_100804154 345
270 3300026088 Ga0207641_10023102 Ga0207641_100231027 345
271 3300026088 Ga0207641_10110982 Ga0207641_101109822 345
272 3300026089 Ga0207648_10002952 Ga0207648_100029522 345
273 3300026089 Ga0207648_10003655 Ga0207648_1000365516 345
274 3300026089 Ga0207648_10006979 Ga0207648_100069799 345
275 3300026089 Ga0207648_10046998 Ga0207648_100469983 345
276 3300026116 Ga0207674_10001890 Ga0207674_100018901 345
277 3300026116 Ga0207674_10004509 Ga0207674_1000450911 345
278 3300026116 Ga0207674_10044776 Ga0207674_100447763 345
279 3300026116 Ga0207674_10106245 Ga0207674_101062452 345
280 3300026118 Ga0207675_100000359 Ga0207675_10000035934 345
281 3300026118 Ga0207675_100008546 Ga0207675_1000085467 345
282 3300026118 Ga0207675_100062813 Ga0207675_1000628134 345
283 3300026118 Ga0207675_100077748 Ga0207675_1000777481 345
284 3300026118 Ga0207675_100110239 Ga0207675_1001102391 345
285 3300026121 Ga0207683_10001842 Ga0207683_100018428 345
286 3300026121 Ga0207683_10137141 Ga0207683_101371412 345
287 3300026142 Ga0207698_10084807 Ga0207698_100848072 345
288 3300027907 Ga0207428_10074585 Ga0207428_100745852 345
289 3300027907 Ga0207428_10101001 Ga0207428_101010012 345
290 3300028379 Ga0268266_10036019 Ga0268266_100360195 345
291 3300028379 Ga0268266_10099400 Ga0268266_100994003 345
292 3300028379 Ga0268266_10113813 Ga0268266_101138133 345
293 3300028380 Ga0268265_10004817 Ga0268265_100048174 345
294 3300028381 Ga0268264_10076822 Ga0268264_100768221 345
295 3300028381 Ga0268264_10107338 Ga0268264_101073383 345
296 3300031456 Ga0307513_10200947 Ga0307513_102009472 345
297 3300044712 Ga0453684_0167923 Ga0453684_0167923_1302_2339 345
298 3300046471 Ga0495650_0034129 Ga0495650_0034129_626_1672 345
299 3300046511 Ga0495608_0016709 Ga0495608_0016709_795_1838 345
300 3300046516 Ga0495628_0064270 Ga0495628_0064270_532_1575 345
301 3300046517 Ga0495630_0025276 Ga0495630_0025276_1293_2336 345
302 3300046533 Ga0495640_0086995 Ga0495640_0086995_119_1162 345
303 3300046642 Ga0495634_0086022 Ga0495634_0086022_763_1806 345
304 3300046663 Ga0495635_0035766 Ga0495635_0035766_843_1886 345
305 3300046680 Ga0495646_0034961 Ga0495646_0034961_780_1823 345
306 3300047319 Ga0495674_0132895 Ga0495674_0132895_29_1072 345
307 3300047320 Ga0495672_0007681 Ga0495672_0007681_1659_2702 345
308 3300047320 Ga0495672_0018066 Ga0495672_0018066_1539_2582 345
309 3300047322 Ga0495680_0064105 Ga0495680_0064105_205_1248 345
310 3300047472 Ga0495686_0039754 Ga0495686_0039754_1931_2974 345
311 3300047472 Ga0495686_0159717 Ga0495686_0159717_42_1085 345
312 3300049568 Ga0501031_0029299 Ga0501031_0029299_1071_2114 345
313 3300049569 Ga0501032_0006173 Ga0501032_0006173_4860_5906 345
314 3300049569 Ga0501032_0046898 Ga0501032_0046898_707_1750 345
315 3300049571 Ga0501034_0174542 Ga0501034_0174542_1002_2045 345
316 3300049572 Ga0501036_0011056 Ga0501036_0011056_6045_7088 345
317 3300049573 Ga0501037_0006584 Ga0501037_0006584_7341_8384 345
318 3300049574 Ga0501038_0016450 Ga0501038_0016450_2732_3775 345
319 3300049574 Ga0501038_0209450 Ga0501038_0209450_310_1356 345
320 3300049575 Ga0501039_0040623 Ga0501039_0040623_1062_2105 345
321 3300049575 Ga0501039_0094611 Ga0501039_0094611_196_1242 345
322 3300049579 Ga0501043_0004526 Ga0501043_0004526_3137_4183 345
323 3300049580 Ga0501046_0003983 Ga0501046_0003983_7849_8895 345
324 3300049580 Ga0501046_0024453 Ga0501046_0024453_1513_2556 345
325 3300049581 Ga0501047_0257604 Ga0501047_0257604_353_1399 345
326 3300049582 Ga0501048_0046639 Ga0501048_0046639_1957_3003 345
327 3300049586 Ga0501070_0021578 Ga0501070_0021578_1337_2383 345
328 3300049589 Ga0501073_0000371 Ga0501073_0000371_4461_5507 345
329 3300049590 Ga0501074_0016939 Ga0501074_0016939_3584_4630 345
330 3300049741 Ga0501079_0102993 Ga0501079_0102993_543_1589 345
331 3300049742 Ga0501080_0087094 Ga0501080_0087094_894_1940 345
332 3300049823 Ga0501044_0101383 Ga0501044_0101383_1028_2071 345
333 3300049823 Ga0501044_0149490 Ga0501044_0149490_214_1260 345
334 3300050508 nmdc:mga09592_84060_c1 nmdc:mga09592_84060_c1_718_1761 345
335 3300050510 nmdc:mga06r32_93200_c1 nmdc:mga06r32_93200_c1_865_1995 345
336 3300050511 nmdc:mga08y16_3350_c1 nmdc:mga08y16_3350_c1_2341_3384 345
337 3300053085 Ga0495619_0059311 Ga0495619_0059311_1048_2091 345
338 3300053139 Ga0500568_0000562 Ga0500568_0000562_14195_15232 345
339 3300053727 Ga0500611_000092 Ga0500611_000092_16308_17348 345
340 3300005329 Ga0070683_100175638 Ga0070683_1001756383 346
341 3300005336 Ga0070680_100029490 Ga0070680_1000294903 346
342 3300005339 Ga0070660_100036738 Ga0070660_1000367383 346
343 3300005339 Ga0070660_100046555 Ga0070660_1000465551 346
344 3300005339 Ga0070660_100084642 Ga0070660_1000846421 346
345 3300005366 Ga0070659_100009607 Ga0070659_1000096076 346
346 3300005458 Ga0070681_10078835 Ga0070681_100788354 346
347 3300005458 Ga0070681_10090375 Ga0070681_100903753 346
348 3300005530 Ga0070679_100011352 Ga0070679_1000113524 346
349 3300005539 Ga0068853_100040732 Ga0068853_1000407322 346
350 3300005563 Ga0068855_100053098 Ga0068855_1000530985 346
351 3300005577 Ga0068857_100200554 Ga0068857_1002005542 346
352 3300013100 Ga0157373_10005431 Ga0157373_100054318 346
353 3300013100 Ga0157373_10079707 Ga0157373_100797072 346
354 3300013102 Ga0157371_10000932 Ga0157371_100009327 346
355 3300013102 Ga0157371_10098152 Ga0157371_100981522 346
356 3300013102 Ga0157371_10136068 Ga0157371_101360682 346
357 3300013102 Ga0157371_10287110 Ga0157371_102871102 346
358 3300013105 Ga0157369_10084258 Ga0157369_100842583 346
359 3300013105 Ga0157369_10183628 Ga0157369_101836283 346
360 3300013105 Ga0157369_10365155 Ga0157369_103651552 346
361 3300013307 Ga0157372_10367893 Ga0157372_103678932 346
362 3300025904 Ga0207647_10176917 Ga0207647_101769171 346
363 3300025909 Ga0207705_10076115 Ga0207705_100761153 346
364 3300025917 Ga0207660_10084884 Ga0207660_100848843 346
365 3300025919 Ga0207657_10062733 Ga0207657_100627332 346
366 3300025919 Ga0207657_10078741 Ga0207657_100787413 346
367 3300025919 Ga0207657_10108985 Ga0207657_101089852 346
368 3300025921 Ga0207652_10017232 Ga0207652_100172323 346
369 3300025921 Ga0207652_10413662 Ga0207652_104136621 346
370 3300025944 Ga0207661_10254553 Ga0207661_102545532 346
371 3300025949 Ga0207667_10058892 Ga0207667_100588924 346
372 3300026116 Ga0207674_10024037 Ga0207674_100240373 346
373 3300037466 Ga0395898_0041168 Ga0395898_0041168_3483_4523 346
374 3300037466 Ga0395898_0170838 Ga0395898_0170838_560_1600 346
375 3300037471 Ga0395905_0169705 Ga0395905_0169705_555_1595 346
376 3300038443 Ga0395901_0007368 Ga0395901_0007368_6989_8029 346
377 3300049571 Ga0501034_0302011 Ga0501034_0302011_231_1271 346
378 3300049579 Ga0501043_0060263 Ga0501043_0060263_25_1065 346
379 3300049586 Ga0501070_0052241 Ga0501070_0052241_748_1788 346
380 3300049822 Ga0501035_0259659 Ga0501035_0259659_216_1256 346
381 3300005327 Ga0070658_10014938 Ga0070658_100149382 348
382 3300005337 Ga0070682_100010328 Ga0070682_1000103282 348
383 3300005337 Ga0070682_100023486 Ga0070682_1000234863 348
384 3300005458 Ga0070681_10083510 Ga0070681_100835103 348
385 3300005530 Ga0070679_100001843 Ga0070679_1000018439 348
386 3300005539 Ga0068853_100032600 Ga0068853_1000326003 348
387 3300005539 Ga0068853_100123171 Ga0068853_1001231712 348
388 3300005578 Ga0068854_100102963 Ga0068854_1001029631 348
389 3300005614 Ga0068856_100021551 Ga0068856_1000215514 348
390 3300005616 Ga0068852_100000563 Ga0068852_10000056322 348
391 3300009093 Ga0105240_10488342 Ga0105240_104883422 348
392 3300009545 Ga0105237_10066269 Ga0105237_100662692 348
393 3300010375 Ga0105239_10064401 Ga0105239_100644013 348
394 3300013100 Ga0157373_10021980 Ga0157373_100219805 348
395 3300013102 Ga0157371_10022360 Ga0157371_100223603 348
396 3300013102 Ga0157371_10115620 Ga0157371_101156202 348
397 3300013104 Ga0157370_10001963 Ga0157370_1000196312 348
398 3300013104 Ga0157370_10151079 Ga0157370_101510793 348
399 3300013307 Ga0157372_10101571 Ga0157372_101015714 348
400 3300025899 Ga0207642_10023623 Ga0207642_100236233 348
401 3300025909 Ga0207705_10003539 Ga0207705_1000353911 348
402 3300025909 Ga0207705_10078713 Ga0207705_100787132 348
403 3300025909 Ga0207705_10223887 Ga0207705_102238871 348
404 3300025911 Ga0207654_10035846 Ga0207654_100358463 348
405 3300025913 Ga0207695_10042677 Ga0207695_100426774 348
406 3300025921 Ga0207652_10001189 Ga0207652_1000118911 348
407 3300025949 Ga0207667_10087799 Ga0207667_100877993 348
408 3300025981 Ga0207640_10359544 Ga0207640_103595441 348
409 3300026142 Ga0207698_10036983 Ga0207698_100369833 348
410 3300026142 Ga0207698_10126464 Ga0207698_101264643 348
411 3300049822 Ga0501035_0071677 Ga0501035_0071677_910_1974 348
412 3300005329 Ga0070683_100150586 Ga0070683_1001505862 349
413 3300005338 Ga0068868_100175144 Ga0068868_1001751441 349
414 3300005339 Ga0070660_100108028 Ga0070660_1001080281 349
415 3300005344 Ga0070661_100110934 Ga0070661_1001109343 349
416 3300005355 Ga0070671_100209185 Ga0070671_1002091851 349
417 3300005364 Ga0070673_100039356 Ga0070673_1000393563 349
418 3300005366 Ga0070659_100016082 Ga0070659_1000160828 349
419 3300005530 Ga0070679_100122541 Ga0070679_1001225413 349
420 3300005535 Ga0070684_100006331 Ga0070684_1000063319 349
421 3300005539 Ga0068853_100180012 Ga0068853_1001800121 349
422 3300005543 Ga0070672_100049424 Ga0070672_1000494243 349
423 3300005563 Ga0068855_100004190 Ga0068855_1000041909 349
424 3300005564 Ga0070664_100008242 Ga0070664_1000082429 349
425 3300005616 Ga0068852_100046492 Ga0068852_1000464923 349
426 3300005834 Ga0068851_10039335 Ga0068851_100393352 349
427 3300013102 Ga0157371_10003421 Ga0157371_100034218 349
428 3300013102 Ga0157371_10003608 Ga0157371_100036083 349
429 3300013102 Ga0157371_10003924 Ga0157371_100039242 349
430 3300013102 Ga0157371_10033448 Ga0157371_100334481 349
431 3300013104 Ga0157370_10003393 Ga0157370_1000339310 349
432 3300013105 Ga0157369_10094153 Ga0157369_100941532 349
433 3300013296 Ga0157374_10115391 Ga0157374_101153911 349
434 3300013307 Ga0157372_10070768 Ga0157372_100707682 349
435 3300013307 Ga0157372_10294196 Ga0157372_102941962 349
436 3300014325 Ga0163163_10067486 Ga0163163_100674863 349
437 3300025321 Ga0207656_10025035 Ga0207656_100250353 349
438 3300025904 Ga0207647_10006080 Ga0207647_100060808 349
439 3300025920 Ga0207649_10039137 Ga0207649_100391373 349
440 3300025925 Ga0207650_10255965 Ga0207650_102559653 349
441 3300025932 Ga0207690_10015077 Ga0207690_100150776 349
442 3300025932 Ga0207690_10239662 Ga0207690_102396622 349
443 3300025940 Ga0207691_10055970 Ga0207691_100559703 349
444 3300025944 Ga0207661_10131880 Ga0207661_101318802 349
445 3300026023 Ga0207677_10075912 Ga0207677_100759122 349
446 3300026095 Ga0207676_10144436 Ga0207676_101444363 349
447 3300026142 Ga0207698_10013319 Ga0207698_100133192 349
448 3300026142 Ga0207698_10133506 Ga0207698_101335063 349
449 3300031824 Ga0307413_10043532 Ga0307413_100435322 349
450 3300031901 Ga0307406_10149211 Ga0307406_101492112 349
451 3300037418 Ga0395900_0102716 Ga0395900_0102716_305_1360 349
452 3300037471 Ga0395905_0005471 Ga0395905_0005471_854_1909 349
453 3300044673 Ga0453683_0039870 Ga0453683_0039870_1074_2129 349
454 3300044712 Ga0453684_0133328 Ga0453684_0133328_1196_2251 349
455 3300046616 Ga0495668_0001051 Ga0495668_0001051_24732_25820 349
456 3300049571 Ga0501034_0000017 Ga0501034_0000017_48914_49966 349
457 3300049681 Ga0501251_001149 Ga0501251_001149_701_1756 349
458 3300049686 Ga0501257_006945 Ga0501257_006945_171_1226 349
459 3300049688 Ga0501259_000124 Ga0501259_000124_2040_3095 349
460 3300049708 Ga0501245_001763 Ga0501245_001763_732_1787 349
461 3300049763 Ga0501266_000169 Ga0501266_000169_4707_5762 349
462 3300005353 Ga0070669_100038970 Ga0070669_1000389704 350
463 3300005842 Ga0068858_100056539 Ga0068858_1000565394 350
464 3300013104 Ga0157370_10213567 Ga0157370_102135672 350
465 3300013307 Ga0157372_10589570 Ga0157372_105895701 350
466 3300017792 Ga0163161_10125675 Ga0163161_101256752 350
467 3300025908 Ga0207643_10074084 Ga0207643_100740842 350
468 3300025923 Ga0207681_10160457 Ga0207681_101604572 350
469 3300025934 Ga0207686_10001727 Ga0207686_1000172712 350
470 3300025960 Ga0207651_10211176 Ga0207651_102111761 350
471 3300025986 Ga0207658_10145790 Ga0207658_101457902 350
472 3300026035 Ga0207703_10028962 Ga0207703_100289623 350
473 3300026075 Ga0207708_10084134 Ga0207708_100841342 350
474 3300026095 Ga0207676_10152850 Ga0207676_101528502 350
475 3300026118 Ga0207675_100020892 Ga0207675_1000208924 350
476 3300042001 Ga0439441_003317 Ga0439441_003317_172_1224 350
477 3300003203 JGI25406J46586_10034817 JGI25406J46586_100348172 352
478 3300005985 Ga0081539_10001245 Ga0081539_1000124537 352

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lg5-assembly1.cif.gz_A synechocystis sp. utex2470 cyanophycin synthetase 1 with atp 0.6981 45 302
7waf-assembly1.cif.gz_B trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas and 4x(beta-asp-arg) 0.6949 56 304
7waf-assembly1.cif.gz_C trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas and 4x(beta-asp-arg) 0.6944 56 304
7lgj-assembly1.cif.gz_A cyanophycin synthetase 1 from synechocystis sp. utex2470 with adpcp and 8x(asp-arg)-nh2 0.6924 45 302
5k2m-assembly1.cif.gz_A bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma-aaa 0.6888 52 308
ID Description Score Start End Superfamily
af_Q58407_112_176_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.8117 70 135 3.30.1490.20
af_Q58407_112_176_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.801 70 135 3.30.1490.20
af_Q9XUC3_200_260_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.7946 82 135 3.30.1490.20
af_A0A1D6F4U5_662_787_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7927 70 135 3.30.470.20
af_D4ADZ3_130_196_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.7835 70 135 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A849UW95-F1-model_v4 D-alanine--D-alanine ligase 0.9814 1 344 GO:0003824
GO:0005524
AF-A0A4P7PRX6-F1-model_v4 D-alanine--D-alanine ligase 0.9797 50 340 GO:0003824
GO:0005524
AF-A0A832BR10-F1-model_v4 D-alanine--D-alanine ligase 0.9776 3 344 GO:0016020
GO:0016874
AF-A0A1G3J283-F1-model_v4 D-alanine--D-alanine ligase 0.9772 2 340 GO:0005524
GO:0016020
GO:0016874
AF-A0A1V5G8F1-F1-model_v4 Carbamoyl phosphate synthase-like protein 0.9767 1 344 GO:0003824
GO:0005524

Feature Viewer

pLDDT pTM Quality
91.54 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map