F451763

General Info

Members Datasets Scaffolds Average Seq Length
477 287 954 351

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0104031|Ga0495665_0104031_100_1269
Length 389
Sequence MTPCSAILCGGAGIVIVSAASGPKERRVREIIMKFSLAALSAATSVALALTSFGVSAADYPAPKQGEWIARDFKFHTGENMPELRLHYTTIGEPTGQPVLVLHGSGGSAASMLTPTFGGELFGADQPLDASKYYIIIPDGIGHGKSSKPSDGMKTAFPKYNYEDMVDAHYRLLKEGLGVKHLRLVIGNSMGGMHTWIWGGKYPQFMDALVPMASQPTEMAARNWMLRRMMIETIRNDPDYNGGNYTSQPRMMKYAINAYGIATGGGTLAYQMLAPTAAKADKMVDDRLAAAIAADANDFIYQWDASHDFNPSARLDKIEAVLLAINAADDERNPPETGITDAAMKRVKNGRLFLIPASTETRGHLTTGNAAFYKKQLQELLQTAPQRTM

Samples

Sample ID Description Type Environment
1 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
260 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
268 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
269 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
270 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
271 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
272 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
273 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
274 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
275 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
276 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
277 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
278 2791355199
279 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
280 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
281 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
282 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
283 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
284 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
285 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
286 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
287 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 2.31
Rhizoplane 4.19
Rhizosphere 80.71
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495665_0104031 3300046531 Bacteria 1490
2 ARcpr5oldR_c000646 3300000041 Bacteria 4164
3 ARcpr5yngRDRAFT_c000989 3300000043 Bacteria 3268
4 ARSoilOldRDRAFT_c000831 3300000044 Bacteria 3092
5 ARCol0yngRDRAFT_1000995 3300000652 Bacteria 2486
6 JGI25406J46586_10005087 3300003203 Bacteria 6100
7 JGI25153J46596_10007272 3300003215 Bacteria 5474
8 Ga0070676_10021552 3300005328 Bacteria 3608
9 Ga0070683_100020536 3300005329 Bacteria 5877
10 Ga0070683_100119120 3300005329 Bacteria 2493
11 Ga0070683_100171532 3300005329 Bacteria 2059
12 Ga0070677_10003427 3300005333 Bacteria 5114
13 Ga0068869_100247496 3300005334 Bacteria 1422
14 Ga0070666_10090490 3300005335 Bacteria 2102
15 Ga0070680_100014976 3300005336 Bacteria 6069
16 Ga0070680_100018264 3300005336 Bacteria 5539
17 Ga0070682_100080076 3300005337 Bacteria 2111
18 Ga0070682_100101858 3300005337 Bacteria 1897
19 Ga0070660_100066012 3300005339 Bacteria 2817
20 Ga0070660_100076837 3300005339 Bacteria 2616
21 Ga0070668_100057246 3300005347 Bacteria 3012
22 Ga0070669_100072499 3300005353 Bacteria 2550
23 Ga0070675_100139212 3300005354 Bacteria 2073
24 Ga0070671_100052583 3300005355 Bacteria 3386
25 Ga0070673_100177124 3300005364 Bacteria 1823
26 Ga0070667_100084304 3300005367 Bacteria 2724
27 Ga0070709_10001480 3300005434 Bacteria 12685
28 Ga0070709_10005323 3300005434 Bacteria 6968
29 Ga0070709_10013521 3300005434 Bacteria 4592
30 Ga0070709_10192411 3300005434 Bacteria 1440
31 Ga0070714_100009188 3300005435 Bacteria 7759
32 Ga0070714_100035003 3300005435 Bacteria 4206
33 Ga0070714_100128347 3300005435 Bacteria 2264
34 Ga0070713_100004561 3300005436 Bacteria 9338
35 Ga0070713_100155907 3300005436 Bacteria 2035
36 Ga0070710_10000417 3300005437 Bacteria 19992
37 Ga0070710_10066726 3300005437 Bacteria 2063
38 Ga0070711_100001688 3300005439 Bacteria 12234
39 Ga0070663_100029577 3300005455 Bacteria 3745
40 Ga0070663_100029957 3300005455 Bacteria 3724
41 Ga0070663_100135034 3300005455 Bacteria 1878
42 Ga0070678_100034555 3300005456 Bacteria 3522
43 Ga0070678_100120524 3300005456 Bacteria 2068
44 Ga0070678_100278906 3300005456 Bacteria 1412
45 Ga0070662_100082699 3300005457 Bacteria 2394
46 Ga0070681_10008226 3300005458 Bacteria 10206
47 Ga0070698_100105939 3300005471 Bacteria 2781
48 Ga0070679_100053159 3300005530 Bacteria 4032
49 Ga0070679_100346331 3300005530 Bacteria 1434
50 Ga0070684_100007976 3300005535 Bacteria 8266
51 Ga0070684_100058035 3300005535 Bacteria 3381
52 Ga0070684_100090240 3300005535 Bacteria 2725
53 Ga0068853_100055433 3300005539 Bacteria 3417
54 Ga0068853_100063144 3300005539 Bacteria 3208
55 Ga0068853_100073343 3300005539 Bacteria 2984
56 Ga0068853_100117234 3300005539 Bacteria 2371
57 Ga0068853_100207816 3300005539 Bacteria 1783
58 Ga0068853_100310544 3300005539 Bacteria 1459
59 Ga0070672_100058450 3300005543 Bacteria 3031
60 Ga0070672_100083513 3300005543 Bacteria 2563
61 Ga0070672_100109511 3300005543 Bacteria 2250
62 Ga0070686_100257312 3300005544 Bacteria 1278
63 Ga0070693_100115836 3300005547 Bacteria 1656
64 Ga0070665_100005813 3300005548 Bacteria 12652
65 Ga0070665_100055307 3300005548 Bacteria 3980
66 Ga0070665_100075858 3300005548 Bacteria 3369
67 Ga0070665_100553578 3300005548 Bacteria 1162
68 Ga0070704_100278284 3300005549 Bacteria 1385
69 Ga0068855_100047201 3300005563 Bacteria 5088
70 Ga0068855_100215943 3300005563 Bacteria 2153
71 Ga0068857_100107433 3300005577 Bacteria 2507
72 Ga0068857_100131586 3300005577 Bacteria 2256
73 Ga0068857_100234325 3300005577 Bacteria 1679
74 Ga0068854_100140828 3300005578 Bacteria 1851
75 Ga0068856_100002827 3300005614 Bacteria 17773
76 Ga0068856_100164803 3300005614 Bacteria 2227
77 Ga0068864_100020965 3300005618 Bacteria 5473
78 Ga0068864_100331679 3300005618 Bacteria 1431
79 Ga0068861_100144956 3300005719 Bacteria 1942
80 Ga0068851_10022035 3300005834 Bacteria 3099
81 Ga0068870_10093566 3300005840 Bacteria 1686
82 Ga0068860_100097680 3300005843 Bacteria 2800
83 Ga0068862_100152378 3300005844 Bacteria 2058
84 Ga0068862_100454638 3300005844 Bacteria 1208
85 Ga0081538_10033029 3300005981 Bacteria 3453
86 Ga0081538_10067318 3300005981 Bacteria 2000
87 Ga0081540_1006552 3300005983 Bacteria 8454
88 Ga0081540_1028197 3300005983 Bacteria 3160
89 Ga0081539_10000321 3300005985 Bacteria 106887
90 Ga0081539_10041443 3300005985 Bacteria 2691
91 Ga0070717_10020188 3300006028 Bacteria 5236
92 Ga0070717_10055976 3300006028 Bacteria 3256
93 Ga0075363_100002799 3300006048 Bacteria 7242
94 Ga0070715_10020200 3300006163 Bacteria 2566
95 Ga0070716_100003948 3300006173 Bacteria 7035
96 Ga0070716_100077450 3300006173 Bacteria 1974
97 Ga0070712_100007788 3300006175 Bacteria 6704
98 Ga0070712_100008845 3300006175 Bacteria 6340
99 Ga0075367_10015462 3300006178 Bacteria 4149
100 Ga0075367_10026542 3300006178 Bacteria 3286
101 Ga0075367_10145439 3300006178 Bacteria 1470
102 Ga0075369_10034497 3300006186 Bacteria 2148
103 Ga0075366_10204077 3300006195 Bacteria 1202
104 Ga0097621_100157936 3300006237 Bacteria 1947
105 Ga0097621_100250879 3300006237 Bacteria 1549
106 Ga0075370_10080360 3300006353 Bacteria 1873
107 Ga0075430_100257120 3300006846 Bacteria 1446
108 Ga0075433_10256876 3300006852 Bacteria 1550
109 Ga0068865_100047092 3300006881 Bacteria 2961
110 Ga0068865_100081135 3300006881 Bacteria 2328
111 Ga0075435_100127669 3300007076 Bacteria 2126
112 Ga0099795_10056282 3300007788 Bacteria 1446
113 Ga0111539_10031306 3300009094 Bacteria 6463
114 Ga0105245_10013409 3300009098 Bacteria 7141
115 Ga0105245_10060778 3300009098 Bacteria 3404
116 Ga0105245_10139845 3300009098 Bacteria 2279
117 Ga0105245_10178100 3300009098 Bacteria 2029
118 Ga0105245_10218397 3300009098 Bacteria 1838
119 Ga0105247_10016797 3300009101 Bacteria 4388
120 Ga0105247_10054471 3300009101 Bacteria 2468
121 Ga0114129_10119512 3300009147 Bacteria 3630
122 Ga0114129_10377446 3300009147 Bacteria 1873
123 Ga0105243_10121314 3300009148 Bacteria 2204
124 Ga0105241_10020147 3300009174 Bacteria 4927
125 Ga0105241_10046726 3300009174 Bacteria 3289
126 Ga0105248_10198411 3300009177 Bacteria 2261
127 Ga0105237_10018863 3300009545 Bacteria 7133
128 Ga0105237_10303708 3300009545 Bacteria 1599
129 Ga0105238_10022240 3300009551 Bacteria 6464
130 Ga0105238_10066730 3300009551 Bacteria 3599
131 Ga0105238_10080730 3300009551 Bacteria 3241
132 Ga0105239_10044642 3300010375 Bacteria 4858
133 Ga0105239_10229978 3300010375 Bacteria 2080
134 Ga0105246_10055044 3300011119 Bacteria 2744
135 Ga0157370_10081072 3300013104 Bacteria 3054
136 Ga0157369_10029246 3300013105 Bacteria 6090
137 Ga0157369_10045780 3300013105 Bacteria 4756
138 Ga0157369_10132973 3300013105 Bacteria 2635
139 Ga0157374_10051630 3300013296 Bacteria 3827
140 Ga0157378_10092115 3300013297 Bacteria 2757
141 Ga0163162_10147786 3300013306 Bacteria 2467
142 Ga0157372_10117661 3300013307 Bacteria 3048
143 Ga0157372_10282382 3300013307 Bacteria 1930
144 Ga0157375_10009376 3300013308 Bacteria 8594
145 Ga0157375_10055784 3300013308 Bacteria 3897
146 Ga0157375_10063703 3300013308 Bacteria 3669
147 Ga0157375_10173311 3300013308 Bacteria 2306
148 Ga0163163_10029708 3300014325 Bacteria 5260
149 Ga0157379_10024614 3300014968 Bacteria 5344
150 Ga0157379_10034714 3300014968 Bacteria 4498
151 Ga0157379_10133438 3300014968 Bacteria 2236
152 Ga0157379_10136580 3300014968 Bacteria 2209
153 Ga0157379_10161608 3300014968 Bacteria 2022
154 Ga0157376_10086773 3300014969 Bacteria 2699
155 Ga0163161_10133381 3300017792 Bacteria 1875
156 Ga0213873_10012025 3300021358 Bacteria 1869
157 Ga0213876_10006775 3300021384 Bacteria 6255
158 Ga0213876_10066363 3300021384 Bacteria 1905
159 Ga0213876_10129528 3300021384 Bacteria 1341
160 Ga0209758_1007858 3300025297 Bacteria 7103
161 Ga0207656_10012790 3300025321 Bacteria 3194
162 Ga0207656_10104035 3300025321 Bacteria 1305
163 Ga0207682_10006173 3300025893 Bacteria 4843
164 Ga0207682_10016425 3300025893 Bacteria 2887
165 Ga0207692_10005681 3300025898 Bacteria 5011
166 Ga0207692_10015533 3300025898 Bacteria 3352
167 Ga0207710_10009723 3300025900 Bacteria 4041
168 Ga0207710_10054699 3300025900 Bacteria 1798
169 Ga0207699_10012265 3300025906 Bacteria 4356
170 Ga0207699_10034006 3300025906 Bacteria 2886
171 Ga0207645_10005001 3300025907 Bacteria 9712
172 Ga0207643_10044119 3300025908 Bacteria 2517
173 Ga0207654_10060241 3300025911 Bacteria 2217
174 Ga0207654_10158476 3300025911 Bacteria 1460
175 Ga0207707_10001008 3300025912 Bacteria 27003
176 Ga0207707_10005928 3300025912 Bacteria 10692
177 Ga0207707_10026306 3300025912 Bacteria 5085
178 Ga0207707_10058231 3300025912 Bacteria 3362
179 Ga0207671_10137209 3300025914 Bacteria 1882
180 Ga0207671_10147184 3300025914 Bacteria 1818
181 Ga0207693_10001458 3300025915 Bacteria 20926
182 Ga0207693_10006327 3300025915 Bacteria 9817
183 Ga0207693_10020973 3300025915 Bacteria 5194
184 Ga0207663_10000176 3300025916 Bacteria 28557
185 Ga0207663_10016826 3300025916 Bacteria 4065
186 Ga0207660_10221998 3300025917 Bacteria 1483
187 Ga0207660_10266449 3300025917 Bacteria 1356
188 Ga0207657_10022995 3300025919 Bacteria 5816
189 Ga0207657_10049132 3300025919 Bacteria 3679
190 Ga0207652_10003168 3300025921 Bacteria 13699
191 Ga0207652_10054453 3300025921 Bacteria 3439
192 Ga0207652_10108185 3300025921 Bacteria 2463
193 Ga0207681_10178329 3300025923 Bacteria 1616
194 Ga0207694_10136989 3300025924 Bacteria 1967
195 Ga0207659_10053417 3300025926 Bacteria 2882
196 Ga0207659_10126596 3300025926 Bacteria 1965
197 Ga0207700_10005697 3300025928 Bacteria 7480
198 Ga0207700_10012732 3300025928 Bacteria 5438
199 Ga0207664_10043553 3300025929 Bacteria 3511
200 Ga0207664_10083947 3300025929 Bacteria 2597
201 Ga0207670_10113335 3300025936 Bacteria 1958
202 Ga0207669_10153782 3300025937 Bacteria 1615
203 Ga0207704_10165664 3300025938 Bacteria 1578
204 Ga0207665_10005346 3300025939 Bacteria 8579
205 Ga0207665_10012835 3300025939 Bacteria 5509
206 Ga0207691_10006284 3300025940 Bacteria 11467
207 Ga0207691_10062023 3300025940 Bacteria 3394
208 Ga0207689_10221582 3300025942 Bacteria 1563
209 Ga0207661_10010494 3300025944 Bacteria 6667
210 Ga0207661_10158274 3300025944 Bacteria 1963
211 Ga0207679_10009946 3300025945 Bacteria 6108
212 Ga0207667_10138347 3300025949 Bacteria 2507
213 Ga0207651_10206997 3300025960 Bacteria 1576
214 Ga0207712_10170173 3300025961 Bacteria 1702
215 Ga0207658_10074110 3300025986 Bacteria 2586
216 Ga0207677_10216696 3300026023 Bacteria 1532
217 Ga0207703_10009809 3300026035 Bacteria 7511
218 Ga0207639_10023543 3300026041 Bacteria 4448
219 Ga0207639_10095480 3300026041 Bacteria 2389
220 Ga0207639_10122208 3300026041 Bacteria 2141
221 Ga0207678_10088778 3300026067 Bacteria 2642
222 Ga0207678_10102309 3300026067 Bacteria 2446
223 Ga0207678_10118306 3300026067 Bacteria 2261
224 Ga0207708_10033443 3300026075 Bacteria 3906
225 Ga0207702_10003504 3300026078 Bacteria 14307
226 Ga0207648_10022633 3300026089 Bacteria 5641
227 Ga0207648_10060130 3300026089 Bacteria 3314
228 Ga0207674_10015173 3300026116 Bacteria 8478
229 Ga0207674_10017324 3300026116 Bacteria 7860
230 Ga0207674_10025859 3300026116 Bacteria 6249
231 Ga0207674_10133753 3300026116 Bacteria 2443
232 Ga0207675_100181607 3300026118 Bacteria 2015
233 Ga0207683_10000979 3300026121 Bacteria 26185
234 Ga0207683_10021099 3300026121 Bacteria 5575
235 Ga0207683_10023560 3300026121 Bacteria 5296
236 Ga0207683_10059015 3300026121 Bacteria 3369
237 Ga0207683_10097928 3300026121 Bacteria 2616
238 Ga0207698_10162577 3300026142 Bacteria 1955
239 Ga0268266_10000446 3300028379 Bacteria 61283
240 Ga0268266_10009990 3300028379 Bacteria 8332
241 Ga0268266_10017902 3300028379 Bacteria 6038
242 Ga0268266_10018419 3300028379 Bacteria 5950
243 Ga0307517_10001444 3300028786 Bacteria 39936
244 Ga0307515_10021507 3300028794 Bacteria 11433
245 Ga0307513_10206109 3300031456 Bacteria 1802
246 Ga0307408_100294319 3300031548 Bacteria 1357
247 Ga0307508_10000184 3300031616 Bacteria 75613
248 Ga0307508_10007695 3300031616 Bacteria 10018
249 Ga0265314_10003230 3300031711 Bacteria 15933
250 Ga0307516_10050012 3300031730 Bacteria 4103
251 Ga0307410_10116997 3300031852 Bacteria 1938
252 Ga0307416_100116417 3300032002 Bacteria 2370
253 Ga0307510_10009874 3300033180 Bacteria 11359
254 Ga0307510_10025554 3300033180 Bacteria 6807
255 Ga0373938_0010813 3300034957 Bacteria 1686
256 Ga0373926_0004071 3300035083 Bacteria 4774
257 Ga0373949_0004588 3300035090 Bacteria 3150
258 Ga0373923_0051984 3300035111 Bacteria 1721
259 Ga0373923_0058485 3300035111 Bacteria 1632
260 Ga0373936_0010572 3300035113 Bacteria 3484
261 Ga0373953_0085212 3300035117 Bacteria 1318
262 Ga0373954_0007500 3300035118 Bacteria 4773
263 Ga0373954_0128798 3300035118 Bacteria 1231
264 Ga0373954_0152470 3300035118 Bacteria 1129
265 Ga0373957_0030503 3300035120 Unclassified 1976
266 Ga0373943_0051407 3300035170 Bacteria 2029
267 Ga0373946_0006888 3300035171 Bacteria 4138
268 Ga0373924_0013710 3300035410 Bacteria 3050
269 Ga0373924_0134071 3300035410 Bacteria 1078
270 Ga0373931_0000299 3300035691 Bacteria 20799
271 Ga0373935_0000660 3300035692 Bacteria 18207
272 Ga0373935_0010312 3300035692 Bacteria 5603
273 Ga0373935_0317519 3300035692 Bacteria 1105
274 Ga0373927_0004283 3300035695 Bacteria 10016
275 Ga0373927_0094384 3300035695 Bacteria 1944
276 Ga0373927_0143494 3300035695 Bacteria 1562
277 Ga0373933_0005476 3300035724 Bacteria 6915
278 Ga0373933_0085684 3300035724 Bacteria 1937
279 Ga0373933_0124731 3300035724 Bacteria 1615
280 Ga0373947_0001631 3300035725 Bacteria 13762
281 Ga0373937_0035153 3300036401 Bacteria 4559
282 Ga0373937_0197937 3300036401 Bacteria 1888
283 Ga0373937_0393690 3300036401 Bacteria 1314
284 Ga0373925_0001524 3300037068 Bacteria 19779
285 Ga0395900_0006562 3300037418 Bacteria 12123
286 Ga0395898_0061121 3300037466 Bacteria 3660
287 Ga0395901_0057706 3300038443 Bacteria 4037
288 Ga0436365_0689701 3300039437 Bacteria 2000
289 Ga0436365_0959977 3300039437 Bacteria 23998
290 Ga0436361_0300746 3300039447 Bacteria 4275
291 Ga0436362_0233808 3300039453 Bacteria 1563
292 Ga0439465_0059468 3300041413 Bacteria 1265
293 Ga0466959_0004580 3300045049 Bacteria 9281
294 Ga0495592_0004852 3300046454 Bacteria 9894
295 Ga0495592_0009493 3300046454 Bacteria 7315
296 Ga0495592_0055876 3300046454 Bacteria 2918
297 Ga0495592_0066393 3300046454 Bacteria 2640
298 Ga0495603_0000155 3300046455 Bacteria 34390
299 Ga0495603_0009165 3300046455 Bacteria 5980
300 Ga0495603_0119085 3300046455 Bacteria 1539
301 Ga0495629_0005389 3300046459 Bacteria 9542
302 Ga0495638_0104585 3300046460 Bacteria 1688
303 Ga0495641_0013284 3300046461 Bacteria 4535
304 Ga0495651_0030285 3300046462 Bacteria 4221
305 Ga0495651_0031110 3300046462 Bacteria 4162
306 Ga0495653_0020657 3300046463 Bacteria 5334
307 Ga0495653_0065522 3300046463 Bacteria 2734
308 Ga0495580_0006361 3300046472 Bacteria 9636
309 Ga0495582_0000401 3300046473 Bacteria 23632
310 Ga0495582_0047839 3300046473 Bacteria 2355
311 Ga0495639_0000146 3300046475 Bacteria 36496
312 Ga0495662_0004838 3300046476 Bacteria 6745
313 Ga0495664_0061559 3300046477 Bacteria 2234
314 Ga0495664_0073697 3300046477 Bacteria 2041
315 Ga0495594_0002348 3300046499 Bacteria 9846
316 Ga0495594_0054690 3300046499 Bacteria 2200
317 Ga0495583_0065217 3300046506 Bacteria 1614
318 Ga0495606_0005824 3300046507 Bacteria 11624
319 Ga0495608_0061655 3300046511 Bacteria 2466
320 Ga0495618_0001029 3300046514 Bacteria 19114
321 Ga0495620_0026520 3300046515 Bacteria 2724
322 Ga0495628_0069263 3300046516 Bacteria 2751
323 Ga0495628_0090592 3300046516 Bacteria 2368
324 Ga0495630_0004000 3300046517 Bacteria 10315
325 Ga0495630_0104855 3300046517 Bacteria 2140
326 Ga0495631_0022372 3300046518 Bacteria 2939
327 Ga0495644_0018812 3300046523 Bacteria 2636
328 Ga0495652_0145987 3300046529 Bacteria 1854
329 Ga0495665_0001951 3300046531 Bacteria 11134
330 Ga0495640_0006675 3300046533 Bacteria 9105
331 Ga0495640_0104863 3300046533 Unclassified 1852
332 Ga0495586_0161875 3300046535 Bacteria 1262
333 Ga0495587_0008972 3300046536 Bacteria 6417
334 Ga0495598_0003891 3300046537 Bacteria 3199
335 Ga0495645_0006201 3300046543 Bacteria 8278
336 Ga0495645_0007652 3300046543 Bacteria 7516
337 Ga0495645_0040971 3300046543 Bacteria 3377
338 Ga0495645_0056729 3300046543 Bacteria 2844
339 Ga0495667_0011204 3300046559 Bacteria 6070
340 Ga0495667_0026069 3300046559 Bacteria 3937
341 Ga0495667_0126564 3300046559 Bacteria 1648
342 Ga0495667_0192855 3300046559 Bacteria 1305
343 Ga0495634_0003138 3300046642 Bacteria 13406
344 Ga0495635_0000823 3300046663 Bacteria 20335
345 Ga0495635_0007234 3300046663 Bacteria 7755
346 Ga0495659_0010172 3300046664 Bacteria 3014
347 Ga0495659_0097516 3300046664 Bacteria 1135
348 Ga0495661_0065750 3300046665 Bacteria 2136
349 Ga0495588_0038738 3300046674 Bacteria 2426
350 Ga0495657_0045623 3300046675 Bacteria 2973
351 Ga0495599_0009170 3300046678 Bacteria 6037
352 Ga0495646_0001170 3300046680 Bacteria 15326
353 Ga0495647_0000494 3300046681 Bacteria 11439
354 Ga0495658_0002856 3300046683 Bacteria 8681
355 Ga0495658_0152277 3300046683 Bacteria 1421
356 Ga0495669_0012465 3300046684 Bacteria 3619
357 Ga0495669_0022817 3300046684 Bacteria 2720
358 Ga0495613_0012542 3300046689 Bacteria 6299
359 Ga0495613_0251813 3300046689 Bacteria 1232
360 Ga0495624_0004679 3300046690 Bacteria 9966
361 Ga0495624_0143110 3300046690 Bacteria 1464
362 Ga0495671_0101892 3300046692 Bacteria 1403
363 Ga0495671_0120016 3300046692 Bacteria 1283
364 Ga0495581_0000865 3300047315 Bacteria 16162
365 Ga0495581_0020871 3300047315 Bacteria 3801
366 Ga0495604_0066263 3300047317 Bacteria 2747
367 Ga0495604_0084938 3300047317 Bacteria 2362
368 Ga0495636_0029368 3300047318 Bacteria 2244
369 Ga0495674_0027198 3300047319 Bacteria 5227
370 Ga0495674_0037730 3300047319 Bacteria 4341
371 Ga0495674_0048300 3300047319 Bacteria 3766
372 Ga0495674_0424023 3300047319 Bacteria 1071
373 Ga0495676_0032170 3300047321 Bacteria 4431
374 Ga0495680_0015741 3300047322 Bacteria 6513
375 Ga0495680_0088729 3300047322 Bacteria 2323
376 Ga0495675_0006644 3300047444 Bacteria 7083
377 Ga0495675_0036677 3300047444 Bacteria 3125
378 Ga0495675_0166460 3300047444 Bacteria 1355
379 Ga0495684_0156441 3300047471 Bacteria 1702
380 Ga0495684_0187509 3300047471 Bacteria 1531
381 Ga0495593_0002852 3300047673 Bacteria 10419
382 Ga0495602_0003336 3300048088 Bacteria 16576
383 Ga0495602_0050346 3300048088 Bacteria 3722
384 Ga0495614_0015990 3300048089 Bacteria 3268
385 Ga0495626_0119052 3300048091 Bacteria 1137
386 Ga0496101_0007208 3300048904 Bacteria 7198
387 Ga0496101_0163787 3300048904 Bacteria 1707
388 Ga0496101_0248938 3300048904 Bacteria 1384
389 Ga0496102_0151814 3300048905 Bacteria 2177
390 Ga0496103_0038546 3300048906 Bacteria 2933
391 Ga0496104_0021250 3300048907 Bacteria 5956
392 Ga0496105_0013807 3300048908 Bacteria 6415
393 Ga0496107_0004453 3300048910 Bacteria 9497
394 Ga0496107_0071893 3300048910 Bacteria 2514
395 Ga0496107_0355229 3300048910 Bacteria 1090
396 Ga0496109_0239587 3300048912 Bacteria 1707
397 Ga0496109_0252003 3300048912 Bacteria 1663
398 Ga0496110_0156324 3300048913 Bacteria 2066
399 Ga0496111_0045069 3300048914 Bacteria 3172
400 Ga0496112_0000037 3300048915 Bacteria 96876
401 Ga0496112_0071930 3300048915 Bacteria 3418
402 Ga0496112_0269938 3300048915 Bacteria 1650
403 Ga0496115_0027009 3300048918 Bacteria 4487
404 Ga0496115_0033984 3300048918 Bacteria 4029
405 Ga0496115_0045659 3300048918 Bacteria 3498
406 Ga0496121_0000221 3300048924 Bacteria 123829
407 Ga0496121_0071813 3300048924 Bacteria 2782
408 Ga0496125_0008742 3300048928 Bacteria 10537
409 Ga0496126_0045676 3300048929 Bacteria 4023
410 Ga0496126_0080876 3300048929 Bacteria 2874
411 Ga0496126_0203577 3300048929 Bacteria 1670
412 Ga0496126_0285685 3300048929 Bacteria 1365
413 Ga0501033_0033477 3300049570 Bacteria 3857
414 Ga0501034_0027400 3300049571 Bacteria 5795
415 Ga0501034_0212756 3300049571 Bacteria 1888
416 Ga0501047_0020638 3300049581 Bacteria 6326
417 Ga0501035_0009241 3300049822 Bacteria 9166
418 Ga0501035_0112450 3300049822 Bacteria 2386
419 Ga0501044_0071699 3300049823 Bacteria 3522
420 nmdc:mga03n38_14612_c1 3300050490 Bacteria 3014
421 nmdc:mga03n38_19721_c1 3300050490 Bacteria 2683
422 nmdc:mga0yw44_64667_c1 3300050492 Bacteria 2252
423 nmdc:mga06z11_119238_c1 3300050494 Bacteria 1470
424 nmdc:mga06z11_120208_c1 3300050494 Bacteria 1465
425 nmdc:mga05p37_124910_c1 3300050507 Bacteria 3160
426 nmdc:mga05p37_431515_c1 3300050507 Bacteria 1531
427 nmdc:mga08y16_42118_c1 3300050511 Bacteria 4782
428 nmdc:mga08y16_8437_c1 3300050511 Bacteria 10787
429 nmdc:mga0n895_401004_c1 3300050512 Bacteria 1387
430 nmdc:mga0a205_202984_c1 3300050515 Bacteria 1872
431 nmdc:mga0a205_474729_c1 3300050515 Bacteria 1109
432 Ga0495601_0004725 3300053077 Bacteria 7896
433 Ga0495601_0021935 3300053077 Bacteria 3916
434 Ga0495612_0007866 3300053078 Bacteria 4347
435 Ga0495612_0010992 3300053078 Bacteria 3655
436 Ga0495595_0001251 3300053084 Bacteria 9903
437 Ga0495595_0012815 3300053084 Bacteria 3535
438 Ga0495619_0002647 3300053085 Bacteria 11703
439 Ga0495619_0089610 3300053085 Bacteria 2081
440 Ga0500643_007315 3300053087 Bacteria 4480
441 Ga0500566_0000782 3300053094 Bacteria 18024
442 Ga0500566_0026840 3300053094 Bacteria 3371
443 Ga0500640_000202 3300053095 Bacteria 12821
444 Ga0500641_0001698 3300053096 Bacteria 7831
445 Ga0500641_0003859 3300053096 Bacteria 5301
446 Ga0500641_0033792 3300053096 Bacteria 2033
447 Ga0500554_000763 3300053102 Bacteria 6445
448 Ga0500572_000491 3300053111 Bacteria 13611
449 Ga0500572_000589 3300053111 Bacteria 12248
450 Ga0500595_000941 3300053119 Bacteria 16447
451 Ga0500614_000997 3300053123 Bacteria 7029
452 Ga0500559_0000685 3300053136 Bacteria 22515
453 Ga0500603_000410 3300053150 Bacteria 11214
454 Ga0500603_001295 3300053150 Bacteria 5753
455 Ga0500630_004401 3300053159 Bacteria 6860
456 Ga0500638_000054 3300053162 Bacteria 23606
457 Ga0500638_053281 3300053162 Bacteria 1953
458 Ga0500639_000014 3300053163 Bacteria 122926
459 Ga0500637_0000775 3300053178 Bacteria 12832
460 Ga0500637_0004245 3300053178 Bacteria 6767
461 Ga0500637_0040692 3300053178 Bacteria 2626
462 Ga0500596_009667 3300053735 Bacteria 1500
463 Ga0500661_000301 3300055283 Bacteria 8965
464 2513657669 2513237096 Bacteria 8722461
465 2513693313 2513237101 Bacteria 7952346
466 2513862135 2513237137 Bacteria 9558895
467 2513919668 2513237145 Bacteria 8979722
468 2793081978
469 2842338644 2842333319 Bacteria 8899485
470 2874607563 2874604998 Bacteria 7834745
471 2879110956 2879110137 Bacteria 8907982
472 2889037256 2889033259 Bacteria 9099371
473 2922361394 2922361189 Bacteria 7436256
474 8006988831 8006984368 Bacteria 9651211
475 8006998594 8006994254 Bacteria 8309700
476 8056675865 8056673599 Bacteria 7871253
477 8056690395 8056689827 Bacteria 6712655
478 Ga0495665_0104031
479 ARcpr5oldR_c000646
480 ARcpr5yngRDRAFT_c000989
481 ARSoilOldRDRAFT_c000831
482 ARCol0yngRDRAFT_1000995
483 JGI25406J46586_10005087
484 JGI25153J46596_10007272
485 Ga0070676_10021552
486 Ga0070683_100020536
487 Ga0070683_100119120
488 Ga0070683_100171532
489 Ga0070677_10003427
490 Ga0068869_100247496
491 Ga0070666_10090490
492 Ga0070680_100014976
493 Ga0070680_100018264
494 Ga0070682_100080076
495 Ga0070682_100101858
496 Ga0070660_100066012
497 Ga0070660_100076837
498 Ga0070668_100057246
499 Ga0070669_100072499
500 Ga0070675_100139212
501 Ga0070671_100052583
502 Ga0070673_100177124
503 Ga0070667_100084304
504 Ga0070709_10001480
505 Ga0070709_10005323
506 Ga0070709_10013521
507 Ga0070709_10192411
508 Ga0070714_100009188
509 Ga0070714_100035003
510 Ga0070714_100128347
511 Ga0070713_100004561
512 Ga0070713_100155907
513 Ga0070710_10000417
514 Ga0070710_10066726
515 Ga0070711_100001688
516 Ga0070663_100029577
517 Ga0070663_100029957
518 Ga0070663_100135034
519 Ga0070678_100034555
520 Ga0070678_100120524
521 Ga0070678_100278906
522 Ga0070662_100082699
523 Ga0070681_10008226
524 Ga0070698_100105939
525 Ga0070679_100053159
526 Ga0070679_100346331
527 Ga0070684_100007976
528 Ga0070684_100058035
529 Ga0070684_100090240
530 Ga0068853_100055433
531 Ga0068853_100063144
532 Ga0068853_100073343
533 Ga0068853_100117234
534 Ga0068853_100207816
535 Ga0068853_100310544
536 Ga0070672_100058450
537 Ga0070672_100083513
538 Ga0070672_100109511
539 Ga0070686_100257312
540 Ga0070693_100115836
541 Ga0070665_100005813
542 Ga0070665_100055307
543 Ga0070665_100075858
544 Ga0070665_100553578
545 Ga0070704_100278284
546 Ga0068855_100047201
547 Ga0068855_100215943
548 Ga0068857_100107433
549 Ga0068857_100131586
550 Ga0068857_100234325
551 Ga0068854_100140828
552 Ga0068856_100002827
553 Ga0068856_100164803
554 Ga0068864_100020965
555 Ga0068864_100331679
556 Ga0068861_100144956
557 Ga0068851_10022035
558 Ga0068870_10093566
559 Ga0068860_100097680
560 Ga0068862_100152378
561 Ga0068862_100454638
562 Ga0081538_10033029
563 Ga0081538_10067318
564 Ga0081540_1006552
565 Ga0081540_1028197
566 Ga0081539_10000321
567 Ga0081539_10041443
568 Ga0070717_10020188
569 Ga0070717_10055976
570 Ga0075363_100002799
571 Ga0070715_10020200
572 Ga0070716_100003948
573 Ga0070716_100077450
574 Ga0070712_100007788
575 Ga0070712_100008845
576 Ga0075367_10015462
577 Ga0075367_10026542
578 Ga0075367_10145439
579 Ga0075369_10034497
580 Ga0075366_10204077
581 Ga0097621_100157936
582 Ga0097621_100250879
583 Ga0075370_10080360
584 Ga0075430_100257120
585 Ga0075433_10256876
586 Ga0068865_100047092
587 Ga0068865_100081135
588 Ga0075435_100127669
589 Ga0099795_10056282
590 Ga0111539_10031306
591 Ga0105245_10013409
592 Ga0105245_10060778
593 Ga0105245_10139845
594 Ga0105245_10178100
595 Ga0105245_10218397
596 Ga0105247_10016797
597 Ga0105247_10054471
598 Ga0114129_10119512
599 Ga0114129_10377446
600 Ga0105243_10121314
601 Ga0105241_10020147
602 Ga0105241_10046726
603 Ga0105248_10198411
604 Ga0105237_10018863
605 Ga0105237_10303708
606 Ga0105238_10022240
607 Ga0105238_10066730
608 Ga0105238_10080730
609 Ga0105239_10044642
610 Ga0105239_10229978
611 Ga0105246_10055044
612 Ga0157370_10081072
613 Ga0157369_10029246
614 Ga0157369_10045780
615 Ga0157369_10132973
616 Ga0157374_10051630
617 Ga0157378_10092115
618 Ga0163162_10147786
619 Ga0157372_10117661
620 Ga0157372_10282382
621 Ga0157375_10009376
622 Ga0157375_10055784
623 Ga0157375_10063703
624 Ga0157375_10173311
625 Ga0163163_10029708
626 Ga0157379_10024614
627 Ga0157379_10034714
628 Ga0157379_10133438
629 Ga0157379_10136580
630 Ga0157379_10161608
631 Ga0157376_10086773
632 Ga0163161_10133381
633 Ga0213873_10012025
634 Ga0213876_10006775
635 Ga0213876_10066363
636 Ga0213876_10129528
637 Ga0209758_1007858
638 Ga0207656_10012790
639 Ga0207656_10104035
640 Ga0207682_10006173
641 Ga0207682_10016425
642 Ga0207692_10005681
643 Ga0207692_10015533
644 Ga0207710_10009723
645 Ga0207710_10054699
646 Ga0207699_10012265
647 Ga0207699_10034006
648 Ga0207645_10005001
649 Ga0207643_10044119
650 Ga0207654_10060241
651 Ga0207654_10158476
652 Ga0207707_10001008
653 Ga0207707_10005928
654 Ga0207707_10026306
655 Ga0207707_10058231
656 Ga0207671_10137209
657 Ga0207671_10147184
658 Ga0207693_10001458
659 Ga0207693_10006327
660 Ga0207693_10020973
661 Ga0207663_10000176
662 Ga0207663_10016826
663 Ga0207660_10221998
664 Ga0207660_10266449
665 Ga0207657_10022995
666 Ga0207657_10049132
667 Ga0207652_10003168
668 Ga0207652_10054453
669 Ga0207652_10108185
670 Ga0207681_10178329
671 Ga0207694_10136989
672 Ga0207659_10053417
673 Ga0207659_10126596
674 Ga0207700_10005697
675 Ga0207700_10012732
676 Ga0207664_10043553
677 Ga0207664_10083947
678 Ga0207670_10113335
679 Ga0207669_10153782
680 Ga0207704_10165664
681 Ga0207665_10005346
682 Ga0207665_10012835
683 Ga0207691_10006284
684 Ga0207691_10062023
685 Ga0207689_10221582
686 Ga0207661_10010494
687 Ga0207661_10158274
688 Ga0207679_10009946
689 Ga0207667_10138347
690 Ga0207651_10206997
691 Ga0207712_10170173
692 Ga0207658_10074110
693 Ga0207677_10216696
694 Ga0207703_10009809
695 Ga0207639_10023543
696 Ga0207639_10095480
697 Ga0207639_10122208
698 Ga0207678_10088778
699 Ga0207678_10102309
700 Ga0207678_10118306
701 Ga0207708_10033443
702 Ga0207702_10003504
703 Ga0207648_10022633
704 Ga0207648_10060130
705 Ga0207674_10015173
706 Ga0207674_10017324
707 Ga0207674_10025859
708 Ga0207674_10133753
709 Ga0207675_100181607
710 Ga0207683_10000979
711 Ga0207683_10021099
712 Ga0207683_10023560
713 Ga0207683_10059015
714 Ga0207683_10097928
715 Ga0207698_10162577
716 Ga0268266_10000446
717 Ga0268266_10009990
718 Ga0268266_10017902
719 Ga0268266_10018419
720 Ga0307517_10001444
721 Ga0307515_10021507
722 Ga0307513_10206109
723 Ga0307408_100294319
724 Ga0307508_10000184
725 Ga0307508_10007695
726 Ga0265314_10003230
727 Ga0307516_10050012
728 Ga0307410_10116997
729 Ga0307416_100116417
730 Ga0307510_10009874
731 Ga0307510_10025554
732 Ga0373938_0010813
733 Ga0373926_0004071
734 Ga0373949_0004588
735 Ga0373923_0051984
736 Ga0373923_0058485
737 Ga0373936_0010572
738 Ga0373953_0085212
739 Ga0373954_0007500
740 Ga0373954_0128798
741 Ga0373954_0152470
742 Ga0373957_0030503
743 Ga0373943_0051407
744 Ga0373946_0006888
745 Ga0373924_0013710
746 Ga0373924_0134071
747 Ga0373931_0000299
748 Ga0373935_0000660
749 Ga0373935_0010312
750 Ga0373935_0317519
751 Ga0373927_0004283
752 Ga0373927_0094384
753 Ga0373927_0143494
754 Ga0373933_0005476
755 Ga0373933_0085684
756 Ga0373933_0124731
757 Ga0373947_0001631
758 Ga0373937_0035153
759 Ga0373937_0197937
760 Ga0373937_0393690
761 Ga0373925_0001524
762 Ga0395900_0006562
763 Ga0395898_0061121
764 Ga0395901_0057706
765 Ga0436365_0689701
766 Ga0436365_0959977
767 Ga0436361_0300746
768 Ga0436362_0233808
769 Ga0439465_0059468
770 Ga0466959_0004580
771 Ga0495592_0004852
772 Ga0495592_0009493
773 Ga0495592_0055876
774 Ga0495592_0066393
775 Ga0495603_0000155
776 Ga0495603_0009165
777 Ga0495603_0119085
778 Ga0495629_0005389
779 Ga0495638_0104585
780 Ga0495641_0013284
781 Ga0495651_0030285
782 Ga0495651_0031110
783 Ga0495653_0020657
784 Ga0495653_0065522
785 Ga0495580_0006361
786 Ga0495582_0000401
787 Ga0495582_0047839
788 Ga0495639_0000146
789 Ga0495662_0004838
790 Ga0495664_0061559
791 Ga0495664_0073697
792 Ga0495594_0002348
793 Ga0495594_0054690
794 Ga0495583_0065217
795 Ga0495606_0005824
796 Ga0495608_0061655
797 Ga0495618_0001029
798 Ga0495620_0026520
799 Ga0495628_0069263
800 Ga0495628_0090592
801 Ga0495630_0004000
802 Ga0495630_0104855
803 Ga0495631_0022372
804 Ga0495644_0018812
805 Ga0495652_0145987
806 Ga0495665_0001951
807 Ga0495640_0006675
808 Ga0495640_0104863
809 Ga0495586_0161875
810 Ga0495587_0008972
811 Ga0495598_0003891
812 Ga0495645_0006201
813 Ga0495645_0007652
814 Ga0495645_0040971
815 Ga0495645_0056729
816 Ga0495667_0011204
817 Ga0495667_0026069
818 Ga0495667_0126564
819 Ga0495667_0192855
820 Ga0495634_0003138
821 Ga0495635_0000823
822 Ga0495635_0007234
823 Ga0495659_0010172
824 Ga0495659_0097516
825 Ga0495661_0065750
826 Ga0495588_0038738
827 Ga0495657_0045623
828 Ga0495599_0009170
829 Ga0495646_0001170
830 Ga0495647_0000494
831 Ga0495658_0002856
832 Ga0495658_0152277
833 Ga0495669_0012465
834 Ga0495669_0022817
835 Ga0495613_0012542
836 Ga0495613_0251813
837 Ga0495624_0004679
838 Ga0495624_0143110
839 Ga0495671_0101892
840 Ga0495671_0120016
841 Ga0495581_0000865
842 Ga0495581_0020871
843 Ga0495604_0066263
844 Ga0495604_0084938
845 Ga0495636_0029368
846 Ga0495674_0027198
847 Ga0495674_0037730
848 Ga0495674_0048300
849 Ga0495674_0424023
850 Ga0495676_0032170
851 Ga0495680_0015741
852 Ga0495680_0088729
853 Ga0495675_0006644
854 Ga0495675_0036677
855 Ga0495675_0166460
856 Ga0495684_0156441
857 Ga0495684_0187509
858 Ga0495593_0002852
859 Ga0495602_0003336
860 Ga0495602_0050346
861 Ga0495614_0015990
862 Ga0495626_0119052
863 Ga0496101_0007208
864 Ga0496101_0163787
865 Ga0496101_0248938
866 Ga0496102_0151814
867 Ga0496103_0038546
868 Ga0496104_0021250
869 Ga0496105_0013807
870 Ga0496107_0004453
871 Ga0496107_0071893
872 Ga0496107_0355229
873 Ga0496109_0239587
874 Ga0496109_0252003
875 Ga0496110_0156324
876 Ga0496111_0045069
877 Ga0496112_0000037
878 Ga0496112_0071930
879 Ga0496112_0269938
880 Ga0496115_0027009
881 Ga0496115_0033984
882 Ga0496115_0045659
883 Ga0496121_0000221
884 Ga0496121_0071813
885 Ga0496125_0008742
886 Ga0496126_0045676
887 Ga0496126_0080876
888 Ga0496126_0203577
889 Ga0496126_0285685
890 Ga0501033_0033477
891 Ga0501034_0027400
892 Ga0501034_0212756
893 Ga0501047_0020638
894 Ga0501035_0009241
895 Ga0501035_0112450
896 Ga0501044_0071699
897 nmdc:mga03n38_14612_c1
898 nmdc:mga03n38_19721_c1
899 nmdc:mga0yw44_64667_c1
900 nmdc:mga06z11_119238_c1
901 nmdc:mga06z11_120208_c1
902 nmdc:mga05p37_124910_c1
903 nmdc:mga05p37_431515_c1
904 nmdc:mga08y16_42118_c1
905 nmdc:mga08y16_8437_c1
906 nmdc:mga0n895_401004_c1
907 nmdc:mga0a205_202984_c1
908 nmdc:mga0a205_474729_c1
909 Ga0495601_0004725
910 Ga0495601_0021935
911 Ga0495612_0007866
912 Ga0495612_0010992
913 Ga0495595_0001251
914 Ga0495595_0012815
915 Ga0495619_0002647
916 Ga0495619_0089610
917 Ga0500643_007315
918 Ga0500566_0000782
919 Ga0500566_0026840
920 Ga0500640_000202
921 Ga0500641_0001698
922 Ga0500641_0003859
923 Ga0500641_0033792
924 Ga0500554_000763
925 Ga0500572_000491
926 Ga0500572_000589
927 Ga0500595_000941
928 Ga0500614_000997
929 Ga0500559_0000685
930 Ga0500603_000410
931 Ga0500603_001295
932 Ga0500630_004401
933 Ga0500638_000054
934 Ga0500638_053281
935 Ga0500639_000014
936 Ga0500637_0000775
937 Ga0500637_0004245
938 Ga0500637_0040692
939 Ga0500596_009667
940 Ga0500661_000301
941 2513657669
942 2513693313
943 2513862135
944 2513919668
945 2793081978
946 2842338644
947 2874607563
948 2879110956
949 2889037256
950 2922361394
951 8006988831
952 8006998594
953 8056675865
954 8056690395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

97

358

0.68

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

99

368

0.48

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vat-assembly4.cif.gz_F crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a 0.8611 28 346
2vat-assembly5.cif.gz_L crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a 0.8607 28 346
2vat-assembly1.cif.gz_A crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a 0.8567 28 346
2vat-assembly2.cif.gz_B crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a 0.8542 28 346
2vav-assembly6.cif.gz_C crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak) 0.8531 28 346
ID Description Score Start End Superfamily
2vaxI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8501 28 346 3.40.50.1820
5efzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8329 28 347 3.40.50.1820
5w8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8265 28 346 3.40.50.1820
af_Q2G2T4_1_322_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8182 28 351 3.40.50.1820
af_Q10341_88_496_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8163 44 332 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W8SM79-F1-model_v4 Homoserine O-acetyltransferase (EC 2.3.1.31) 0.978 22 352 GO:0004414
GO:0009086
GO:0009092
AF-A0A643F8Z6-F1-model_v4 Alpha/beta fold hydrolase 0.9695 23 349 GO:0004414
GO:0009086
GO:0009092
GO:0016787
AF-X1WS60-F1-model_v4 deleted 0.969 119 350
AF-A0A7W8SM79-F1-model_v4 Homoserine O-acetyltransferase (EC 2.3.1.31) 0.9664 22 352 GO:0004414
GO:0009086
GO:0009092
AF-A0A836ZKJ9-F1-model_v4 deleted 0.9658 17 350

Map