F451784

General Info

Members Datasets Scaffolds Average Seq Length
477 270 477 142

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0052205|Ga0501034_0052205_1495_1944
Length 149
Sequence MAKKVTAQIKLQIPAGAARPAPPVGPALGQAGVNIKQFCDQFNERTKAQAADGMAIPVVITVYADRSFTFETKVPPVSALVKKAAGLPTVKKPGSGSGEPNRRKVGTITTAQVRAIATQKLSDLNATKLESAMSQVAGTARSMGIDVVD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
187 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
188 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
196 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
197 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
198 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
199 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 4.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 2.52
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3744550 2162886007 Bacteria 1043
2 JGI24746J21847_1000129 3300001977 Bacteria 9195
3 JGI24744J21845_10008544 3300002077 Bacteria 2105
4 JGI24033J26618_1003213 3300002155 Bacteria 1713
5 rootH2_10042645 3300003320 Bacteria 2701
6 rootH2_10097490 3300003320 Bacteria 3634
7 rootH1_10159199 3300003323 Bacteria 1937
8 rootH1_10226936 3300003323 Bacteria 1054
9 Ga0058859_11243853 3300004798 Bacteria 738
10 Ga0065704_10101503 3300005289 Bacteria 2224
11 Ga0070658_10014610 3300005327 Bacteria 6301
12 Ga0070658_10018910 3300005327 Bacteria 5519
13 Ga0070658_10022791 3300005327 Bacteria 5025
14 Ga0070658_10086656 3300005327 Bacteria 2576
15 Ga0070658_10434531 3300005327 Bacteria 1130
16 Ga0070658_10540917 3300005327 Bacteria 1008
17 Ga0070658_10716402 3300005327 Bacteria 869
18 Ga0070676_10374143 3300005328 Bacteria 985
19 Ga0070676_10387226 3300005328 Bacteria 969
20 Ga0070676_10433390 3300005328 Bacteria 921
21 Ga0070676_10674073 3300005328 Bacteria 753
22 Ga0070683_100033824 3300005329 Bacteria 4664
23 Ga0070683_100478551 3300005329 Bacteria 1189
24 Ga0070690_100410838 3300005330 Bacteria 996
25 Ga0068869_100095216 3300005334 Bacteria 2246
26 Ga0068869_100709289 3300005334 Bacteria 858
27 Ga0070666_10008416 3300005335 Bacteria 6406
28 Ga0070666_10030398 3300005335 Bacteria 3558
29 Ga0070666_10193715 3300005335 Bacteria 1429
30 Ga0070680_100097508 3300005336 Bacteria 2437
31 Ga0070660_100043594 3300005339 Bacteria 3429
32 Ga0070660_100053656 3300005339 Bacteria 3110
33 Ga0070660_100208032 3300005339 Bacteria 1588
34 Ga0070691_10541395 3300005341 Bacteria 679
35 Ga0070687_100342740 3300005343 Bacteria 962
36 Ga0070661_100005986 3300005344 Bacteria 8370
37 Ga0070661_100116077 3300005344 Bacteria 2002
38 Ga0070661_100149332 3300005344 Bacteria 1766
39 Ga0070661_100232555 3300005344 Bacteria 1417
40 Ga0070668_100048812 3300005347 Bacteria 3256
41 Ga0070668_100909886 3300005347 Bacteria 787
42 Ga0070669_100000022 3300005353 Bacteria 177723
43 Ga0070669_100649055 3300005353 Bacteria 888
44 Ga0070674_100834961 3300005356 Bacteria 798
45 Ga0070674_101169228 3300005356 Bacteria 682
46 Ga0070688_100084609 3300005365 Bacteria 2060
47 Ga0070659_100045036 3300005366 Bacteria 3456
48 Ga0070659_100095620 3300005366 Bacteria 2386
49 Ga0070667_100308272 3300005367 Bacteria 1426
50 Ga0070667_101093761 3300005367 Bacteria 745
51 Ga0070709_10075967 3300005434 Bacteria 2181
52 Ga0070709_10397132 3300005434 Bacteria 1029
53 Ga0070709_11437206 3300005434 Bacteria 559
54 Ga0070714_100866192 3300005435 Bacteria 876
55 Ga0070713_100035314 3300005436 Bacteria 4023
56 Ga0070713_100433592 3300005436 Bacteria 1232
57 Ga0070713_100674346 3300005436 Bacteria 986
58 Ga0070705_100161694 3300005440 Bacteria 1498
59 Ga0070705_101400167 3300005440 Bacteria 583
60 Ga0070694_100960999 3300005444 Bacteria 708
61 Ga0070663_100035762 3300005455 Bacteria 3448
62 Ga0070663_100134198 3300005455 Bacteria 1883
63 Ga0070663_100190063 3300005455 Bacteria 1597
64 Ga0070663_100268720 3300005455 Bacteria 1355
65 Ga0070663_101007486 3300005455 Bacteria 724
66 Ga0070681_10041854 3300005458 Bacteria 4592
67 Ga0070681_10458560 3300005458 Bacteria 1187
68 Ga0070681_10548400 3300005458 Bacteria 1070
69 Ga0070681_10947595 3300005458 Bacteria 780
70 Ga0068867_100000425 3300005459 Bacteria 28223
71 Ga0070685_10011019 3300005466 Bacteria 4718
72 Ga0070685_10066252 3300005466 Bacteria 2128
73 Ga0070685_10665113 3300005466 Bacteria 756
74 Ga0070706_100016100 3300005467 Bacteria 6905
75 Ga0070698_101623389 3300005471 Bacteria 599
76 Ga0070699_100337200 3300005518 Bacteria 1357
77 Ga0070699_101359216 3300005518 Bacteria 651
78 Ga0070679_100029297 3300005530 Bacteria 5432
79 Ga0070679_100049634 3300005530 Bacteria 4179
80 Ga0070679_100521114 3300005530 Bacteria 1133
81 Ga0070684_100073693 3300005535 Bacteria 3009
82 Ga0070684_100092187 3300005535 Bacteria 2696
83 Ga0068853_100083100 3300005539 Bacteria 2805
84 Ga0068853_100132843 3300005539 Bacteria 2229
85 Ga0068853_100139365 3300005539 Bacteria 2177
86 Ga0070695_100662966 3300005545 Bacteria 825
87 Ga0070696_100280042 3300005546 Bacteria 1271
88 Ga0070693_100543099 3300005547 Bacteria 831
89 Ga0070665_100000875 3300005548 Bacteria 38817
90 Ga0070665_100728361 3300005548 Bacteria 1005
91 Ga0068855_100044007 3300005563 Bacteria 5286
92 Ga0068855_100047325 3300005563 Bacteria 5081
93 Ga0068855_100071509 3300005563 Bacteria 4034
94 Ga0068855_100144717 3300005563 Bacteria 2707
95 Ga0068855_100226528 3300005563 Bacteria 2095
96 Ga0068855_100253037 3300005563 Bacteria 1964
97 Ga0068855_100735879 3300005563 Bacteria 1053
98 Ga0070664_100000306 3300005564 Bacteria 35640
99 Ga0070664_100071504 3300005564 Bacteria 2973
100 Ga0070664_100417742 3300005564 Bacteria 1228
101 Ga0068857_100126274 3300005577 Bacteria 2305
102 Ga0068857_100268368 3300005577 Bacteria 1568
103 Ga0068857_101185979 3300005577 Bacteria 739
104 Ga0068854_100057700 3300005578 Bacteria 2801
105 Ga0068854_100388899 3300005578 Bacteria 1151
106 Ga0068852_100318936 3300005616 Bacteria 1509
107 Ga0068852_100870973 3300005616 Bacteria 917
108 Ga0068859_100895921 3300005617 Bacteria 972
109 Ga0068863_100472015 3300005841 Bacteria 1233
110 Ga0068863_100796112 3300005841 Bacteria 943
111 Ga0068863_101336069 3300005841 Bacteria 724
112 Ga0068858_100368066 3300005842 Bacteria 1378
113 Ga0068858_101456597 3300005842 Bacteria 675
114 Ga0068860_100008252 3300005843 Bacteria 10366
115 Ga0068860_100014588 3300005843 Bacteria 7688
116 Ga0068862_100004282 3300005844 Bacteria 12074
117 Ga0070717_10964341 3300006028 Bacteria 776
118 Ga0070716_100068384 3300006173 Bacteria 2078
119 Ga0070712_100133996 3300006175 Bacteria 1881
120 Ga0097621_100066245 3300006237 Bacteria 2974
121 Ga0068871_100667864 3300006358 Bacteria 950
122 Ga0068871_100725407 3300006358 Bacteria 912
123 Ga0075428_100077885 3300006844 Bacteria 3619
124 Ga0075433_10066316 3300006852 Bacteria 3167
125 Ga0075434_101643351 3300006871 Bacteria 651
126 Ga0068865_100123349 3300006881 Bacteria 1930
127 Ga0075436_100000132 3300006914 Bacteria 44395
128 Ga0075436_101507653 3300006914 Bacteria 511
129 Ga0097620_100896104 3300006931 Bacteria 972
130 Ga0099794_10179927 3300007265 Bacteria 1079
131 Ga0105240_10018183 3300009093 Bacteria 9450
132 Ga0105240_10023675 3300009093 Bacteria 8112
133 Ga0105240_10131289 3300009093 Bacteria 3004
134 Ga0105240_10402781 3300009093 Bacteria 1541
135 Ga0105240_10517920 3300009093 Bacteria 1324
136 Ga0111539_10042697 3300009094 Bacteria 5443
137 Ga0105245_10739200 3300009098 Bacteria 1019
138 Ga0114129_10238694 3300009147 Bacteria 2444
139 Ga0114129_10860285 3300009147 Bacteria 1152
140 Ga0105243_10000129 3300009148 Bacteria 85721
141 Ga0105242_10972632 3300009176 Bacteria 854
142 Ga0105248_10068144 3300009177 Bacteria 3996
143 Ga0105248_10505372 3300009177 Bacteria 1363
144 Ga0105248_10513451 3300009177 Bacteria 1351
145 Ga0105237_10010685 3300009545 Bacteria 9746
146 Ga0105237_10045115 3300009545 Bacteria 4437
147 Ga0105237_10333101 3300009545 Bacteria 1522
148 Ga0105237_10575730 3300009545 Bacteria 1133
149 Ga0105238_10008173 3300009551 Bacteria 10467
150 Ga0105238_10079017 3300009551 Bacteria 3279
151 Ga0105238_10104176 3300009551 Bacteria 2818
152 Ga0105238_10252139 3300009551 Bacteria 1743
153 Ga0105238_10504296 3300009551 Bacteria 1211
154 Ga0105238_10726885 3300009551 Bacteria 1006
155 Ga0105238_11622736 3300009551 Bacteria 677
156 Ga0105249_11090432 3300009553 Bacteria 868
157 Ga0105239_10581299 3300010375 Bacteria 1277
158 Ga0105246_10019298 3300011119 Bacteria 4355
159 Ga0157373_10004032 3300013100 Bacteria 11070
160 Ga0157370_10000554 3300013104 Bacteria 46615
161 Ga0157370_10042549 3300013104 Bacteria 4376
162 Ga0157370_10043513 3300013104 Bacteria 4321
163 Ga0157370_10056640 3300013104 Bacteria 3731
164 Ga0157370_10063846 3300013104 Bacteria 3487
165 Ga0157370_10073827 3300013104 Bacteria 3218
166 Ga0157370_10078467 3300013104 Bacteria 3109
167 Ga0157370_10122281 3300013104 Bacteria 2430
168 Ga0157370_10338762 3300013104 Bacteria 1386
169 Ga0157370_10942613 3300013104 Bacteria 783
170 Ga0157369_10031197 3300013105 Bacteria 5872
171 Ga0157369_10042844 3300013105 Bacteria 4937
172 Ga0157369_10070475 3300013105 Bacteria 3755
173 Ga0157369_10181689 3300013105 Bacteria 2213
174 Ga0157369_10194541 3300013105 Bacteria 2130
175 Ga0157369_10395467 3300013105 Bacteria 1434
176 Ga0157374_11285219 3300013296 Bacteria 754
177 Ga0157378_10808406 3300013297 Bacteria 964
178 Ga0157378_11955290 3300013297 Bacteria 636
179 Ga0157372_10022195 3300013307 Bacteria 6866
180 Ga0157372_10064333 3300013307 Bacteria 4116
181 Ga0157372_10075365 3300013307 Bacteria 3807
182 Ga0157372_10091617 3300013307 Bacteria 3457
183 Ga0157372_10120414 3300013307 Bacteria 3014
184 Ga0157372_10206145 3300013307 Bacteria 2278
185 Ga0157372_13336105 3300013307 Bacteria 511
186 Ga0157375_10153511 3300013308 Bacteria 2440
187 Ga0157375_10346179 3300013308 Bacteria 1652
188 Ga0157379_10025150 3300014968 Bacteria 5285
189 Ga0157379_10067767 3300014968 Bacteria 3190
190 Ga0157379_10253026 3300014968 Bacteria 1599
191 Ga0206349_1695842 3300020075 Bacteria 800
192 Ga0206355_1515726 3300020076 Bacteria 658
193 Ga0206352_11143396 3300020078 Bacteria 500
194 Ga0206354_11021863 3300020081 Unclassified 693
195 Ga0213872_10060517 3300021361 Bacteria 1713
196 Ga0209437_113867 3300025233 Bacteria 1141
197 Ga0209233_1003686 3300025261 Bacteria 5355
198 Ga0207656_10227629 3300025321 Bacteria 908
199 Ga0207688_10688978 3300025901 Bacteria 646
200 Ga0207680_10144859 3300025903 Bacteria 1578
201 Ga0207680_10297518 3300025903 Bacteria 1124
202 Ga0207680_10482793 3300025903 Bacteria 882
203 Ga0207680_10567848 3300025903 Bacteria 810
204 Ga0207647_10087212 3300025904 Bacteria 1865
205 Ga0207647_10393177 3300025904 Bacteria 782
206 Ga0207647_10419709 3300025904 Bacteria 752
207 Ga0207699_10192172 3300025906 Bacteria 1378
208 Ga0207645_10028719 3300025907 Bacteria 3589
209 Ga0207645_10219356 3300025907 Bacteria 1253
210 Ga0207705_10000109 3300025909 Bacteria 93256
211 Ga0207705_10003287 3300025909 Bacteria 12308
212 Ga0207705_10004570 3300025909 Bacteria 10451
213 Ga0207705_10008756 3300025909 Bacteria 7374
214 Ga0207705_10025620 3300025909 Bacteria 4208
215 Ga0207705_10032967 3300025909 Bacteria 3702
216 Ga0207705_10268019 3300025909 Bacteria 1305
217 Ga0207684_10549474 3300025910 Bacteria 988
218 Ga0207707_10055953 3300025912 Bacteria 3431
219 Ga0207707_11608388 3300025912 Bacteria 511
220 Ga0207695_10000857 3300025913 Bacteria 55783
221 Ga0207695_10145885 3300025913 Bacteria 2311
222 Ga0207695_10150231 3300025913 Bacteria 2269
223 Ga0207695_10254929 3300025913 Bacteria 1653
224 Ga0207695_10969853 3300025913 Bacteria 730
225 Ga0207671_10043527 3300025914 Bacteria 3320
226 Ga0207671_11015286 3300025914 Bacteria 653
227 Ga0207693_10041354 3300025915 Bacteria 3628
228 Ga0207660_10595343 3300025917 Bacteria 900
229 Ga0207662_10504006 3300025918 Bacteria 834
230 Ga0207662_11116725 3300025918 Bacteria 560
231 Ga0207657_10014449 3300025919 Bacteria 7709
232 Ga0207657_10063567 3300025919 Bacteria 3155
233 Ga0207657_10160340 3300025919 Bacteria 1827
234 Ga0207649_10005562 3300025920 Bacteria 6815
235 Ga0207649_10026757 3300025920 Bacteria 3377
236 Ga0207649_10269397 3300025920 Bacteria 1234
237 Ga0207649_10340263 3300025920 Unclassified 1107
238 Ga0207652_10006934 3300025921 Bacteria 9128
239 Ga0207652_10117239 3300025921 Bacteria 2366
240 Ga0207681_10000033 3300025923 Bacteria 166731
241 Ga0207681_10226191 3300025923 Bacteria 1450
242 Ga0207694_10000922 3300025924 Bacteria 26025
243 Ga0207694_10066744 3300025924 Bacteria 2807
244 Ga0207694_11602280 3300025924 Bacteria 549
245 Ga0207687_11033474 3300025927 Bacteria 705
246 Ga0207700_10091213 3300025928 Bacteria 2406
247 Ga0207664_10360603 3300025929 Bacteria 1288
248 Ga0207690_10038994 3300025932 Bacteria 3097
249 Ga0207690_10278874 3300025932 Bacteria 1301
250 Ga0207706_10071397 3300025933 Bacteria 3053
251 Ga0207709_10000177 3300025935 Bacteria 85726
252 Ga0207704_10043139 3300025938 Bacteria 2660
253 Ga0207704_11402000 3300025938 Bacteria 599
254 Ga0207665_10155248 3300025939 Bacteria 1642
255 Ga0207691_10585429 3300025940 Bacteria 945
256 Ga0207691_10698434 3300025940 Bacteria 855
257 Ga0207711_10070683 3300025941 Bacteria 3027
258 Ga0207711_10379833 3300025941 Bacteria 1311
259 Ga0207711_10439760 3300025941 Bacteria 1214
260 Ga0207711_10805719 3300025941 Bacteria 875
261 Ga0207689_10167929 3300025942 Bacteria 1808
262 Ga0207661_10169950 3300025944 Bacteria 1897
263 Ga0207661_11227678 3300025944 Bacteria 690
264 Ga0207661_11255271 3300025944 Bacteria 681
265 Ga0207661_11272750 3300025944 Bacteria 676
266 Ga0207679_10002514 3300025945 Bacteria 11300
267 Ga0207679_10196669 3300025945 Bacteria 1681
268 Ga0207667_10018917 3300025949 Bacteria 7704
269 Ga0207667_10031347 3300025949 Bacteria 5739
270 Ga0207667_10032946 3300025949 Bacteria 5577
271 Ga0207667_10035272 3300025949 Bacteria 5366
272 Ga0207667_10037502 3300025949 Bacteria 5180
273 Ga0207667_10070990 3300025949 Bacteria 3623
274 Ga0207667_10104164 3300025949 Bacteria 2926
275 Ga0207667_10158599 3300025949 Bacteria 2328
276 Ga0207667_10251268 3300025949 Bacteria 1809
277 Ga0207667_10479934 3300025949 Bacteria 1262
278 Ga0207651_10489057 3300025960 Bacteria 1062
279 Ga0207651_10704120 3300025960 Bacteria 890
280 Ga0207651_11937208 3300025960 Bacteria 530
281 Ga0207668_10580528 3300025972 Bacteria 974
282 Ga0207668_10898035 3300025972 Bacteria 788
283 Ga0207640_10008744 3300025981 Bacteria 5634
284 Ga0207640_10502453 3300025981 Bacteria 1010
285 Ga0207658_10123539 3300025986 Bacteria 2068
286 Ga0207658_10680091 3300025986 Bacteria 929
287 Ga0207703_10102632 3300026035 Bacteria 2427
288 Ga0207703_10416797 3300026035 Bacteria 1249
289 Ga0207703_11088251 3300026035 Bacteria 768
290 Ga0207639_10041089 3300026041 Bacteria 3457
291 Ga0207639_10320451 3300026041 Bacteria 1376
292 Ga0207678_10015868 3300026067 Bacteria 6620
293 Ga0207678_10018940 3300026067 Bacteria 6049
294 Ga0207678_10041404 3300026067 Bacteria 3994
295 Ga0207678_10839225 3300026067 Bacteria 812
296 Ga0207702_10101371 3300026078 Bacteria 2542
297 Ga0207702_11491331 3300026078 Bacteria 670
298 Ga0207641_10328608 3300026088 Bacteria 1452
299 Ga0207641_11327488 3300026088 Bacteria 720
300 Ga0207648_10000380 3300026089 Bacteria 48986
301 Ga0207674_10020940 3300026116 Bacteria 7054
302 Ga0207674_10270404 3300026116 Bacteria 1647
303 Ga0207674_11159944 3300026116 Bacteria 742
304 Ga0207675_100875867 3300026118 Bacteria 913
305 Ga0207698_10070475 3300026142 Bacteria 2770
306 Ga0207698_10350320 3300026142 Bacteria 1394
307 Ga0207698_10372112 3300026142 Bacteria 1357
308 Ga0207698_11467931 3300026142 Bacteria 697
309 Ga0207428_10030983 3300027907 Bacteria 4419
310 Ga0268266_10001104 3300028379 Bacteria 33828
311 Ga0268265_10000230 3300028380 Bacteria 63968
312 Ga0268265_10971492 3300028380 Bacteria 838
313 Ga0268264_10030382 3300028381 Bacteria 4428
314 Ga0268264_10068020 3300028381 Bacteria 3008
315 Ga0265319_1023707 3300028563 Bacteria 2220
316 Ga0265334_10030953 3300028573 Bacteria 2140
317 Ga0265318_10140311 3300028577 Bacteria 887
318 Ga0265322_10005643 3300028654 Bacteria 3702
319 Ga0265322_10049639 3300028654 Bacteria 1192
320 Ga0265336_10155144 3300028666 Bacteria 681
321 Ga0265338_10035566 3300028800 Bacteria 4784
322 Ga0265338_10752130 3300028800 Bacteria 670
323 Ga0265324_10000597 3300029957 Bacteria 24795
324 Ga0265332_10025781 3300031238 Bacteria 2580
325 Ga0265320_10089049 3300031240 Bacteria 1431
326 Ga0265325_10088585 3300031241 Bacteria 1529
327 Ga0265325_10257017 3300031241 Bacteria 789
328 Ga0265339_10002110 3300031249 Bacteria 14500
329 Ga0265331_10023024 3300031250 Bacteria 3171
330 Ga0265327_10000629 3300031251 Bacteria 57603
331 Ga0265316_10028606 3300031344 Bacteria 4595
332 Ga0265316_10071462 3300031344 Bacteria 2675
333 Ga0307408_100000021 3300031548 Bacteria 312158
334 Ga0307408_100014510 3300031548 Bacteria 5234
335 Ga0307408_102481682 3300031548 Bacteria 504
336 Ga0307508_10128696 3300031616 Bacteria 2135
337 Ga0265342_10000714 3300031712 Bacteria 34315
338 Ga0307406_10000099 3300031901 Bacteria 49697
339 Ga0307407_10001025 3300031903 Bacteria 9639
340 Ga0307407_10144949 3300031903 Bacteria 1536
341 Ga0307412_10000013 3300031911 Bacteria 365239
342 Ga0307409_100024303 3300031995 Bacteria 4223
343 Ga0307416_100065329 3300032002 Bacteria 2989
344 Ga0307416_100544289 3300032002 Bacteria 1233
345 Ga0307414_10000163 3300032004 Bacteria 44513
346 Ga0307414_10057144 3300032004 Bacteria 2741
347 Ga0307414_10401313 3300032004 Bacteria 1191
348 Ga0307411_10783934 3300032005 Bacteria 838
349 Ga0307510_10189698 3300033180 Bacteria 1605
350 Ga0373929_0000002 3300035085 Bacteria 683932
351 Ga0373929_0108420 3300035085 Bacteria 707
352 Ga0373949_0226743 3300035090 Bacteria 570
353 Ga0373932_0057499 3300035112 Bacteria 1173
354 Ga0373939_0277616 3300035114 Bacteria 661
355 Ga0373953_0142769 3300035117 Bacteria 1024
356 Ga0373956_0202817 3300035119 Bacteria 940
357 Ga0373957_0114746 3300035120 Bacteria 1087
358 Ga0373961_0000446 3300035241 Bacteria 16728
359 Ga0373935_0004352 3300035692 Bacteria 8311
360 Ga0373935_1463337 3300035692 Bacteria 511
361 Ga0373933_0249508 3300035724 Bacteria 1143
362 Ga0373947_0051908 3300035725 Bacteria 2469
363 Ga0373947_0200375 3300035725 Bacteria 1306
364 Ga0373937_0007445 3300036401 Bacteria 9472
365 Ga0373925_0464188 3300037068 Bacteria 1038
366 Ga0373925_1720091 3300037068 Bacteria 512
367 Ga0395899_0784011 3300037312 Bacteria 590
368 Ga0395900_0299334 3300037418 Bacteria 1595
369 Ga0395900_0569409 3300037418 Bacteria 1076
370 Ga0395901_1358051 3300038443 Bacteria 670
371 Ga0436362_1036084 3300039453 Bacteria 2115
372 Ga0439453_0000606 3300041408 Bacteria 4052
373 Ga0451787_666878 3300041441 Bacteria 767
374 Ga0451789_0154147 3300041443 Bacteria 753
375 Ga0451789_0680423 3300041443 Bacteria 597
376 Ga0451789_1091942 3300041443 Bacteria 553
377 Ga0451791_1198727 3300041451 Bacteria 741
378 Ga0451807_2244152 3300041486 Bacteria 748
379 Ga0451835_0535545 3300041492 Bacteria 601
380 Ga0451849_0736492 3300041505 Bacteria 1717
381 Ga0451843_1200383 3300041509 Bacteria 2078
382 Ga0439448_0003792 3300042005 Bacteria 4218
383 Ga0450888_001278 3300042126 Bacteria 2402
384 Ga0450890_000014 3300042127 Bacteria 54459
385 Ga0450892_000004 3300042130 Bacteria 24056
386 Ga0450889_008224 3300042144 Bacteria 1058
387 Ga0450893_0055904 3300042532 Bacteria 746
388 Ga0451577_0441518 3300042876 Bacteria 1181
389 Ga0451577_1244237 3300042876 Bacteria 663
390 Ga0466961_0743852 3300044693 Bacteria 586
391 Ga0453684_0063314 3300044712 Bacteria 4732
392 Ga0453684_0393384 3300044712 Bacteria 1554
393 Ga0453684_0521277 3300044712 Bacteria 1313
394 Ga0466957_1202807 3300044842 Bacteria 548
395 Ga0466959_0185804 3300045049 Bacteria 1452
396 Ga0451576_0284230 3300045051 Bacteria 1730
397 Ga0466967_1158777 3300045976 Bacteria 770
398 Ga0495629_0634186 3300046459 Bacteria 713
399 Ga0495580_0390603 3300046472 Bacteria 939
400 Ga0495580_0851223 3300046472 Bacteria 589
401 Ga0495665_0181230 3300046531 Bacteria 1095
402 Ga0495587_0199436 3300046536 Bacteria 1132
403 Ga0495633_0345275 3300046558 Bacteria 675
404 Ga0495667_0885008 3300046559 Bacteria 548
405 Ga0495661_0145314 3300046665 Bacteria 1286
406 Ga0495658_0064291 3300046683 Bacteria 2113
407 Ga0495613_0143079 3300046689 Bacteria 1708
408 Ga0495679_059250 3300047446 Bacteria 1127
409 Ga0495686_0000064 3300047472 Bacteria 226284
410 Ga0495686_0018132 3300047472 Bacteria 4729
411 Ga0495686_0059010 3300047472 Bacteria 2390
412 Ga0495686_0716604 3300047472 Bacteria 509
413 Ga0495615_0003433 3300048090 Bacteria 2654
414 Ga0496104_0001188 3300048907 Bacteria 22382
415 Ga0496105_0354459 3300048908 Bacteria 1171
416 Ga0496108_0510016 3300048911 Bacteria 1050
417 Ga0496112_0458832 3300048915 Bacteria 1212
418 Ga0496114_0000036 3300048917 Bacteria 155622
419 Ga0496114_0023800 3300048917 Bacteria 4998
420 Ga0496122_0515519 3300048925 Bacteria 578
421 Ga0496123_0126698 3300048926 Bacteria 1423
422 Ga0496125_0381352 3300048928 Bacteria 831
423 Ga0496126_0000092 3300048929 Bacteria 209156
424 Ga0496126_0000170 3300048929 Bacteria 148961
425 Ga0501307_002000 3300049162 Bacteria 1842
426 Ga0501311_003387 3300049527 Bacteria 1620
427 Ga0501311_020097 3300049527 Bacteria 901
428 Ga0501312_042231 3300049528 Bacteria 748
429 Ga0501315_003219 3300049531 Bacteria 1616
430 Ga0501317_027399 3300049533 Bacteria 809
431 Ga0501318_000498 3300049534 Bacteria 2538
432 Ga0501320_000406 3300049536 Bacteria 2447
433 Ga0501321_015448 3300049537 Bacteria 899
434 Ga0501328_01054 3300049544 Bacteria 1040
435 Ga0501032_0066044 3300049569 Bacteria 2418
436 Ga0501033_0583663 3300049570 Bacteria 768
437 Ga0501034_0025112 3300049571 Bacteria 6064
438 Ga0501034_0052205 3300049571 Bacteria 4120
439 Ga0501038_0099431 3300049574 Bacteria 2425
440 Ga0501039_0179710 3300049575 Bacteria 1664
441 Ga0501047_0273986 3300049581 Bacteria 1533
442 Ga0501067_0110451 3300049583 Bacteria 1528
443 Ga0501068_0023815 3300049584 Bacteria 3590
444 Ga0501070_0624790 3300049586 Bacteria 857
445 Ga0501070_0773340 3300049586 Bacteria 755
446 Ga0501071_0652416 3300049587 Bacteria 810
447 Ga0501073_0313362 3300049589 Bacteria 1083
448 Ga0501075_0000962 3300049591 Bacteria 18337
449 Ga0501077_0000515 3300049593 Bacteria 23497
450 Ga0501227_002242 3300049665 Bacteria 4277
451 Ga0501227_103760 3300049665 Bacteria 758
452 Ga0501080_0004504 3300049742 Bacteria 12418
453 Ga0501080_1479603 3300049742 Bacteria 578
454 Ga0501083_0002431 3300049744 Bacteria 12739
455 Ga0501083_0011441 3300049744 Bacteria 6224
456 Ga0501035_0379506 3300049822 Bacteria 1179
457 Ga0501044_0204756 3300049823 Bacteria 1930
458 nmdc:mga03683_247637_c1 3300050489 Bacteria 827
459 nmdc:mga05p37_1722893_c1 3300050507 Bacteria 609
460 nmdc:mga05p37_440056_c1 3300050507 Bacteria 1512
461 nmdc:mga08y16_3103_c1 3300050511 Bacteria 17195
462 nmdc:mga0n895_194205_c1 3300050512 Bacteria 2061
463 nmdc:mga0n895_378931_c1 3300050512 Bacteria 1432
464 nmdc:mga0rr50_443865_c1 3300050513 Bacteria 1099
465 nmdc:mga08x19_125868_c1 3300050514 Bacteria 1721
466 nmdc:mga08x19_210_c1 3300050514 Bacteria 44472
467 nmdc:mga0a205_237526_c1 3300050515 Bacteria 1704
468 Ga0495655_0049942 3300053083 Bacteria 1103
469 Ga0500608_296952 3300053122 Bacteria 602
470 Ga0500559_0000535 3300053136 Bacteria 26450
471 Ga0587077_002267 3300059493 Bacteria 2249
472 Ga0587077_006017 3300059493 Bacteria 1695
473 Ga0587085_034593 3300059506 Bacteria 850
474 Ga0587091_089769 3300059511 Bacteria 704
475 Ga0587062_032284 3300059639 Bacteria 809
476 Ga0587068_033361 3300059641 Bacteria 903
477 Ga0501082_0129159 3300060353 Bacteria 2192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049527 Ga0501311_020097 Ga0501311_020097_175_600 116
2 3300003320 rootH2_10097490 rootH2_100974902 119
3 3300005841 Ga0068863_101336069 Ga0068863_1013360692 119
4 3300026088 Ga0207641_11327488 Ga0207641_113274882 119
5 3300046472 Ga0495580_0390603 Ga0495580_0390603_261_683 119
6 3300005471 Ga0070698_101623389 Ga0070698_1016233891 120
7 3300037068 Ga0373925_1720091 Ga0373925_1720091_38_463 122
8 3300006914 Ga0075436_101507653 Ga0075436_1015076531 127
9 3300006175 Ga0070712_100133996 Ga0070712_1001339966 130
10 3300025915 Ga0207693_10041354 Ga0207693_100413545 130
11 3300037068 Ga0373925_0464188 Ga0373925_0464188_115_537 130
12 3300041492 Ga0451835_0535545 Ga0451835_0535545_92_517 130
13 3300046459 Ga0495629_0634186 Ga0495629_0634186_77_499 130
14 3300046559 Ga0495667_0885008 Ga0495667_0885008_98_520 130
15 3300048917 Ga0496114_0023800 Ga0496114_0023800_1482_1904 130
16 3300028654 Ga0265322_10005643 Ga0265322_100056433 132
17 3300031238 Ga0265332_10025781 Ga0265332_100257816 132
18 3300031249 Ga0265339_10002110 Ga0265339_1000211013 132
19 3300031344 Ga0265316_10028606 Ga0265316_100286066 132
20 3300031712 Ga0265342_10000714 Ga0265342_1000071430 132
21 3300049533 Ga0501317_027399 Ga0501317_027399_261_692 133
22 3300048928 Ga0496125_0381352 Ga0496125_0381352_232_657 135
23 3300005545 Ga0070695_100662966 Ga0070695_1006629662 139
24 3300005330 Ga0070690_100410838 Ga0070690_1004108382 140
25 3300005335 Ga0070666_10030398 Ga0070666_100303984 140
26 3300005347 Ga0070668_100909886 Ga0070668_1009098862 140
27 3300005353 Ga0070669_100649055 Ga0070669_1006490552 140
28 3300005356 Ga0070674_100834961 Ga0070674_1008349612 140
29 3300005356 Ga0070674_101169228 Ga0070674_1011692281 140
30 3300005367 Ga0070667_101093761 Ga0070667_1010937612 140
31 3300005434 Ga0070709_11437206 Ga0070709_114372061 140
32 3300005436 Ga0070713_100433592 Ga0070713_1004335922 140
33 3300005440 Ga0070705_100161694 Ga0070705_1001616942 140
34 3300005444 Ga0070694_100960999 Ga0070694_1009609992 140
35 3300005518 Ga0070699_101359216 Ga0070699_1013592161 140
36 3300005535 Ga0070684_100092187 Ga0070684_1000921875 140
37 3300005539 Ga0068853_100139365 Ga0068853_1001393651 140
38 3300005548 Ga0070665_100728361 Ga0070665_1007283612 140
39 3300005841 Ga0068863_100472015 Ga0068863_1004720152 140
40 3300005842 Ga0068858_100368066 Ga0068858_1003680663 140
41 3300005843 Ga0068860_100014588 Ga0068860_1000145886 140
42 3300006237 Ga0097621_100066245 Ga0097621_1000662452 140
43 3300006358 Ga0068871_100725407 Ga0068871_1007254071 140
44 3300006871 Ga0075434_101643351 Ga0075434_1016433512 140
45 3300006881 Ga0068865_100123349 Ga0068865_1001233492 140
46 3300009094 Ga0111539_10042697 Ga0111539_100426978 140
47 3300009098 Ga0105245_10739200 Ga0105245_107392002 140
48 3300009147 Ga0114129_10860285 Ga0114129_108602852 140
49 3300009176 Ga0105242_10972632 Ga0105242_109726322 140
50 3300009177 Ga0105248_10068144 Ga0105248_100681445 140
51 3300009177 Ga0105248_10513451 Ga0105248_105134512 140
52 3300013297 Ga0157378_10808406 Ga0157378_108084062 140
53 3300013297 Ga0157378_11955290 Ga0157378_119552901 140
54 3300013308 Ga0157375_10153511 Ga0157375_101535112 140
55 3300014968 Ga0157379_10025150 Ga0157379_100251505 140
56 3300014968 Ga0157379_10253026 Ga0157379_102530262 140
57 3300021361 Ga0213872_10060517 Ga0213872_100605175 140
58 3300025901 Ga0207688_10688978 Ga0207688_106889782 140
59 3300025903 Ga0207680_10144859 Ga0207680_101448592 140
60 3300025903 Ga0207680_10482793 Ga0207680_104827932 140
61 3300025927 Ga0207687_11033474 Ga0207687_110334741 140
62 3300025933 Ga0207706_10071397 Ga0207706_100713974 140
63 3300025938 Ga0207704_10043139 Ga0207704_100431392 140
64 3300025940 Ga0207691_10698434 Ga0207691_106984341 140
65 3300025941 Ga0207711_10070683 Ga0207711_100706832 140
66 3300025941 Ga0207711_10805719 Ga0207711_108057191 140
67 3300025960 Ga0207651_10704120 Ga0207651_107041202 140
68 3300025972 Ga0207668_10898035 Ga0207668_108980352 140
69 3300025986 Ga0207658_10680091 Ga0207658_106800912 140
70 3300026035 Ga0207703_11088251 Ga0207703_110882512 140
71 3300026067 Ga0207678_10839225 Ga0207678_108392252 140
72 3300026088 Ga0207641_10328608 Ga0207641_103286082 140
73 3300027907 Ga0207428_10030983 Ga0207428_1003098312 140
74 3300028381 Ga0268264_10030382 Ga0268264_100303826 140
75 3300029957 Ga0265324_10000597 Ga0265324_100005975 140
76 3300035117 Ga0373953_0142769 Ga0373953_0142769_202_624 140
77 3300035119 Ga0373956_0202817 Ga0373956_0202817_496_918 140
78 3300035120 Ga0373957_0114746 Ga0373957_0114746_347_769 140
79 3300035692 Ga0373935_1463337 Ga0373935_1463337_24_446 140
80 3300035724 Ga0373933_0249508 Ga0373933_0249508_308_730 140
81 3300035725 Ga0373947_0051908 Ga0373947_0051908_116_538 140
82 3300035725 Ga0373947_0200375 Ga0373947_0200375_111_533 140
83 3300036401 Ga0373937_0007445 Ga0373937_0007445_6131_6553 140
84 3300037312 Ga0395899_0784011 Ga0395899_0784011_148_570 140
85 3300037418 Ga0395900_0299334 Ga0395900_0299334_1097_1519 140
86 3300037418 Ga0395900_0569409 Ga0395900_0569409_103_549 140
87 3300038443 Ga0395901_1358051 Ga0395901_1358051_72_494 140
88 3300039453 Ga0436362_1036084 Ga0436362_1036084_1332_1754 140
89 3300046472 Ga0495580_0851223 Ga0495580_0851223_97_519 140
90 3300046531 Ga0495665_0181230 Ga0495665_0181230_234_656 140
91 3300046536 Ga0495587_0199436 Ga0495587_0199436_204_626 140
92 3300046683 Ga0495658_0064291 Ga0495658_0064291_1433_1855 140
93 3300046689 Ga0495613_0143079 Ga0495613_0143079_44_466 140
94 3300047446 Ga0495679_059250 Ga0495679_059250_44_466 140
95 3300049744 Ga0501083_0002431 Ga0501083_0002431_1612_2037 140
96 3300050507 nmdc:mga05p37_1722893_c1 nmdc:mga05p37_1722893_c1_177_599 140
97 3300050511 nmdc:mga08y16_3103_c1 nmdc:mga08y16_3103_c1_8566_8988 140
98 3300050513 nmdc:mga0rr50_443865_c1 nmdc:mga0rr50_443865_c1_124_546 140
99 3300059493 Ga0587077_002267 Ga0587077_002267_58_480 140
100 3300004798 Ga0058859_11243853 Ga0058859_112438531 141
101 3300005327 Ga0070658_10014610 Ga0070658_100146107 141
102 3300005327 Ga0070658_10022791 Ga0070658_100227913 141
103 3300005327 Ga0070658_10086656 Ga0070658_100866566 141
104 3300005327 Ga0070658_10434531 Ga0070658_104345312 141
105 3300005327 Ga0070658_10540917 Ga0070658_105409171 141
106 3300005327 Ga0070658_10716402 Ga0070658_107164021 141
107 3300005328 Ga0070676_10374143 Ga0070676_103741431 141
108 3300005328 Ga0070676_10387226 Ga0070676_103872262 141
109 3300005328 Ga0070676_10433390 Ga0070676_104333902 141
110 3300005329 Ga0070683_100033824 Ga0070683_1000338245 141
111 3300005329 Ga0070683_100478551 Ga0070683_1004785512 141
112 3300005335 Ga0070666_10008416 Ga0070666_100084166 141
113 3300005335 Ga0070666_10193715 Ga0070666_101937154 141
114 3300005336 Ga0070680_100097508 Ga0070680_1000975081 141
115 3300005339 Ga0070660_100043594 Ga0070660_1000435942 141
116 3300005339 Ga0070660_100053656 Ga0070660_1000536565 141
117 3300005339 Ga0070660_100208032 Ga0070660_1002080322 141
118 3300005341 Ga0070691_10541395 Ga0070691_105413951 141
119 3300005343 Ga0070687_100342740 Ga0070687_1003427401 141
120 3300005344 Ga0070661_100116077 Ga0070661_1001160772 141
121 3300005344 Ga0070661_100149332 Ga0070661_1001493321 141
122 3300005347 Ga0070668_100048812 Ga0070668_1000488124 141
123 3300005353 Ga0070669_100000022 Ga0070669_100000022126 141
124 3300005365 Ga0070688_100084609 Ga0070688_1000846095 141
125 3300005366 Ga0070659_100045036 Ga0070659_1000450365 141
126 3300005366 Ga0070659_100095620 Ga0070659_1000956202 141
127 3300005367 Ga0070667_100308272 Ga0070667_1003082722 141
128 3300005434 Ga0070709_10075967 Ga0070709_100759673 141
129 3300005434 Ga0070709_10397132 Ga0070709_103971322 141
130 3300005435 Ga0070714_100866192 Ga0070714_1008661921 141
131 3300005436 Ga0070713_100035314 Ga0070713_1000353146 141
132 3300005436 Ga0070713_100674346 Ga0070713_1006743462 141
133 3300005440 Ga0070705_101400167 Ga0070705_1014001671 141
134 3300005455 Ga0070663_100035762 Ga0070663_1000357626 141
135 3300005455 Ga0070663_100134198 Ga0070663_1001341981 141
136 3300005455 Ga0070663_100190063 Ga0070663_1001900631 141
137 3300005455 Ga0070663_100268720 Ga0070663_1002687201 141
138 3300005455 Ga0070663_101007486 Ga0070663_1010074861 141
139 3300005458 Ga0070681_10041854 Ga0070681_100418543 141
140 3300005458 Ga0070681_10458560 Ga0070681_104585601 141
141 3300005458 Ga0070681_10548400 Ga0070681_105484002 141
142 3300005458 Ga0070681_10947595 Ga0070681_109475952 141
143 3300005466 Ga0070685_10011019 Ga0070685_100110194 141
144 3300005466 Ga0070685_10066252 Ga0070685_100662522 141
145 3300005466 Ga0070685_10665113 Ga0070685_106651131 141
146 3300005518 Ga0070699_100337200 Ga0070699_1003372003 141
147 3300005530 Ga0070679_100029297 Ga0070679_1000292973 141
148 3300005530 Ga0070679_100049634 Ga0070679_1000496342 141
149 3300005530 Ga0070679_100521114 Ga0070679_1005211142 141
150 3300005535 Ga0070684_100073693 Ga0070684_1000736932 141
151 3300005539 Ga0068853_100083100 Ga0068853_1000831002 141
152 3300005539 Ga0068853_100132843 Ga0068853_1001328432 141
153 3300005546 Ga0070696_100280042 Ga0070696_1002800422 141
154 3300005547 Ga0070693_100543099 Ga0070693_1005430991 141
155 3300005548 Ga0070665_100000875 Ga0070665_1000008755 141
156 3300005563 Ga0068855_100044007 Ga0068855_1000440076 141
157 3300005563 Ga0068855_100047325 Ga0068855_1000473257 141
158 3300005563 Ga0068855_100071509 Ga0068855_1000715095 141
159 3300005563 Ga0068855_100144717 Ga0068855_1001447176 141
160 3300005563 Ga0068855_100226528 Ga0068855_1002265282 141
161 3300005563 Ga0068855_100253037 Ga0068855_1002530372 141
162 3300005563 Ga0068855_100735879 Ga0068855_1007358792 141
163 3300005564 Ga0070664_100071504 Ga0070664_1000715042 141
164 3300005564 Ga0070664_100417742 Ga0070664_1004177421 141
165 3300005577 Ga0068857_100126274 Ga0068857_1001262742 141
166 3300005577 Ga0068857_101185979 Ga0068857_1011859791 141
167 3300005578 Ga0068854_100057700 Ga0068854_1000577004 141
168 3300005578 Ga0068854_100388899 Ga0068854_1003888991 141
169 3300005616 Ga0068852_100870973 Ga0068852_1008709732 141
170 3300005617 Ga0068859_100895921 Ga0068859_1008959212 141
171 3300005841 Ga0068863_100796112 Ga0068863_1007961122 141
172 3300005842 Ga0068858_101456597 Ga0068858_1014565971 141
173 3300005843 Ga0068860_100008252 Ga0068860_1000082526 141
174 3300005844 Ga0068862_100004282 Ga0068862_1000042825 141
175 3300006028 Ga0070717_10964341 Ga0070717_109643412 141
176 3300006358 Ga0068871_100667864 Ga0068871_1006678642 141
177 3300006844 Ga0075428_100077885 Ga0075428_1000778857 141
178 3300006852 Ga0075433_10066316 Ga0075433_100663163 141
179 3300006914 Ga0075436_100000132 Ga0075436_1000001325 141
180 3300006931 Ga0097620_100896104 Ga0097620_1008961042 141
181 3300007265 Ga0099794_10179927 Ga0099794_101799272 141
182 3300009093 Ga0105240_10018183 Ga0105240_100181838 141
183 3300009093 Ga0105240_10023675 Ga0105240_100236755 141
184 3300009093 Ga0105240_10131289 Ga0105240_101312892 141
185 3300009093 Ga0105240_10402781 Ga0105240_104027812 141
186 3300009093 Ga0105240_10517920 Ga0105240_105179202 141
187 3300009147 Ga0114129_10238694 Ga0114129_102386944 141
188 3300009177 Ga0105248_10505372 Ga0105248_105053722 141
189 3300009545 Ga0105237_10045115 Ga0105237_100451153 141
190 3300009545 Ga0105237_10333101 Ga0105237_103331012 141
191 3300009545 Ga0105237_10575730 Ga0105237_105757302 141
192 3300009551 Ga0105238_10008173 Ga0105238_1000817313 141
193 3300009551 Ga0105238_10079017 Ga0105238_100790175 141
194 3300009551 Ga0105238_10104176 Ga0105238_101041762 141
195 3300009551 Ga0105238_10252139 Ga0105238_102521392 141
196 3300009551 Ga0105238_10504296 Ga0105238_105042961 141
197 3300009551 Ga0105238_10726885 Ga0105238_107268851 141
198 3300009551 Ga0105238_11622736 Ga0105238_116227361 141
199 3300009553 Ga0105249_11090432 Ga0105249_110904321 141
200 3300010375 Ga0105239_10581299 Ga0105239_105812993 141
201 3300013104 Ga0157370_10042549 Ga0157370_100425492 141
202 3300013104 Ga0157370_10043513 Ga0157370_100435134 141
203 3300013104 Ga0157370_10063846 Ga0157370_100638462 141
204 3300013104 Ga0157370_10073827 Ga0157370_100738272 141
205 3300013104 Ga0157370_10078467 Ga0157370_100784675 141
206 3300013104 Ga0157370_10122281 Ga0157370_101222812 141
207 3300013104 Ga0157370_10338762 Ga0157370_103387621 141
208 3300013105 Ga0157369_10031197 Ga0157369_100311975 141
209 3300013105 Ga0157369_10042844 Ga0157369_100428445 141
210 3300013105 Ga0157369_10070475 Ga0157369_100704756 141
211 3300013105 Ga0157369_10181689 Ga0157369_101816892 141
212 3300013105 Ga0157369_10194541 Ga0157369_101945415 141
213 3300013105 Ga0157369_10395467 Ga0157369_103954672 141
214 3300013296 Ga0157374_11285219 Ga0157374_112852191 141
215 3300013307 Ga0157372_10022195 Ga0157372_100221955 141
216 3300013307 Ga0157372_10064333 Ga0157372_100643333 141
217 3300013307 Ga0157372_10075365 Ga0157372_100753654 141
218 3300013307 Ga0157372_10091617 Ga0157372_100916176 141
219 3300013307 Ga0157372_10120414 Ga0157372_101204144 141
220 3300013307 Ga0157372_10206145 Ga0157372_102061451 141
221 3300013307 Ga0157372_13336105 Ga0157372_133361051 141
222 3300013308 Ga0157375_10346179 Ga0157375_103461792 141
223 3300014968 Ga0157379_10067767 Ga0157379_100677673 141
224 3300020075 Ga0206349_1695842 Ga0206349_16958421 141
225 3300020076 Ga0206355_1515726 Ga0206355_15157261 141
226 3300020078 Ga0206352_11143396 Ga0206352_111433961 141
227 3300025233 Ga0209437_113867 Ga0209437_1138671 141
228 3300025261 Ga0209233_1003686 Ga0209233_10036865 141
229 3300025321 Ga0207656_10227629 Ga0207656_102276292 141
230 3300025903 Ga0207680_10297518 Ga0207680_102975181 141
231 3300025903 Ga0207680_10567848 Ga0207680_105678482 141
232 3300025904 Ga0207647_10087212 Ga0207647_100872122 141
233 3300025904 Ga0207647_10393177 Ga0207647_103931772 141
234 3300025904 Ga0207647_10419709 Ga0207647_104197091 141
235 3300025906 Ga0207699_10192172 Ga0207699_101921723 141
236 3300025907 Ga0207645_10028719 Ga0207645_100287192 141
237 3300025909 Ga0207705_10000109 Ga0207705_1000010913 141
238 3300025909 Ga0207705_10003287 Ga0207705_1000328710 141
239 3300025909 Ga0207705_10004570 Ga0207705_100045705 141
240 3300025909 Ga0207705_10025620 Ga0207705_100256205 141
241 3300025909 Ga0207705_10032967 Ga0207705_100329671 141
242 3300025909 Ga0207705_10268019 Ga0207705_102680191 141
243 3300025910 Ga0207684_10549474 Ga0207684_105494742 141
244 3300025912 Ga0207707_10055953 Ga0207707_100559532 141
245 3300025912 Ga0207707_11608388 Ga0207707_116083881 141
246 3300025913 Ga0207695_10000857 Ga0207695_1000085744 141
247 3300025913 Ga0207695_10145885 Ga0207695_101458855 141
248 3300025913 Ga0207695_10150231 Ga0207695_101502313 141
249 3300025913 Ga0207695_10254929 Ga0207695_102549291 141
250 3300025913 Ga0207695_10969853 Ga0207695_109698532 141
251 3300025914 Ga0207671_10043527 Ga0207671_100435272 141
252 3300025914 Ga0207671_11015286 Ga0207671_110152861 141
253 3300025917 Ga0207660_10595343 Ga0207660_105953431 141
254 3300025918 Ga0207662_10504006 Ga0207662_105040062 141
255 3300025918 Ga0207662_11116725 Ga0207662_111167251 141
256 3300025919 Ga0207657_10014449 Ga0207657_100144495 141
257 3300025919 Ga0207657_10063567 Ga0207657_100635675 141
258 3300025919 Ga0207657_10160340 Ga0207657_101603402 141
259 3300025920 Ga0207649_10026757 Ga0207649_100267576 141
260 3300025920 Ga0207649_10269397 Ga0207649_102693972 141
261 3300025921 Ga0207652_10006934 Ga0207652_100069346 141
262 3300025921 Ga0207652_10117239 Ga0207652_101172396 141
263 3300025923 Ga0207681_10000033 Ga0207681_1000003393 141
264 3300025923 Ga0207681_10226191 Ga0207681_102261912 141
265 3300025924 Ga0207694_10000922 Ga0207694_1000092215 141
266 3300025924 Ga0207694_10066744 Ga0207694_100667445 141
267 3300025924 Ga0207694_11602280 Ga0207694_116022801 141
268 3300025928 Ga0207700_10091213 Ga0207700_100912133 141
269 3300025929 Ga0207664_10360603 Ga0207664_103606032 141
270 3300025932 Ga0207690_10038994 Ga0207690_100389942 141
271 3300025932 Ga0207690_10278874 Ga0207690_102788742 141
272 3300025938 Ga0207704_11402000 Ga0207704_114020002 141
273 3300025941 Ga0207711_10379833 Ga0207711_103798331 141
274 3300025941 Ga0207711_10439760 Ga0207711_104397602 141
275 3300025944 Ga0207661_10169950 Ga0207661_101699502 141
276 3300025944 Ga0207661_11227678 Ga0207661_112276781 141
277 3300025944 Ga0207661_11255271 Ga0207661_112552712 141
278 3300025944 Ga0207661_11272750 Ga0207661_112727502 141
279 3300025945 Ga0207679_10196669 Ga0207679_101966692 141
280 3300025949 Ga0207667_10018917 Ga0207667_100189176 141
281 3300025949 Ga0207667_10031347 Ga0207667_100313476 141
282 3300025949 Ga0207667_10032946 Ga0207667_100329466 141
283 3300025949 Ga0207667_10035272 Ga0207667_100352721 141
284 3300025949 Ga0207667_10037502 Ga0207667_100375025 141
285 3300025949 Ga0207667_10070990 Ga0207667_100709902 141
286 3300025949 Ga0207667_10104164 Ga0207667_101041642 141
287 3300025949 Ga0207667_10158599 Ga0207667_101585994 141
288 3300025949 Ga0207667_10251268 Ga0207667_102512681 141
289 3300025949 Ga0207667_10479934 Ga0207667_104799341 141
290 3300025960 Ga0207651_10489057 Ga0207651_104890572 141
291 3300025960 Ga0207651_11937208 Ga0207651_119372081 141
292 3300025972 Ga0207668_10580528 Ga0207668_105805282 141
293 3300025981 Ga0207640_10008744 Ga0207640_100087443 141
294 3300025981 Ga0207640_10502453 Ga0207640_105024532 141
295 3300025986 Ga0207658_10123539 Ga0207658_101235394 141
296 3300026035 Ga0207703_10102632 Ga0207703_101026321 141
297 3300026035 Ga0207703_10416797 Ga0207703_104167972 141
298 3300026041 Ga0207639_10041089 Ga0207639_100410894 141
299 3300026041 Ga0207639_10320451 Ga0207639_103204512 141
300 3300026067 Ga0207678_10015868 Ga0207678_100158681 141
301 3300026067 Ga0207678_10018940 Ga0207678_100189404 141
302 3300026067 Ga0207678_10041404 Ga0207678_100414045 141
303 3300026078 Ga0207702_10101371 Ga0207702_101013712 141
304 3300026078 Ga0207702_11491331 Ga0207702_114913311 141
305 3300026116 Ga0207674_10020940 Ga0207674_100209405 141
306 3300026116 Ga0207674_11159944 Ga0207674_111599441 141
307 3300026118 Ga0207675_100875867 Ga0207675_1008758672 141
308 3300026142 Ga0207698_10070475 Ga0207698_100704754 141
309 3300026142 Ga0207698_10350320 Ga0207698_103503202 141
310 3300026142 Ga0207698_11467931 Ga0207698_114679311 141
311 3300028379 Ga0268266_10001104 Ga0268266_1000110423 141
312 3300028380 Ga0268265_10000230 Ga0268265_1000023024 141
313 3300028380 Ga0268265_10971492 Ga0268265_109714921 141
314 3300028381 Ga0268264_10068020 Ga0268264_100680205 141
315 3300028563 Ga0265319_1023707 Ga0265319_10237073 141
316 3300028573 Ga0265334_10030953 Ga0265334_100309533 141
317 3300028577 Ga0265318_10140311 Ga0265318_101403112 141
318 3300028654 Ga0265322_10049639 Ga0265322_100496392 141
319 3300028666 Ga0265336_10155144 Ga0265336_101551442 141
320 3300028800 Ga0265338_10035566 Ga0265338_100355667 141
321 3300028800 Ga0265338_10752130 Ga0265338_107521301 141
322 3300031240 Ga0265320_10089049 Ga0265320_100890493 141
323 3300031241 Ga0265325_10088585 Ga0265325_100885853 141
324 3300031344 Ga0265316_10071462 Ga0265316_100714623 141
325 3300031548 Ga0307408_102481682 Ga0307408_1024816821 141
326 3300031616 Ga0307508_10128696 Ga0307508_101286962 141
327 3300033180 Ga0307510_10189698 Ga0307510_101896982 141
328 3300035085 Ga0373929_0000002 Ga0373929_0000002_84342_84767 141
329 3300035085 Ga0373929_0108420 Ga0373929_0108420_264_689 141
330 3300035090 Ga0373949_0226743 Ga0373949_0226743_117_542 141
331 3300035112 Ga0373932_0057499 Ga0373932_0057499_708_1136 141
332 3300035241 Ga0373961_0000446 Ga0373961_0000446_1592_2017 141
333 3300035692 Ga0373935_0004352 Ga0373935_0004352_1921_2346 141
334 3300041441 Ga0451787_666878 Ga0451787_666878_246_671 141
335 3300041443 Ga0451789_0680423 Ga0451789_0680423_153_578 141
336 3300041451 Ga0451791_1198727 Ga0451791_1198727_217_642 141
337 3300041486 Ga0451807_2244152 Ga0451807_2244152_100_525 141
338 3300041505 Ga0451849_0736492 Ga0451849_0736492_963_1388 141
339 3300041509 Ga0451843_1200383 Ga0451843_1200383_1309_1734 141
340 3300042005 Ga0439448_0003792 Ga0439448_0003792_2535_2969 141
341 3300042876 Ga0451577_0441518 Ga0451577_0441518_186_611 141
342 3300044693 Ga0466961_0743852 Ga0466961_0743852_51_485 141
343 3300044712 Ga0453684_0063314 Ga0453684_0063314_1099_1524 141
344 3300044712 Ga0453684_0521277 Ga0453684_0521277_670_1104 141
345 3300044842 Ga0466957_1202807 Ga0466957_1202807_16_441 141
346 3300045049 Ga0466959_0185804 Ga0466959_0185804_826_1263 141
347 3300045051 Ga0451576_0284230 Ga0451576_0284230_855_1283 141
348 3300045976 Ga0466967_1158777 Ga0466967_1158777_166_600 141
349 3300046558 Ga0495633_0345275 Ga0495633_0345275_226_660 141
350 3300046665 Ga0495661_0145314 Ga0495661_0145314_790_1224 141
351 3300047472 Ga0495686_0000064 Ga0495686_0000064_224210_224644 141
352 3300047472 Ga0495686_0018132 Ga0495686_0018132_1900_2334 141
353 3300047472 Ga0495686_0059010 Ga0495686_0059010_43_477 141
354 3300047472 Ga0495686_0716604 Ga0495686_0716604_23_457 141
355 3300048090 Ga0495615_0003433 Ga0495615_0003433_947_1372 141
356 3300048907 Ga0496104_0001188 Ga0496104_0001188_9453_9887 141
357 3300048908 Ga0496105_0354459 Ga0496105_0354459_340_765 141
358 3300048911 Ga0496108_0510016 Ga0496108_0510016_278_712 141
359 3300048915 Ga0496112_0458832 Ga0496112_0458832_52_477 141
360 3300048917 Ga0496114_0000036 Ga0496114_0000036_82915_83340 141
361 3300048929 Ga0496126_0000092 Ga0496126_0000092_207091_207525 141
362 3300048929 Ga0496126_0000170 Ga0496126_0000170_146108_146542 141
363 3300049570 Ga0501033_0583663 Ga0501033_0583663_206_640 141
364 3300049571 Ga0501034_0025112 Ga0501034_0025112_1655_2083 141
365 3300049571 Ga0501034_0052205 Ga0501034_0052205_1495_1944 141
366 3300049574 Ga0501038_0099431 Ga0501038_0099431_230_664 141
367 3300049581 Ga0501047_0273986 Ga0501047_0273986_442_876 141
368 3300049583 Ga0501067_0110451 Ga0501067_0110451_984_1409 141
369 3300049584 Ga0501068_0023815 Ga0501068_0023815_982_1407 141
370 3300049586 Ga0501070_0773340 Ga0501070_0773340_97_531 141
371 3300049589 Ga0501073_0313362 Ga0501073_0313362_402_827 141
372 3300049591 Ga0501075_0000962 Ga0501075_0000962_4885_5310 141
373 3300049593 Ga0501077_0000515 Ga0501077_0000515_21699_22124 141
374 3300049742 Ga0501080_0004504 Ga0501080_0004504_10155_10580 141
375 3300049742 Ga0501080_1479603 Ga0501080_1479603_134_568 141
376 3300049744 Ga0501083_0011441 Ga0501083_0011441_4715_5140 141
377 3300049822 Ga0501035_0379506 Ga0501035_0379506_540_965 141
378 3300049823 Ga0501044_0204756 Ga0501044_0204756_125_559 141
379 3300050489 nmdc:mga03683_247637_c1 nmdc:mga03683_247637_c1_80_505 141
380 3300050507 nmdc:mga05p37_440056_c1 nmdc:mga05p37_440056_c1_530_955 141
381 3300050512 nmdc:mga0n895_194205_c1 nmdc:mga0n895_194205_c1_1380_1805 141
382 3300050512 nmdc:mga0n895_378931_c1 nmdc:mga0n895_378931_c1_355_780 141
383 3300050514 nmdc:mga08x19_125868_c1 nmdc:mga08x19_125868_c1_766_1191 141
384 3300050514 nmdc:mga08x19_210_c1 nmdc:mga08x19_210_c1_1650_2075 141
385 3300050515 nmdc:mga0a205_237526_c1 nmdc:mga0a205_237526_c1_320_745 141
386 3300053083 Ga0495655_0049942 Ga0495655_0049942_318_743 141
387 3300059493 Ga0587077_006017 Ga0587077_006017_1064_1495 141
388 3300059506 Ga0587085_034593 Ga0587085_034593_312_737 141
389 3300059511 Ga0587091_089769 Ga0587091_089769_155_580 141
390 3300059639 Ga0587062_032284 Ga0587062_032284_66_491 141
391 3300060353 Ga0501082_0129159 Ga0501082_0129159_606_1031 141
392 2162886007 SwRhRL2b_contig_3744550 SwRhRL2b_0745.00003160 142
393 3300001977 JGI24746J21847_1000129 JGI24746J21847_10001296 142
394 3300002077 JGI24744J21845_10008544 JGI24744J21845_100085442 142
395 3300002155 JGI24033J26618_1003213 JGI24033J26618_10032132 142
396 3300003320 rootH2_10042645 rootH2_100426452 142
397 3300003323 rootH1_10159199 rootH1_101591993 142
398 3300003323 rootH1_10226936 rootH1_102269362 142
399 3300005289 Ga0065704_10101503 Ga0065704_101015032 142
400 3300005327 Ga0070658_10018910 Ga0070658_100189102 142
401 3300005328 Ga0070676_10674073 Ga0070676_106740731 142
402 3300005334 Ga0068869_100095216 Ga0068869_1000952164 142
403 3300005334 Ga0068869_100709289 Ga0068869_1007092891 142
404 3300005344 Ga0070661_100005986 Ga0070661_1000059866 142
405 3300005344 Ga0070661_100232555 Ga0070661_1002325552 142
406 3300005459 Ga0068867_100000425 Ga0068867_10000042510 142
407 3300005467 Ga0070706_100016100 Ga0070706_1000161001 142
408 3300005564 Ga0070664_100000306 Ga0070664_10000030613 142
409 3300005577 Ga0068857_100268368 Ga0068857_1002683684 142
410 3300005616 Ga0068852_100318936 Ga0068852_1003189362 142
411 3300006173 Ga0070716_100068384 Ga0070716_1000683845 142
412 3300009148 Ga0105243_10000129 Ga0105243_1000012935 142
413 3300009545 Ga0105237_10010685 Ga0105237_100106857 142
414 3300011119 Ga0105246_10019298 Ga0105246_100192981 142
415 3300013100 Ga0157373_10004032 Ga0157373_1000403210 142
416 3300013104 Ga0157370_10000554 Ga0157370_100005545 142
417 3300013104 Ga0157370_10056640 Ga0157370_100566402 142
418 3300013104 Ga0157370_10942613 Ga0157370_109426131 142
419 3300020081 Ga0206354_11021863 Ga0206354_110218631 142
420 3300025907 Ga0207645_10219356 Ga0207645_102193562 142
421 3300025909 Ga0207705_10008756 Ga0207705_100087568 142
422 3300025920 Ga0207649_10005562 Ga0207649_100055628 142
423 3300025920 Ga0207649_10340263 Ga0207649_103402632 142
424 3300025935 Ga0207709_10000177 Ga0207709_1000017736 142
425 3300025939 Ga0207665_10155248 Ga0207665_101552482 142
426 3300025940 Ga0207691_10585429 Ga0207691_105854291 142
427 3300025942 Ga0207689_10167929 Ga0207689_101679292 142
428 3300025945 Ga0207679_10002514 Ga0207679_100025143 142
429 3300026089 Ga0207648_10000380 Ga0207648_100003808 142
430 3300026116 Ga0207674_10270404 Ga0207674_102704041 142
431 3300026142 Ga0207698_10372112 Ga0207698_103721122 142
432 3300031241 Ga0265325_10257017 Ga0265325_102570171 142
433 3300031250 Ga0265331_10023024 Ga0265331_100230245 142
434 3300031251 Ga0265327_10000629 Ga0265327_100006296 142
435 3300031548 Ga0307408_100000021 Ga0307408_100000021252 142
436 3300031548 Ga0307408_100014510 Ga0307408_1000145103 142
437 3300031901 Ga0307406_10000099 Ga0307406_1000009927 142
438 3300031903 Ga0307407_10001025 Ga0307407_100010255 142
439 3300031903 Ga0307407_10144949 Ga0307407_101449493 142
440 3300031911 Ga0307412_10000013 Ga0307412_1000001378 142
441 3300031995 Ga0307409_100024303 Ga0307409_1000243032 142
442 3300032002 Ga0307416_100065329 Ga0307416_1000653292 142
443 3300032002 Ga0307416_100544289 Ga0307416_1005442892 142
444 3300032004 Ga0307414_10000163 Ga0307414_1000016340 142
445 3300032004 Ga0307414_10057144 Ga0307414_100571445 142
446 3300032004 Ga0307414_10401313 Ga0307414_104013132 142
447 3300032005 Ga0307411_10783934 Ga0307411_107839341 142
448 3300035114 Ga0373939_0277616 Ga0373939_0277616_180_608 142
449 3300041408 Ga0439453_0000606 Ga0439453_0000606_818_1246 142
450 3300041443 Ga0451789_0154147 Ga0451789_0154147_31_459 142
451 3300041443 Ga0451789_1091942 Ga0451789_1091942_93_521 142
452 3300042126 Ga0450888_001278 Ga0450888_001278_823_1251 142
453 3300042127 Ga0450890_000014 Ga0450890_000014_20084_20512 142
454 3300042130 Ga0450892_000004 Ga0450892_000004_9049_9477 142
455 3300042144 Ga0450889_008224 Ga0450889_008224_189_617 142
456 3300042532 Ga0450893_0055904 Ga0450893_0055904_88_516 142
457 3300042876 Ga0451577_1244237 Ga0451577_1244237_207_635 142
458 3300044712 Ga0453684_0393384 Ga0453684_0393384_563_991 142
459 3300048925 Ga0496122_0515519 Ga0496122_0515519_72_500 142
460 3300048926 Ga0496123_0126698 Ga0496123_0126698_435_863 142
461 3300049162 Ga0501307_002000 Ga0501307_002000_1205_1633 142
462 3300049527 Ga0501311_003387 Ga0501311_003387_262_690 142
463 3300049528 Ga0501312_042231 Ga0501312_042231_221_649 142
464 3300049531 Ga0501315_003219 Ga0501315_003219_946_1374 142
465 3300049534 Ga0501318_000498 Ga0501318_000498_234_662 142
466 3300049536 Ga0501320_000406 Ga0501320_000406_1816_2244 142
467 3300049537 Ga0501321_015448 Ga0501321_015448_243_671 142
468 3300049544 Ga0501328_01054 Ga0501328_01054_370_798 142
469 3300049569 Ga0501032_0066044 Ga0501032_0066044_1397_1825 142
470 3300049575 Ga0501039_0179710 Ga0501039_0179710_935_1363 142
471 3300049586 Ga0501070_0624790 Ga0501070_0624790_74_502 142
472 3300049587 Ga0501071_0652416 Ga0501071_0652416_262_690 142
473 3300049665 Ga0501227_002242 Ga0501227_002242_1993_2421 142
474 3300049665 Ga0501227_103760 Ga0501227_103760_302_730 142
475 3300053122 Ga0500608_296952 Ga0500608_296952_106_534 142
476 3300053136 Ga0500559_0000535 Ga0500559_0000535_20306_20734 142
477 3300059641 Ga0587068_033361 Ga0587068_033361_221_649 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

9

68

0.99

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

73

147

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9594 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9545 3 78
2bcw-assembly1.cif.gz_A coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex 0.9482 9 72
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9338 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9311 3 78
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9609 3 68 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9545 3 78 3.30.1550.10
af_Q9VFJ2_20_96_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9517 6 75 3.30.1550.10
4v19K01 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9409 7 71 3.30.1550.10
af_Q8IIQ5_3_68_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9323 6 69 3.30.1550.10
ID Description Score Start End GO Terms
AF-A0A1B7WHC5-F1-model_v4 50S ribosomal protein L11 1.004 1 69 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2V5R234-F1-model_v4 50S ribosomal protein L11 1.001 1 74 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A849X8K1-F1-model_v4 50S ribosomal protein L11 0.9952 1 69 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A5D0I5Z3-F1-model_v4 50S ribosomal protein L11 0.9933 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A5N9EE46-F1-model_v4 50S ribosomal protein L11 0.9907 1 67 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
83.45 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map