F451702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 477 | 254 | 466 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10422384|Ga0157372_104223842 |
| Length | 271 |
| Sequence | MKQIHAVHPEDFKKYDTATIRERFLLNDLFEKDKINFVYTHYDRMIAGGAMPTNRSLELPDFSILRADYFLERREMGIINVGGSGDEKFNLSKLDCLYIGKGSQKINFSSSDINQPAVFYILSAPAHTKYPTRLLQKKDAESTVLGALETSNQRTIYRYIHKNGIQSCQLVMGLTLLEKGSVWNTIPAHTHDRRMEVYFYFDVPENQIVFHYMGQQEETRHIVMKNYQAVASPPWSIHAGSATSNYGFIWGMAGENLEYSDMDVIQLNDLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 3 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 4 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 5 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 6 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 7 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 8 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 9 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 10 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 11 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 12 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 168 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 169 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 179 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 180 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 181 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 182 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 183 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 184 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 185 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 186 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 187 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 188 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 216 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 217 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 237 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 246 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 247 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 248 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 250 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 251 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 252 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 253 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 254 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 0 |
| Isolates | 2.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.56 |
| Nodule | 0.21 |
| Rhizoplane | 0.63 |
| Rhizosphere | 89.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1017597 | 3300001904 | Bacteria | 1133 |
| 2 | JGI24739J22299_10013373 | 3300001989 | Bacteria | 2997 |
| 3 | JGI24737J22298_10005749 | 3300001990 | Bacteria | 4269 |
| 4 | JGI24735J21928_10000013 | 3300002067 | Bacteria | 208663 |
| 5 | rootH1_10001050 | 3300003316 | Bacteria | 47333 |
| 6 | rootL2_10032000 | 3300003322 | Bacteria | 5067 |
| 7 | rootL2_10146929 | 3300003322 | Bacteria | 2945 |
| 8 | rootH1_10024035 | 3300003316 | Bacteria | 8072 |
| 9 | rootH1_10024035 | 3300003323 | Bacteria | 75545 |
| 10 | rootH1_10197073 | 3300003323 | Bacteria | 2545 |
| 11 | JGI25160J50197_1000376 | 3300003354 | Bacteria | 29172 |
| 12 | Ga0065714_10069557 | 3300005288 | Bacteria | 4163 |
| 13 | Ga0065704_10164208 | 3300005289 | Bacteria | 1301 |
| 14 | Ga0070658_10058950 | 3300005327 | Bacteria | 3126 |
| 15 | Ga0070658_10089536 | 3300005327 | Bacteria | 2534 |
| 16 | Ga0070658_10237411 | 3300005327 | Bacteria | 1545 |
| 17 | Ga0070683_100034695 | 3300005329 | Bacteria | 4610 |
| 18 | Ga0070690_100260562 | 3300005330 | Bacteria | 1230 |
| 19 | Ga0070670_100032693 | 3300005331 | Bacteria | 4481 |
| 20 | Ga0070670_100275341 | 3300005331 | Bacteria | 1469 |
| 21 | Ga0068869_100007354 | 3300005334 | Bacteria | 7029 |
| 22 | Ga0068869_100094402 | 3300005334 | Unclassified | 2255 |
| 23 | Ga0068869_100272450 | 3300005334 | Bacteria | 1358 |
| 24 | Ga0070666_10000042 | 3300005335 | Bacteria | 112296 |
| 25 | Ga0070680_100000878 | 3300005336 | Bacteria | 21341 |
| 26 | Ga0070680_100027359 | 3300005336 | Bacteria | 4566 |
| 27 | Ga0070682_100001122 | 3300005337 | Bacteria | 15300 |
| 28 | Ga0068868_100004734 | 3300005338 | Bacteria | 9556 |
| 29 | Ga0068868_100271537 | 3300005338 | Bacteria | 1433 |
| 30 | Ga0070660_100079286 | 3300005339 | Bacteria | 2576 |
| 31 | Ga0070660_100168873 | 3300005339 | Bacteria | 1766 |
| 32 | Ga0070691_10055513 | 3300005341 | Bacteria | 1897 |
| 33 | Ga0070661_100028849 | 3300005344 | Bacteria | 4004 |
| 34 | Ga0070692_10119637 | 3300005345 | Unclassified | 1467 |
| 35 | Ga0070669_100378366 | 3300005353 | Bacteria | 1154 |
| 36 | Ga0070675_100029413 | 3300005354 | Bacteria | 4431 |
| 37 | Ga0070675_100154983 | 3300005354 | Bacteria | 1966 |
| 38 | Ga0070671_100073637 | 3300005355 | Bacteria | 2853 |
| 39 | Ga0070671_100236140 | 3300005355 | Bacteria | 1552 |
| 40 | Ga0070671_100290019 | 3300005355 | Bacteria | 1392 |
| 41 | Ga0070688_100160740 | 3300005365 | Bacteria | 1543 |
| 42 | Ga0070659_100023248 | 3300005366 | Bacteria | 4741 |
| 43 | Ga0070667_100044613 | 3300005367 | Bacteria | 3724 |
| 44 | Ga0070667_100087465 | 3300005367 | Bacteria | 2675 |
| 45 | Ga0070667_100729402 | 3300005367 | Bacteria | 918 |
| 46 | Ga0070700_100212342 | 3300005441 | Bacteria | 1366 |
| 47 | Ga0070663_100066019 | 3300005455 | Bacteria | 2621 |
| 48 | Ga0070678_100364358 | 3300005456 | Bacteria | 1246 |
| 49 | Ga0070681_10107427 | 3300005458 | Bacteria | 2731 |
| 50 | Ga0068867_100371125 | 3300005459 | Bacteria | 1199 |
| 51 | Ga0070679_100003316 | 3300005530 | Bacteria | 14753 |
| 52 | Ga0070684_100384859 | 3300005535 | Unclassified | 1292 |
| 53 | Ga0068853_100017299 | 3300005539 | Bacteria | 5952 |
| 54 | Ga0070686_100350105 | 3300005544 | Bacteria | 1110 |
| 55 | Ga0070693_100000650 | 3300005547 | Bacteria | 15328 |
| 56 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 57 | Ga0068855_100005029 | 3300005563 | Bacteria | 16134 |
| 58 | Ga0068855_100021745 | 3300005563 | Bacteria | 7693 |
| 59 | Ga0068855_100022488 | 3300005563 | Bacteria | 7555 |
| 60 | Ga0068855_100268785 | 3300005563 | Bacteria | 1896 |
| 61 | Ga0070664_100020776 | 3300005564 | Bacteria | 5409 |
| 62 | Ga0070664_100459822 | 3300005564 | Bacteria | 1169 |
| 63 | Ga0068857_100001316 | 3300005577 | Bacteria | 19543 |
| 64 | Ga0068857_100430408 | 3300005577 | Bacteria | 1231 |
| 65 | Ga0068854_100228082 | 3300005578 | Bacteria | 1477 |
| 66 | Ga0068856_100050360 | 3300005614 | Bacteria | 4106 |
| 67 | Ga0068856_100070615 | 3300005614 | Bacteria | 3455 |
| 68 | Ga0068856_100097121 | 3300005614 | Bacteria | 2935 |
| 69 | Ga0068856_100115232 | 3300005614 | Bacteria | 2687 |
| 70 | Ga0068852_100000811 | 3300005616 | Bacteria | 20584 |
| 71 | Ga0068852_100001166 | 3300005616 | Bacteria | 17391 |
| 72 | Ga0068852_100009916 | 3300005616 | Bacteria | 7093 |
| 73 | Ga0068852_100089660 | 3300005616 | Bacteria | 2749 |
| 74 | Ga0068852_100568653 | 3300005616 | Bacteria | 1135 |
| 75 | Ga0068852_100637843 | 3300005616 | Bacteria | 1072 |
| 76 | Ga0068852_100670681 | 3300005616 | Bacteria | 1045 |
| 77 | Ga0068859_100013654 | 3300005617 | Bacteria | 8143 |
| 78 | Ga0068859_100067304 | 3300005617 | Bacteria | 3616 |
| 79 | Ga0068859_100178142 | 3300005617 | Bacteria | 2208 |
| 80 | Ga0068864_100009257 | 3300005618 | Bacteria | 8121 |
| 81 | Ga0068864_100071098 | 3300005618 | Bacteria | 3029 |
| 82 | Ga0068864_100207334 | 3300005618 | Bacteria | 1803 |
| 83 | Ga0068864_100477920 | 3300005618 | Unclassified | 1196 |
| 84 | Ga0068851_10012661 | 3300005834 | Bacteria | 3982 |
| 85 | Ga0068851_10081459 | 3300005834 | Bacteria | 1691 |
| 86 | Ga0068863_100005978 | 3300005841 | Bacteria | 11939 |
| 87 | Ga0068863_100052271 | 3300005841 | Bacteria | 3872 |
| 88 | Ga0068858_100046101 | 3300005842 | Bacteria | 4041 |
| 89 | Ga0068860_100000005 | 3300005843 | Bacteria | 472349 |
| 90 | Ga0068860_100002561 | 3300005843 | Bacteria | 19014 |
| 91 | Ga0068860_100003920 | 3300005843 | Bacteria | 15287 |
| 92 | Ga0068860_100027888 | 3300005843 | Bacteria | 5438 |
| 93 | Ga0068860_100112440 | 3300005843 | Bacteria | 2604 |
| 94 | Ga0068860_100451802 | 3300005843 | Unclassified | 1278 |
| 95 | Ga0070716_100084569 | 3300006173 | Bacteria | 1903 |
| 96 | Ga0075366_10008789 | 3300006195 | Bacteria | 5625 |
| 97 | Ga0075366_10181895 | 3300006195 | Bacteria | 1277 |
| 98 | Ga0097621_100002185 | 3300006237 | Bacteria | 13386 |
| 99 | Ga0068871_100019766 | 3300006358 | Bacteria | 5146 |
| 100 | Ga0075428_100080181 | 3300006844 | Bacteria | 3562 |
| 101 | Ga0075430_100007454 | 3300006846 | Bacteria | 9235 |
| 102 | Ga0075431_100055364 | 3300006847 | Bacteria | 4091 |
| 103 | Ga0075429_100086160 | 3300006880 | Bacteria | 2738 |
| 104 | Ga0097620_100013654 | 3300006931 | Bacteria | 8143 |
| 105 | Ga0097620_100039542 | 3300006931 | Bacteria | 4732 |
| 106 | Ga0097620_100067307 | 3300006931 | Bacteria | 3616 |
| 107 | Ga0097620_100178146 | 3300006931 | Bacteria | 2208 |
| 108 | Ga0105240_10001981 | 3300009093 | Bacteria | 33825 |
| 109 | Ga0105240_10002364 | 3300009093 | Bacteria | 30415 |
| 110 | Ga0105240_10008491 | 3300009093 | Bacteria | 14689 |
| 111 | Ga0105240_10083819 | 3300009093 | Bacteria | 3910 |
| 112 | Ga0105240_10186537 | 3300009093 | Bacteria | 2442 |
| 113 | Ga0105240_10212651 | 3300009093 | Bacteria | 2258 |
| 114 | Ga0105247_10022031 | 3300009101 | Bacteria | 3835 |
| 115 | Ga0114129_10067557 | 3300009147 | Bacteria | 4985 |
| 116 | Ga0105243_10105721 | 3300009148 | Bacteria | 2345 |
| 117 | Ga0105241_10006161 | 3300009174 | Bacteria | 8845 |
| 118 | Ga0105241_10009180 | 3300009174 | Bacteria | 7279 |
| 119 | Ga0105241_10122505 | 3300009174 | Bacteria | 2096 |
| 120 | Ga0105237_10002312 | 3300009545 | Bacteria | 23678 |
| 121 | Ga0105237_10006705 | 3300009545 | Bacteria | 12727 |
| 122 | Ga0105237_10011376 | 3300009545 | Bacteria | 9413 |
| 123 | Ga0105237_10021911 | 3300009545 | Bacteria | 6562 |
| 124 | Ga0105237_10103921 | 3300009545 | Bacteria | 2833 |
| 125 | Ga0105237_10191041 | 3300009545 | Bacteria | 2048 |
| 126 | Ga0105237_10387381 | 3300009545 | Bacteria | 1403 |
| 127 | Ga0105237_10772888 | 3300009545 | Bacteria | 967 |
| 128 | Ga0105249_10600628 | 3300009553 | Bacteria | 1155 |
| 129 | Ga0105249_10850480 | 3300009553 | Unclassified | 978 |
| 130 | Ga0105239_10006736 | 3300010375 | Bacteria | 13273 |
| 131 | Ga0105239_10031088 | 3300010375 | Bacteria | 5874 |
| 132 | Ga0105239_10243849 | 3300010375 | Bacteria | 2017 |
| 133 | Ga0105239_10410474 | 3300010375 | Bacteria | 1533 |
| 134 | Ga0105246_10062235 | 3300011119 | Bacteria | 2599 |
| 135 | Ga0157373_10006957 | 3300013100 | Bacteria | 8423 |
| 136 | Ga0157373_10137943 | 3300013100 | Bacteria | 1715 |
| 137 | Ga0157371_10000242 | 3300013102 | Bacteria | 78183 |
| 138 | Ga0157371_10007760 | 3300013102 | Bacteria | 8628 |
| 139 | Ga0157371_10008547 | 3300013102 | Bacteria | 8147 |
| 140 | Ga0157371_10033320 | 3300013102 | Bacteria | 3702 |
| 141 | Ga0157371_10114507 | 3300013102 | Bacteria | 1915 |
| 142 | Ga0157370_10007415 | 3300013104 | Bacteria | 11943 |
| 143 | Ga0157370_10014024 | 3300013104 | Bacteria | 8228 |
| 144 | Ga0157370_10062438 | 3300013104 | Bacteria | 3533 |
| 145 | Ga0157370_10074087 | 3300013104 | Bacteria | 3212 |
| 146 | Ga0157370_10156011 | 3300013104 | Bacteria | 2124 |
| 147 | Ga0157369_10012301 | 3300013105 | Bacteria | 9720 |
| 148 | Ga0157369_10036173 | 3300013105 | Bacteria | 5411 |
| 149 | Ga0157369_10139752 | 3300013105 | Bacteria | 2563 |
| 150 | Ga0157369_10224911 | 3300013105 | Bacteria | 1963 |
| 151 | Ga0157369_10283965 | 3300013105 | Unclassified | 1724 |
| 152 | Ga0157369_10556784 | 3300013105 | Bacteria | 1185 |
| 153 | Ga0157374_10182361 | 3300013296 | Bacteria | 2051 |
| 154 | Ga0157374_10300760 | 3300013296 | Bacteria | 1587 |
| 155 | Ga0157378_10004167 | 3300013297 | Bacteria | 12765 |
| 156 | Ga0157378_10044235 | 3300013297 | Bacteria | 3954 |
| 157 | Ga0157378_10045074 | 3300013297 | Bacteria | 3918 |
| 158 | Ga0157378_10072153 | 3300013297 | Bacteria | 3102 |
| 159 | Ga0157378_10279820 | 3300013297 | Bacteria | 1608 |
| 160 | Ga0157378_10436987 | 3300013297 | Bacteria | 1296 |
| 161 | Ga0163162_10005547 | 3300013306 | Bacteria | 12200 |
| 162 | Ga0163162_10031627 | 3300013306 | Bacteria | 5250 |
| 163 | Ga0163162_10046772 | 3300013306 | Bacteria | 4338 |
| 164 | Ga0163162_10229752 | 3300013306 | Bacteria | 1985 |
| 165 | Ga0157372_10000052 | 3300013307 | Bacteria | 135497 |
| 166 | Ga0157372_10000115 | 3300013307 | Bacteria | 84815 |
| 167 | Ga0157372_10008424 | 3300013307 | Bacteria | 10946 |
| 168 | Ga0157372_10011878 | 3300013307 | Bacteria | 9279 |
| 169 | Ga0157372_10028489 | 3300013307 | Bacteria | 6095 |
| 170 | Ga0157372_10045882 | 3300013307 | Bacteria | 4849 |
| 171 | Ga0157372_10074816 | 3300013307 | Bacteria | 3820 |
| 172 | Ga0157372_10081022 | 3300013307 | Bacteria | 3674 |
| 173 | Ga0157372_10109475 | 3300013307 | Bacteria | 3164 |
| 174 | Ga0157372_10115082 | 3300013307 | Bacteria | 3083 |
| 175 | Ga0157372_10155631 | 3300013307 | Bacteria | 2640 |
| 176 | Ga0157372_10422384 | 3300013307 | Bacteria | 1554 |
| 177 | Ga0157372_10494999 | 3300013307 | Bacteria | 1425 |
| 178 | Ga0157372_10581076 | 3300013307 | Bacteria | 1306 |
| 179 | Ga0157372_10709006 | 3300013307 | Bacteria | 1171 |
| 180 | Ga0157375_10192383 | 3300013308 | Bacteria | 2195 |
| 181 | Ga0163163_10340249 | 3300014325 | Bacteria | 1555 |
| 182 | Ga0163163_10394846 | 3300014325 | Bacteria | 1441 |
| 183 | Ga0157380_10809862 | 3300014326 | Bacteria | 954 |
| 184 | Ga0157379_10295979 | 3300014968 | Bacteria | 1474 |
| 185 | Ga0157379_10475910 | 3300014968 | Unclassified | 1155 |
| 186 | Ga0157376_10002899 | 3300014969 | Bacteria | 11760 |
| 187 | Ga0182006_1000876 | 3300015261 | Bacteria | 20226 |
| 188 | Ga0163161_10000905 | 3300017792 | Bacteria | 22916 |
| 189 | Ga0213872_10011465 | 3300021361 | Bacteria | 4191 |
| 190 | Ga0213876_10005187 | 3300021384 | Bacteria | 7187 |
| 191 | Ga0209026_1000862 | 3300025250 | Bacteria | 15839 |
| 192 | Ga0209233_1004147 | 3300025261 | Bacteria | 4986 |
| 193 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 194 | Ga0207697_10161336 | 3300025315 | Bacteria | 978 |
| 195 | Ga0207656_10056065 | 3300025321 | Bacteria | 1717 |
| 196 | Ga0207682_10117240 | 3300025893 | Bacteria | 1178 |
| 197 | Ga0207710_10008199 | 3300025900 | Bacteria | 4410 |
| 198 | Ga0207680_10000228 | 3300025903 | Bacteria | 27141 |
| 199 | Ga0207647_10000480 | 3300025904 | Bacteria | 32267 |
| 200 | Ga0207647_10007430 | 3300025904 | Bacteria | 7917 |
| 201 | Ga0207647_10122070 | 3300025904 | Bacteria | 1536 |
| 202 | Ga0207645_10022378 | 3300025907 | Bacteria | 4113 |
| 203 | Ga0207645_10195536 | 3300025907 | Bacteria | 1329 |
| 204 | Ga0207643_10134355 | 3300025908 | Bacteria | 1474 |
| 205 | Ga0207705_10000015 | 3300025909 | Bacteria | 382901 |
| 206 | Ga0207705_10004284 | 3300025909 | Bacteria | 10799 |
| 207 | Ga0207654_10004675 | 3300025911 | Bacteria | 6924 |
| 208 | Ga0207654_10017743 | 3300025911 | Bacteria | 3726 |
| 209 | Ga0207654_10304322 | 3300025911 | Bacteria | 1085 |
| 210 | Ga0207707_10000722 | 3300025912 | Bacteria | 32676 |
| 211 | Ga0207707_10012266 | 3300025912 | Bacteria | 7450 |
| 212 | Ga0207707_10087874 | 3300025912 | Bacteria | 2715 |
| 213 | Ga0207695_10002702 | 3300025913 | Bacteria | 25862 |
| 214 | Ga0207695_10023732 | 3300025913 | Bacteria | 6921 |
| 215 | Ga0207695_10101098 | 3300025913 | Bacteria | 2878 |
| 216 | Ga0207695_10186053 | 3300025913 | Bacteria | 1996 |
| 217 | Ga0207671_10001247 | 3300025914 | Bacteria | 29996 |
| 218 | Ga0207671_10001635 | 3300025914 | Bacteria | 25501 |
| 219 | Ga0207671_10004787 | 3300025914 | Bacteria | 12757 |
| 220 | Ga0207671_10006785 | 3300025914 | Bacteria | 10117 |
| 221 | Ga0207671_10065245 | 3300025914 | Bacteria | 2707 |
| 222 | Ga0207660_10004797 | 3300025917 | Bacteria | 8795 |
| 223 | Ga0207660_10019465 | 3300025917 | Bacteria | 4538 |
| 224 | Ga0207662_10135392 | 3300025918 | Bacteria | 1557 |
| 225 | Ga0207657_10198998 | 3300025919 | Bacteria | 1613 |
| 226 | Ga0207657_10210605 | 3300025919 | Bacteria | 1560 |
| 227 | Ga0207657_10280592 | 3300025919 | Bacteria | 1323 |
| 228 | Ga0207657_10371862 | 3300025919 | Bacteria | 1126 |
| 229 | Ga0207652_10001022 | 3300025921 | Bacteria | 25679 |
| 230 | Ga0207652_10006617 | 3300025921 | Bacteria | 9340 |
| 231 | Ga0207694_10050498 | 3300025924 | Bacteria | 3221 |
| 232 | Ga0207650_10110269 | 3300025925 | Unclassified | 2129 |
| 233 | Ga0207650_10157283 | 3300025925 | Bacteria | 1798 |
| 234 | Ga0207650_10266897 | 3300025925 | Bacteria | 1390 |
| 235 | Ga0207644_10087314 | 3300025931 | Bacteria | 2318 |
| 236 | Ga0207644_10217730 | 3300025931 | Bacteria | 1512 |
| 237 | Ga0207690_10008826 | 3300025932 | Bacteria | 5981 |
| 238 | Ga0207690_10030335 | 3300025932 | Bacteria | 3448 |
| 239 | Ga0207709_10141262 | 3300025935 | Unclassified | 1655 |
| 240 | Ga0207670_10340712 | 3300025936 | Bacteria | 1185 |
| 241 | Ga0207669_10003972 | 3300025937 | Bacteria | 6459 |
| 242 | Ga0207691_10021466 | 3300025940 | Bacteria | 6096 |
| 243 | Ga0207691_10037667 | 3300025940 | Bacteria | 4477 |
| 244 | Ga0207691_10160726 | 3300025940 | Bacteria | 1971 |
| 245 | Ga0207691_10221128 | 3300025940 | Bacteria | 1642 |
| 246 | Ga0207711_10000028 | 3300025941 | Bacteria | 214107 |
| 247 | Ga0207689_10009695 | 3300025942 | Bacteria | 8295 |
| 248 | Ga0207689_10078572 | 3300025942 | Bacteria | 2712 |
| 249 | Ga0207661_10156025 | 3300025944 | Bacteria | 1977 |
| 250 | Ga0207661_10220451 | 3300025944 | Bacteria | 1676 |
| 251 | Ga0207679_10021840 | 3300025945 | Bacteria | 4347 |
| 252 | Ga0207679_10121644 | 3300025945 | Bacteria | 2079 |
| 253 | Ga0207679_10162180 | 3300025945 | Bacteria | 1831 |
| 254 | Ga0207679_10373854 | 3300025945 | Bacteria | 1248 |
| 255 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 256 | Ga0207667_10001800 | 3300025949 | Bacteria | 27004 |
| 257 | Ga0207667_10002024 | 3300025949 | Bacteria | 25418 |
| 258 | Ga0207667_10011416 | 3300025949 | Bacteria | 10326 |
| 259 | Ga0207667_10040996 | 3300025949 | Bacteria | 4927 |
| 260 | Ga0207667_10160636 | 3300025949 | Bacteria | 2311 |
| 261 | Ga0207651_10324120 | 3300025960 | Bacteria | 1289 |
| 262 | Ga0207712_10009009 | 3300025961 | Bacteria | 6313 |
| 263 | Ga0207712_10016687 | 3300025961 | Bacteria | 4759 |
| 264 | Ga0207640_10084794 | 3300025981 | Bacteria | 2176 |
| 265 | Ga0207640_10317146 | 3300025981 | Bacteria | 1239 |
| 266 | Ga0207658_10064798 | 3300025986 | Unclassified | 2742 |
| 267 | Ga0207658_10102615 | 3300025986 | Bacteria | 2244 |
| 268 | Ga0207677_10494537 | 3300026023 | Bacteria | 1056 |
| 269 | Ga0207703_10004767 | 3300026035 | Bacteria | 11059 |
| 270 | Ga0207639_10029149 | 3300026041 | Bacteria | 4038 |
| 271 | Ga0207639_10032202 | 3300026041 | Bacteria | 3858 |
| 272 | Ga0207639_10464122 | 3300026041 | Bacteria | 1152 |
| 273 | Ga0207678_10029748 | 3300026067 | Bacteria | 4769 |
| 274 | Ga0207678_10341038 | 3300026067 | Bacteria | 1291 |
| 275 | Ga0207708_10311876 | 3300026075 | Bacteria | 1282 |
| 276 | Ga0207702_10058064 | 3300026078 | Bacteria | 3292 |
| 277 | Ga0207702_10075338 | 3300026078 | Bacteria | 2915 |
| 278 | Ga0207702_10356659 | 3300026078 | Bacteria | 1401 |
| 279 | Ga0207641_10000158 | 3300026088 | Bacteria | 96378 |
| 280 | Ga0207641_10006686 | 3300026088 | Bacteria | 9667 |
| 281 | Ga0207641_10336642 | 3300026088 | Bacteria | 1435 |
| 282 | Ga0207648_10001073 | 3300026089 | Bacteria | 30612 |
| 283 | Ga0207676_10004127 | 3300026095 | Bacteria | 10254 |
| 284 | Ga0207676_10054313 | 3300026095 | Bacteria | 3139 |
| 285 | Ga0207676_10150795 | 3300026095 | Bacteria | 2002 |
| 286 | Ga0207676_10207452 | 3300026095 | Unclassified | 1736 |
| 287 | Ga0207674_10070485 | 3300026116 | Bacteria | 3515 |
| 288 | Ga0207674_10162918 | 3300026116 | Bacteria | 2184 |
| 289 | Ga0207675_100054038 | 3300026118 | Bacteria | 3747 |
| 290 | Ga0207683_10042793 | 3300026121 | Bacteria | 3956 |
| 291 | Ga0207698_10001170 | 3300026142 | Bacteria | 15290 |
| 292 | Ga0207698_10001210 | 3300026142 | Bacteria | 15065 |
| 293 | Ga0207698_10008221 | 3300026142 | Bacteria | 6582 |
| 294 | Ga0207698_10049231 | 3300026142 | Bacteria | 3206 |
| 295 | Ga0207698_10056355 | 3300026142 | Bacteria | 3034 |
| 296 | Ga0207698_10166184 | 3300026142 | Bacteria | 1937 |
| 297 | Ga0207698_10369743 | 3300026142 | Bacteria | 1360 |
| 298 | Ga0207698_10805741 | 3300026142 | Bacteria | 942 |
| 299 | Ga0209281_1008337 | 3300027111 | Bacteria | 2524 |
| 300 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 301 | Ga0268265_10819947 | 3300028380 | Unclassified | 908 |
| 302 | Ga0268264_10000012 | 3300028381 | Bacteria | 521740 |
| 303 | Ga0268264_10005689 | 3300028381 | Bacteria | 10570 |
| 304 | Ga0268264_10009194 | 3300028381 | Bacteria | 8187 |
| 305 | Ga0268264_10031602 | 3300028381 | Bacteria | 4340 |
| 306 | Ga0268264_10136542 | 3300028381 | Bacteria | 2181 |
| 307 | Ga0307515_10000859 | 3300028794 | Bacteria | 69963 |
| 308 | Ga0307515_10001136 | 3300028794 | Bacteria | 61007 |
| 309 | Ga0265338_10029068 | 3300028800 | Bacteria | 5493 |
| 310 | Ga0307511_10000850 | 3300030521 | Bacteria | 32503 |
| 311 | Ga0265327_10000488 | 3300031251 | Bacteria | 69809 |
| 312 | Ga0265327_10016774 | 3300031251 | Bacteria | 4629 |
| 313 | Ga0265327_10169658 | 3300031251 | Bacteria | 1003 |
| 314 | Ga0307513_10248806 | 3300031456 | Unclassified | 1576 |
| 315 | Ga0307509_10037320 | 3300031507 | Bacteria | 5313 |
| 316 | Ga0307408_100001972 | 3300031548 | Bacteria | 14821 |
| 317 | Ga0307508_10001227 | 3300031616 | Bacteria | 29288 |
| 318 | Ga0307412_10088207 | 3300031911 | Bacteria | 2163 |
| 319 | Ga0307409_100120140 | 3300031995 | Bacteria | 2224 |
| 320 | Ga0307416_100178995 | 3300032002 | Bacteria | 1985 |
| 321 | Ga0307414_10158090 | 3300032004 | Bacteria | 1797 |
| 322 | Ga0307415_100041291 | 3300032126 | Bacteria | 3062 |
| 323 | Ga0316585_10028486 | 3300032137 | Bacteria | 1747 |
| 324 | Ga0316580_10009432 | 3300032139 | Bacteria | 2934 |
| 325 | Ga0307507_10020463 | 3300033179 | Bacteria | 7406 |
| 326 | Ga0307510_10007660 | 3300033180 | Bacteria | 12874 |
| 327 | Ga0373935_0136215 | 3300035692 | Bacteria | 1654 |
| 328 | Ga0395899_0033581 | 3300037312 | Bacteria | 3852 |
| 329 | Ga0395899_0093740 | 3300037312 | Bacteria | 2173 |
| 330 | Ga0395899_0171142 | 3300037312 | Bacteria | 1529 |
| 331 | Ga0395899_0265766 | 3300037312 | Bacteria | 1172 |
| 332 | Ga0395900_0029481 | 3300037418 | Bacteria | 5628 |
| 333 | Ga0395900_0077503 | 3300037418 | Bacteria | 3414 |
| 334 | Ga0395900_0113365 | 3300037418 | Bacteria | 2783 |
| 335 | Ga0395900_0275726 | 3300037418 | Bacteria | 1675 |
| 336 | Ga0395900_0350884 | 3300037418 | Unclassified | 1449 |
| 337 | Ga0395900_0400524 | 3300037418 | Bacteria | 1337 |
| 338 | Ga0395898_0010470 | 3300037466 | Bacteria | 9694 |
| 339 | Ga0395898_0068906 | 3300037466 | Bacteria | 3423 |
| 340 | Ga0395898_0122628 | 3300037466 | Unclassified | 2490 |
| 341 | Ga0395898_0154876 | 3300037466 | Bacteria | 2192 |
| 342 | Ga0395905_0044479 | 3300037471 | Bacteria | 4168 |
| 343 | Ga0395905_0082438 | 3300037471 | Bacteria | 3013 |
| 344 | Ga0395905_0265783 | 3300037471 | Bacteria | 1601 |
| 345 | Ga0395901_0071323 | 3300038443 | Bacteria | 3620 |
| 346 | Ga0395901_0081828 | 3300038443 | Bacteria | 3373 |
| 347 | Ga0395901_0741369 | 3300038443 | Bacteria | 976 |
| 348 | Ga0436365_1251897 | 3300039437 | Bacteria | 24739 |
| 349 | Ga0436365_1501550 | 3300039437 | Unclassified | 2102 |
| 350 | Ga0436361_0544688 | 3300039447 | Bacteria | 4916 |
| 351 | Ga0439436_0007176 | 3300041404 | Bacteria | 3429 |
| 352 | Ga0439439_0000685 | 3300041406 | Bacteria | 5987 |
| 353 | Ga0439466_0040771 | 3300041411 | Bacteria | 1552 |
| 354 | Ga0451855_0034114 | 3300041511 | Bacteria | 3113 |
| 355 | Ga0439433_0003295 | 3300041999 | Bacteria | 3460 |
| 356 | Ga0439445_0053759 | 3300042004 | Bacteria | 1091 |
| 357 | Ga0439449_0004582 | 3300042007 | Bacteria | 5343 |
| 358 | Ga0439449_0004763 | 3300042007 | Bacteria | 5237 |
| 359 | Ga0439449_0038234 | 3300042007 | Bacteria | 1785 |
| 360 | Ga0439457_015664 | 3300042014 | Bacteria | 1692 |
| 361 | Ga0439457_028009 | 3300042014 | Bacteria | 1247 |
| 362 | Ga0439462_0001585 | 3300042015 | Bacteria | 5106 |
| 363 | Ga0439462_0035363 | 3300042015 | Bacteria | 1328 |
| 364 | Ga0439434_0023737 | 3300042435 | Bacteria | 1847 |
| 365 | Ga0439434_0056571 | 3300042435 | Bacteria | 1222 |
| 366 | Ga0451577_0010712 | 3300042876 | Bacteria | 8730 |
| 367 | Ga0451577_0056136 | 3300042876 | Bacteria | 3512 |
| 368 | Ga0451577_0140651 | 3300042876 | Bacteria | 2169 |
| 369 | Ga0451577_0592703 | 3300042876 | Bacteria | 1006 |
| 370 | Ga0453683_0007933 | 3300044673 | Bacteria | 7155 |
| 371 | Ga0453683_0079499 | 3300044673 | Bacteria | 2053 |
| 372 | Ga0453684_0000191 | 3300044712 | Bacteria | 267816 |
| 373 | Ga0453684_0001431 | 3300044712 | Bacteria | 68233 |
| 374 | Ga0453684_0125115 | 3300044712 | Bacteria | 3096 |
| 375 | Ga0451576_0003347 | 3300045051 | Bacteria | 22204 |
| 376 | Ga0451576_0004911 | 3300045051 | Bacteria | 17059 |
| 377 | Ga0495638_0059936 | 3300046460 | Bacteria | 2355 |
| 378 | Ga0495638_0161133 | 3300046460 | Bacteria | 1294 |
| 379 | Ga0495651_0318377 | 3300046462 | Bacteria | 1038 |
| 380 | Ga0495650_0000025 | 3300046471 | Bacteria | 486001 |
| 381 | Ga0495585_0000290 | 3300046492 | Bacteria | 50496 |
| 382 | Ga0495585_0000980 | 3300046492 | Bacteria | 23938 |
| 383 | Ga0495585_0273334 | 3300046492 | Bacteria | 837 |
| 384 | Ga0495606_0000035 | 3300046507 | Bacteria | 243820 |
| 385 | Ga0495606_0010337 | 3300046507 | Bacteria | 7761 |
| 386 | Ga0495606_0057220 | 3300046507 | Bacteria | 2512 |
| 387 | Ga0495610_0001310 | 3300046512 | Bacteria | 22164 |
| 388 | Ga0495610_0014425 | 3300046512 | Bacteria | 4641 |
| 389 | Ga0495616_0012017 | 3300046513 | Bacteria | 4930 |
| 390 | Ga0495637_0022925 | 3300046520 | Bacteria | 2842 |
| 391 | Ga0495652_0139161 | 3300046529 | Bacteria | 1911 |
| 392 | Ga0495652_0231095 | 3300046529 | Bacteria | 1383 |
| 393 | Ga0495652_0562010 | 3300046529 | Bacteria | 783 |
| 394 | Ga0495654_0031871 | 3300046530 | Bacteria | 2675 |
| 395 | Ga0495654_0078093 | 3300046530 | Bacteria | 1557 |
| 396 | Ga0495609_0010365 | 3300046538 | Bacteria | 4473 |
| 397 | Ga0495609_0090612 | 3300046538 | Bacteria | 1330 |
| 398 | Ga0495633_0000172 | 3300046558 | Bacteria | 84811 |
| 399 | Ga0495633_0031931 | 3300046558 | Bacteria | 2547 |
| 400 | Ga0495668_0000069 | 3300046616 | Bacteria | 174287 |
| 401 | Ga0495668_0128064 | 3300046616 | Bacteria | 1390 |
| 402 | Ga0495625_0000063 | 3300046660 | Bacteria | 176435 |
| 403 | Ga0495625_0000385 | 3300046660 | Bacteria | 67419 |
| 404 | Ga0495625_0000419 | 3300046660 | Bacteria | 63844 |
| 405 | Ga0495661_0004990 | 3300046665 | Bacteria | 9477 |
| 406 | Ga0495661_0040839 | 3300046665 | Bacteria | 2874 |
| 407 | Ga0495658_0060081 | 3300046683 | Bacteria | 2179 |
| 408 | Ga0495649_0000006 | 3300046694 | Bacteria | 542188 |
| 409 | Ga0495672_0005283 | 3300047320 | Bacteria | 10282 |
| 410 | Ga0495687_000243 | 3300047443 | Bacteria | 75026 |
| 411 | Ga0495687_001958 | 3300047443 | Bacteria | 17588 |
| 412 | Ga0495614_0067849 | 3300048089 | Bacteria | 1535 |
| 413 | Ga0496114_0265998 | 3300048917 | Unclassified | 1511 |
| 414 | Ga0496115_0164960 | 3300048918 | Bacteria | 1832 |
| 415 | Ga0496123_0022358 | 3300048926 | Bacteria | 4875 |
| 416 | Ga0496124_0003190 | 3300048927 | Bacteria | 20256 |
| 417 | Ga0496124_0014329 | 3300048927 | Bacteria | 7669 |
| 418 | Ga0496125_0004037 | 3300048928 | Bacteria | 17207 |
| 419 | Ga0496126_0000153 | 3300048929 | Bacteria | 160642 |
| 420 | Ga0501291_010833 | 3300049514 | Unclassified | 1304 |
| 421 | Ga0501033_0042980 | 3300049570 | Bacteria | 3367 |
| 422 | Ga0501033_0389698 | 3300049570 | Unclassified | 973 |
| 423 | Ga0501034_0005663 | 3300049571 | Bacteria | 13592 |
| 424 | Ga0501034_0016302 | 3300049571 | Bacteria | 7628 |
| 425 | Ga0501034_0063913 | 3300049571 | Unclassified | 3694 |
| 426 | Ga0501034_0300693 | 3300049571 | Bacteria | 1541 |
| 427 | Ga0501036_0141203 | 3300049572 | Bacteria | 2032 |
| 428 | Ga0501038_0055888 | 3300049574 | Bacteria | 3390 |
| 429 | Ga0501039_0032992 | 3300049575 | Bacteria | 3994 |
| 430 | Ga0501043_0003830 | 3300049579 | Bacteria | 12375 |
| 431 | Ga0501046_0006720 | 3300049580 | Bacteria | 10156 |
| 432 | Ga0501047_0010701 | 3300049581 | Bacteria | 8669 |
| 433 | Ga0501070_0041260 | 3300049586 | Bacteria | 3845 |
| 434 | Ga0501070_0427560 | 3300049586 | Unclassified | 1069 |
| 435 | Ga0501073_0002013 | 3300049589 | Bacteria | 15173 |
| 436 | Ga0501074_0002600 | 3300049590 | Bacteria | 12616 |
| 437 | Ga0501202_029400 | 3300049652 | Bacteria | 1139 |
| 438 | Ga0501223_002156 | 3300049663 | Bacteria | 4411 |
| 439 | Ga0501233_006755 | 3300049668 | Bacteria | 2165 |
| 440 | Ga0501235_028660 | 3300049669 | Bacteria | 1251 |
| 441 | Ga0501240_009402 | 3300049673 | Bacteria | 1275 |
| 442 | Ga0501243_004172 | 3300049675 | Bacteria | 2162 |
| 443 | Ga0501243_008698 | 3300049675 | Bacteria | 1569 |
| 444 | Ga0501225_0042448 | 3300049705 | Bacteria | 1256 |
| 445 | Ga0501080_0018745 | 3300049742 | Bacteria | 6404 |
| 446 | Ga0501080_0181426 | 3300049742 | Bacteria | 1937 |
| 447 | Ga0501083_0012750 | 3300049744 | Bacteria | 5878 |
| 448 | Ga0501035_0049062 | 3300049822 | Bacteria | 3784 |
| 449 | Ga0501035_0079018 | 3300049822 | Bacteria | 2906 |
| 450 | Ga0501044_0045316 | 3300049823 | Bacteria | 4557 |
| 451 | Ga0501044_0251411 | 3300049823 | Bacteria | 1708 |
| 452 | nmdc:mga0k408_190_c1 | 3300050493 | Bacteria | 31887 |
| 453 | nmdc:mga0qj67_44943_c1 | 3300050509 | Bacteria | 3484 |
| 454 | nmdc:mga06r32_117938_c1 | 3300050510 | Bacteria | 2616 |
| 455 | Ga0500647_0124805 | 3300053091 | Bacteria | 1217 |
| 456 | Ga0500583_0015747 | 3300053092 | Unclassified | 3001 |
| 457 | Ga0500562_000047 | 3300053108 | Bacteria | 62430 |
| 458 | Ga0500618_000001 | 3300053125 | Bacteria | 538477 |
| 459 | Ga0500618_020344 | 3300053125 | Bacteria | 1626 |
| 460 | Ga0500642_0010291 | 3300053130 | Unclassified | 3292 |
| 461 | Ga0500616_0009931 | 3300053153 | Bacteria | 5729 |
| 462 | Ga0500619_144813 | 3300053154 | Bacteria | 809 |
| 463 | Ga0500622_0012858 | 3300053156 | Bacteria | 4523 |
| 464 | Ga0500622_0049166 | 3300053156 | Bacteria | 2175 |
| 465 | Ga0500645_017016 | 3300053730 | Bacteria | 2284 |
| 466 | Ga0501082_0077751 | 3300060353 | Bacteria | 2861 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10156011 | Ga0157370_101560112 | 232 |
| 2 | 3300013105 | Ga0157369_10139752 | Ga0157369_101397522 | 232 |
| 3 | 3300013307 | Ga0157372_10011878 | Ga0157372_100118785 | 232 |
| 4 | 3300046462 | Ga0495651_0318377 | Ga0495651_0318377_72_770 | 232 |
| 5 | 3300046492 | Ga0495585_0000290 | Ga0495585_0000290_34727_35425 | 232 |
| 6 | 3300046492 | Ga0495585_0273334 | Ga0495585_0273334_87_785 | 232 |
| 7 | 3300046520 | Ga0495637_0022925 | Ga0495637_0022925_760_1458 | 232 |
| 8 | 3300046529 | Ga0495652_0139161 | Ga0495652_0139161_93_791 | 232 |
| 9 | 3300046529 | Ga0495652_0562010 | Ga0495652_0562010_13_711 | 232 |
| 10 | 3300046538 | Ga0495609_0090612 | Ga0495609_0090612_21_719 | 232 |
| 11 | 3300053091 | Ga0500647_0124805 | Ga0500647_0124805_369_1067 | 232 |
| 12 | 3300053154 | Ga0500619_144813 | Ga0500619_144813_91_789 | 232 |
| 13 | 3300046507 | Ga0495606_0010337 | Ga0495606_0010337_3172_3927 | 251 |
| 14 | 3300005355 | Ga0070671_100073637 | Ga0070671_1000736371 | 252 |
| 15 | 3300021361 | Ga0213872_10011465 | Ga0213872_100114654 | 252 |
| 16 | 3300046558 | Ga0495633_0000172 | Ga0495633_0000172_48635_49393 | 252 |
| 17 | 3300046660 | Ga0495625_0000385 | Ga0495625_0000385_65410_66168 | 252 |
| 18 | 3300050493 | nmdc:mga0k408_190_c1 | nmdc:mga0k408_190_c1_28272_29030 | 252 |
| 19 | 3300042876 | Ga0451577_0592703 | Ga0451577_0592703_213_986 | 257 |
| 20 | 3300005614 | Ga0068856_100070615 | Ga0068856_1000706153 | 258 |
| 21 | 3300026078 | Ga0207702_10075338 | Ga0207702_100753381 | 258 |
| 22 | 3300005334 | Ga0068869_100094402 | Ga0068869_1000944022 | 262 |
| 23 | 3300006195 | Ga0075366_10181895 | Ga0075366_101818951 | 262 |
| 24 | 3300009148 | Ga0105243_10105721 | Ga0105243_101057212 | 262 |
| 25 | 3300026089 | Ga0207648_10001073 | Ga0207648_1000107318 | 262 |
| 26 | 3300039437 | Ga0436365_1251897 | Ga0436365_1251897_18236_19024 | 262 |
| 27 | 3300053125 | Ga0500618_000001 | Ga0500618_000001_482995_483798 | 267 |
| 28 | 3300013297 | Ga0157378_10004167 | Ga0157378_1000416714 | 270 |
| 29 | 3300013307 | Ga0157372_10422384 | Ga0157372_104223842 | 271 |
| 30 | iso_pu_bacteria | 2599185184 | 2599480322 | 272 |
| 31 | iso_pu_bacteria | 2738541273 | 2738700822 | 272 |
| 32 | iso_pu_bacteria | 2738543014 | 2739254571 | 272 |
| 33 | iso_pu_bacteria | 2791355222 | 2793182853 | 272 |
| 34 | iso_pu_bacteria | 2818991444 | 2819586664 | 272 |
| 35 | iso_pu_bacteria | 2904113452 | 2904119639 | 272 |
| 36 | iso_pu_bacteria | 2910245624 | 2910246141 | 272 |
| 37 | iso_pu_bacteria | 2914759650 | 2914760424 | 272 |
| 38 | iso_pu_bacteria | 2928078545 | 2928083427 | 272 |
| 39 | iso_pu_bacteria | 2928147474 | 2928151309 | 272 |
| 40 | iso_pu_bacteria | 2932082852 | 2932084610 | 272 |
| 41 | iso_pu_bacteria | 2842682962 | 2842687151 | 274 |
| 42 | 3300001904 | JGI24736J21556_1017597 | JGI24736J21556_10175972 | 276 |
| 43 | 3300001989 | JGI24739J22299_10013373 | JGI24739J22299_100133732 | 276 |
| 44 | 3300001990 | JGI24737J22298_10005749 | JGI24737J22298_100057492 | 276 |
| 45 | 3300002067 | JGI24735J21928_10000013 | JGI24735J21928_1000001355 | 276 |
| 46 | 3300003316 | rootH1_10001050 | rootH1_100010502 | 276 |
| 47 | 3300003322 | rootL2_10032000 | rootL2_100320006 | 276 |
| 48 | 3300003322 | rootL2_10146929 | rootL2_101469292 | 276 |
| 49 | 3300003323 | rootH1_10024035 | rootH1_100240354 | 276 |
| 50 | 3300003323 | rootH1_10197073 | rootH1_101970734 | 276 |
| 51 | 3300003354 | JGI25160J50197_1000376 | JGI25160J50197_100037613 | 276 |
| 52 | 3300005288 | Ga0065714_10069557 | Ga0065714_100695572 | 276 |
| 53 | 3300005289 | Ga0065704_10164208 | Ga0065704_101642082 | 276 |
| 54 | 3300005327 | Ga0070658_10058950 | Ga0070658_100589502 | 276 |
| 55 | 3300005327 | Ga0070658_10089536 | Ga0070658_100895362 | 276 |
| 56 | 3300005327 | Ga0070658_10237411 | Ga0070658_102374112 | 276 |
| 57 | 3300005329 | Ga0070683_100034695 | Ga0070683_1000346951 | 276 |
| 58 | 3300005330 | Ga0070690_100260562 | Ga0070690_1002605621 | 276 |
| 59 | 3300005331 | Ga0070670_100032693 | Ga0070670_1000326932 | 276 |
| 60 | 3300005331 | Ga0070670_100275341 | Ga0070670_1002753412 | 276 |
| 61 | 3300005334 | Ga0068869_100007354 | Ga0068869_1000073543 | 276 |
| 62 | 3300005334 | Ga0068869_100272450 | Ga0068869_1002724501 | 276 |
| 63 | 3300005335 | Ga0070666_10000042 | Ga0070666_10000042103 | 276 |
| 64 | 3300005336 | Ga0070680_100000878 | Ga0070680_10000087812 | 276 |
| 65 | 3300005336 | Ga0070680_100027359 | Ga0070680_1000273592 | 276 |
| 66 | 3300005337 | Ga0070682_100001122 | Ga0070682_10000112211 | 276 |
| 67 | 3300005338 | Ga0068868_100004734 | Ga0068868_1000047342 | 276 |
| 68 | 3300005338 | Ga0068868_100271537 | Ga0068868_1002715371 | 276 |
| 69 | 3300005339 | Ga0070660_100079286 | Ga0070660_1000792862 | 276 |
| 70 | 3300005339 | Ga0070660_100168873 | Ga0070660_1001688732 | 276 |
| 71 | 3300005341 | Ga0070691_10055513 | Ga0070691_100555132 | 276 |
| 72 | 3300005344 | Ga0070661_100028849 | Ga0070661_1000288493 | 276 |
| 73 | 3300005345 | Ga0070692_10119637 | Ga0070692_101196372 | 276 |
| 74 | 3300005353 | Ga0070669_100378366 | Ga0070669_1003783661 | 276 |
| 75 | 3300005354 | Ga0070675_100029413 | Ga0070675_1000294133 | 276 |
| 76 | 3300005354 | Ga0070675_100154983 | Ga0070675_1001549832 | 276 |
| 77 | 3300005355 | Ga0070671_100236140 | Ga0070671_1002361401 | 276 |
| 78 | 3300005355 | Ga0070671_100290019 | Ga0070671_1002900191 | 276 |
| 79 | 3300005365 | Ga0070688_100160740 | Ga0070688_1001607402 | 276 |
| 80 | 3300005366 | Ga0070659_100023248 | Ga0070659_1000232485 | 276 |
| 81 | 3300005367 | Ga0070667_100044613 | Ga0070667_1000446134 | 276 |
| 82 | 3300005367 | Ga0070667_100087465 | Ga0070667_1000874652 | 276 |
| 83 | 3300005367 | Ga0070667_100729402 | Ga0070667_1007294021 | 276 |
| 84 | 3300005441 | Ga0070700_100212342 | Ga0070700_1002123421 | 276 |
| 85 | 3300005455 | Ga0070663_100066019 | Ga0070663_1000660192 | 276 |
| 86 | 3300005456 | Ga0070678_100364358 | Ga0070678_1003643582 | 276 |
| 87 | 3300005458 | Ga0070681_10107427 | Ga0070681_101074272 | 276 |
| 88 | 3300005459 | Ga0068867_100371125 | Ga0068867_1003711252 | 276 |
| 89 | 3300005530 | Ga0070679_100003316 | Ga0070679_1000033167 | 276 |
| 90 | 3300005535 | Ga0070684_100384859 | Ga0070684_1003848592 | 276 |
| 91 | 3300005539 | Ga0068853_100017299 | Ga0068853_1000172994 | 276 |
| 92 | 3300005544 | Ga0070686_100350105 | Ga0070686_1003501052 | 276 |
| 93 | 3300005547 | Ga0070693_100000650 | Ga0070693_10000065010 | 276 |
| 94 | 3300005548 | Ga0070665_100000006 | Ga0070665_100000006115 | 276 |
| 95 | 3300005563 | Ga0068855_100005029 | Ga0068855_1000050295 | 276 |
| 96 | 3300005563 | Ga0068855_100021745 | Ga0068855_1000217452 | 276 |
| 97 | 3300005563 | Ga0068855_100022488 | Ga0068855_1000224884 | 276 |
| 98 | 3300005563 | Ga0068855_100268785 | Ga0068855_1002687853 | 276 |
| 99 | 3300005564 | Ga0070664_100020776 | Ga0070664_1000207763 | 276 |
| 100 | 3300005564 | Ga0070664_100459822 | Ga0070664_1004598222 | 276 |
| 101 | 3300005577 | Ga0068857_100001316 | Ga0068857_10000131614 | 276 |
| 102 | 3300005577 | Ga0068857_100430408 | Ga0068857_1004304081 | 276 |
| 103 | 3300005578 | Ga0068854_100228082 | Ga0068854_1002280822 | 276 |
| 104 | 3300005614 | Ga0068856_100050360 | Ga0068856_1000503603 | 276 |
| 105 | 3300005614 | Ga0068856_100097121 | Ga0068856_1000971213 | 276 |
| 106 | 3300005614 | Ga0068856_100115232 | Ga0068856_1001152321 | 276 |
| 107 | 3300005616 | Ga0068852_100000811 | Ga0068852_10000081112 | 276 |
| 108 | 3300005616 | Ga0068852_100001166 | Ga0068852_1000011668 | 276 |
| 109 | 3300005616 | Ga0068852_100009916 | Ga0068852_1000099165 | 276 |
| 110 | 3300005616 | Ga0068852_100089660 | Ga0068852_1000896603 | 276 |
| 111 | 3300005616 | Ga0068852_100568653 | Ga0068852_1005686531 | 276 |
| 112 | 3300005616 | Ga0068852_100637843 | Ga0068852_1006378431 | 276 |
| 113 | 3300005616 | Ga0068852_100670681 | Ga0068852_1006706812 | 276 |
| 114 | 3300005617 | Ga0068859_100013654 | Ga0068859_1000136542 | 276 |
| 115 | 3300005617 | Ga0068859_100067304 | Ga0068859_1000673041 | 276 |
| 116 | 3300005617 | Ga0068859_100178142 | Ga0068859_1001781422 | 276 |
| 117 | 3300005618 | Ga0068864_100009257 | Ga0068864_1000092574 | 276 |
| 118 | 3300005618 | Ga0068864_100071098 | Ga0068864_1000710982 | 276 |
| 119 | 3300005618 | Ga0068864_100207334 | Ga0068864_1002073342 | 276 |
| 120 | 3300005618 | Ga0068864_100477920 | Ga0068864_1004779201 | 276 |
| 121 | 3300005834 | Ga0068851_10012661 | Ga0068851_100126613 | 276 |
| 122 | 3300005834 | Ga0068851_10081459 | Ga0068851_100814592 | 276 |
| 123 | 3300005841 | Ga0068863_100005978 | Ga0068863_1000059782 | 276 |
| 124 | 3300005841 | Ga0068863_100052271 | Ga0068863_1000522715 | 276 |
| 125 | 3300005842 | Ga0068858_100046101 | Ga0068858_1000461012 | 276 |
| 126 | 3300005843 | Ga0068860_100000005 | Ga0068860_10000000557 | 276 |
| 127 | 3300005843 | Ga0068860_100002561 | Ga0068860_1000025617 | 276 |
| 128 | 3300005843 | Ga0068860_100003920 | Ga0068860_1000039208 | 276 |
| 129 | 3300005843 | Ga0068860_100027888 | Ga0068860_1000278882 | 276 |
| 130 | 3300005843 | Ga0068860_100112440 | Ga0068860_1001124402 | 276 |
| 131 | 3300005843 | Ga0068860_100451802 | Ga0068860_1004518022 | 276 |
| 132 | 3300006173 | Ga0070716_100084569 | Ga0070716_1000845694 | 276 |
| 133 | 3300006195 | Ga0075366_10008789 | Ga0075366_100087895 | 276 |
| 134 | 3300006237 | Ga0097621_100002185 | Ga0097621_1000021853 | 276 |
| 135 | 3300006358 | Ga0068871_100019766 | Ga0068871_1000197663 | 276 |
| 136 | 3300006844 | Ga0075428_100080181 | Ga0075428_1000801814 | 276 |
| 137 | 3300006846 | Ga0075430_100007454 | Ga0075430_1000074542 | 276 |
| 138 | 3300006847 | Ga0075431_100055364 | Ga0075431_1000553644 | 276 |
| 139 | 3300006880 | Ga0075429_100086160 | Ga0075429_1000861602 | 276 |
| 140 | 3300006931 | Ga0097620_100013654 | Ga0097620_1000136542 | 276 |
| 141 | 3300006931 | Ga0097620_100039542 | Ga0097620_1000395425 | 276 |
| 142 | 3300006931 | Ga0097620_100067307 | Ga0097620_1000673071 | 276 |
| 143 | 3300006931 | Ga0097620_100178146 | Ga0097620_1001781462 | 276 |
| 144 | 3300009093 | Ga0105240_10001981 | Ga0105240_1000198110 | 276 |
| 145 | 3300009093 | Ga0105240_10002364 | Ga0105240_1000236415 | 276 |
| 146 | 3300009093 | Ga0105240_10008491 | Ga0105240_1000849113 | 276 |
| 147 | 3300009093 | Ga0105240_10083819 | Ga0105240_100838193 | 276 |
| 148 | 3300009093 | Ga0105240_10186537 | Ga0105240_101865373 | 276 |
| 149 | 3300009093 | Ga0105240_10212651 | Ga0105240_102126514 | 276 |
| 150 | 3300009101 | Ga0105247_10022031 | Ga0105247_100220313 | 276 |
| 151 | 3300009147 | Ga0114129_10067557 | Ga0114129_100675573 | 276 |
| 152 | 3300009174 | Ga0105241_10006161 | Ga0105241_100061613 | 276 |
| 153 | 3300009174 | Ga0105241_10009180 | Ga0105241_100091803 | 276 |
| 154 | 3300009174 | Ga0105241_10122505 | Ga0105241_101225053 | 276 |
| 155 | 3300009545 | Ga0105237_10002312 | Ga0105237_1000231215 | 276 |
| 156 | 3300009545 | Ga0105237_10006705 | Ga0105237_100067052 | 276 |
| 157 | 3300009545 | Ga0105237_10011376 | Ga0105237_100113763 | 276 |
| 158 | 3300009545 | Ga0105237_10021911 | Ga0105237_100219116 | 276 |
| 159 | 3300009545 | Ga0105237_10103921 | Ga0105237_101039212 | 276 |
| 160 | 3300009545 | Ga0105237_10191041 | Ga0105237_101910413 | 276 |
| 161 | 3300009545 | Ga0105237_10387381 | Ga0105237_103873812 | 276 |
| 162 | 3300009545 | Ga0105237_10772888 | Ga0105237_107728881 | 276 |
| 163 | 3300009553 | Ga0105249_10600628 | Ga0105249_106006281 | 276 |
| 164 | 3300009553 | Ga0105249_10850480 | Ga0105249_108504801 | 276 |
| 165 | 3300010375 | Ga0105239_10006736 | Ga0105239_100067364 | 276 |
| 166 | 3300010375 | Ga0105239_10031088 | Ga0105239_100310884 | 276 |
| 167 | 3300010375 | Ga0105239_10243849 | Ga0105239_102438492 | 276 |
| 168 | 3300010375 | Ga0105239_10410474 | Ga0105239_104104742 | 276 |
| 169 | 3300011119 | Ga0105246_10062235 | Ga0105246_100622352 | 276 |
| 170 | 3300013100 | Ga0157373_10006957 | Ga0157373_100069573 | 276 |
| 171 | 3300013100 | Ga0157373_10137943 | Ga0157373_101379431 | 276 |
| 172 | 3300013102 | Ga0157371_10000242 | Ga0157371_100002429 | 276 |
| 173 | 3300013102 | Ga0157371_10007760 | Ga0157371_100077602 | 276 |
| 174 | 3300013102 | Ga0157371_10008547 | Ga0157371_100085477 | 276 |
| 175 | 3300013102 | Ga0157371_10033320 | Ga0157371_100333203 | 276 |
| 176 | 3300013102 | Ga0157371_10114507 | Ga0157371_101145072 | 276 |
| 177 | 3300013104 | Ga0157370_10007415 | Ga0157370_100074154 | 276 |
| 178 | 3300013104 | Ga0157370_10014024 | Ga0157370_100140243 | 276 |
| 179 | 3300013104 | Ga0157370_10062438 | Ga0157370_100624382 | 276 |
| 180 | 3300013104 | Ga0157370_10074087 | Ga0157370_100740874 | 276 |
| 181 | 3300013105 | Ga0157369_10012301 | Ga0157369_100123019 | 276 |
| 182 | 3300013105 | Ga0157369_10036173 | Ga0157369_100361733 | 276 |
| 183 | 3300013105 | Ga0157369_10224911 | Ga0157369_102249112 | 276 |
| 184 | 3300013105 | Ga0157369_10283965 | Ga0157369_102839652 | 276 |
| 185 | 3300013105 | Ga0157369_10556784 | Ga0157369_105567842 | 276 |
| 186 | 3300013296 | Ga0157374_10182361 | Ga0157374_101823613 | 276 |
| 187 | 3300013296 | Ga0157374_10300760 | Ga0157374_103007602 | 276 |
| 188 | 3300013297 | Ga0157378_10044235 | Ga0157378_100442352 | 276 |
| 189 | 3300013297 | Ga0157378_10045074 | Ga0157378_100450743 | 276 |
| 190 | 3300013297 | Ga0157378_10072153 | Ga0157378_100721531 | 276 |
| 191 | 3300013297 | Ga0157378_10279820 | Ga0157378_102798202 | 276 |
| 192 | 3300013297 | Ga0157378_10436987 | Ga0157378_104369872 | 276 |
| 193 | 3300013306 | Ga0163162_10005547 | Ga0163162_100055472 | 276 |
| 194 | 3300013306 | Ga0163162_10031627 | Ga0163162_100316272 | 276 |
| 195 | 3300013306 | Ga0163162_10046772 | Ga0163162_100467722 | 276 |
| 196 | 3300013306 | Ga0163162_10229752 | Ga0163162_102297521 | 276 |
| 197 | 3300013307 | Ga0157372_10000052 | Ga0157372_1000005241 | 276 |
| 198 | 3300013307 | Ga0157372_10000115 | Ga0157372_1000011542 | 276 |
| 199 | 3300013307 | Ga0157372_10008424 | Ga0157372_100084247 | 276 |
| 200 | 3300013307 | Ga0157372_10028489 | Ga0157372_100284892 | 276 |
| 201 | 3300013307 | Ga0157372_10045882 | Ga0157372_100458825 | 276 |
| 202 | 3300013307 | Ga0157372_10074816 | Ga0157372_100748162 | 276 |
| 203 | 3300013307 | Ga0157372_10081022 | Ga0157372_100810223 | 276 |
| 204 | 3300013307 | Ga0157372_10109475 | Ga0157372_101094752 | 276 |
| 205 | 3300013307 | Ga0157372_10115082 | Ga0157372_101150823 | 276 |
| 206 | 3300013307 | Ga0157372_10155631 | Ga0157372_101556313 | 276 |
| 207 | 3300013307 | Ga0157372_10494999 | Ga0157372_104949992 | 276 |
| 208 | 3300013307 | Ga0157372_10581076 | Ga0157372_105810762 | 276 |
| 209 | 3300013307 | Ga0157372_10709006 | Ga0157372_107090062 | 276 |
| 210 | 3300013308 | Ga0157375_10192383 | Ga0157375_101923832 | 276 |
| 211 | 3300014325 | Ga0163163_10340249 | Ga0163163_103402491 | 276 |
| 212 | 3300014325 | Ga0163163_10394846 | Ga0163163_103948462 | 276 |
| 213 | 3300014326 | Ga0157380_10809862 | Ga0157380_108098621 | 276 |
| 214 | 3300014968 | Ga0157379_10295979 | Ga0157379_102959792 | 276 |
| 215 | 3300014968 | Ga0157379_10475910 | Ga0157379_104759101 | 276 |
| 216 | 3300014969 | Ga0157376_10002899 | Ga0157376_100028991 | 276 |
| 217 | 3300015261 | Ga0182006_1000876 | Ga0182006_100087613 | 276 |
| 218 | 3300017792 | Ga0163161_10000905 | Ga0163161_100009056 | 276 |
| 219 | 3300021384 | Ga0213876_10005187 | Ga0213876_100051873 | 276 |
| 220 | 3300025250 | Ga0209026_1000862 | Ga0209026_100086210 | 276 |
| 221 | 3300025261 | Ga0209233_1004147 | Ga0209233_10041472 | 276 |
| 222 | 3300025302 | Ga0207426_1000026 | Ga0207426_1000026437 | 276 |
| 223 | 3300025315 | Ga0207697_10161336 | Ga0207697_101613361 | 276 |
| 224 | 3300025321 | Ga0207656_10056065 | Ga0207656_100560651 | 276 |
| 225 | 3300025893 | Ga0207682_10117240 | Ga0207682_101172402 | 276 |
| 226 | 3300025900 | Ga0207710_10008199 | Ga0207710_100081992 | 276 |
| 227 | 3300025903 | Ga0207680_10000228 | Ga0207680_1000022825 | 276 |
| 228 | 3300025904 | Ga0207647_10000480 | Ga0207647_1000048021 | 276 |
| 229 | 3300025904 | Ga0207647_10007430 | Ga0207647_100074307 | 276 |
| 230 | 3300025904 | Ga0207647_10122070 | Ga0207647_101220702 | 276 |
| 231 | 3300025907 | Ga0207645_10022378 | Ga0207645_100223782 | 276 |
| 232 | 3300025907 | Ga0207645_10195536 | Ga0207645_101955362 | 276 |
| 233 | 3300025908 | Ga0207643_10134355 | Ga0207643_101343552 | 276 |
| 234 | 3300025909 | Ga0207705_10000015 | Ga0207705_10000015159 | 276 |
| 235 | 3300025909 | Ga0207705_10004284 | Ga0207705_100042843 | 276 |
| 236 | 3300025911 | Ga0207654_10004675 | Ga0207654_100046755 | 276 |
| 237 | 3300025911 | Ga0207654_10017743 | Ga0207654_100177433 | 276 |
| 238 | 3300025911 | Ga0207654_10304322 | Ga0207654_103043221 | 276 |
| 239 | 3300025912 | Ga0207707_10000722 | Ga0207707_1000072214 | 276 |
| 240 | 3300025912 | Ga0207707_10012266 | Ga0207707_100122665 | 276 |
| 241 | 3300025912 | Ga0207707_10087874 | Ga0207707_100878742 | 276 |
| 242 | 3300025913 | Ga0207695_10002702 | Ga0207695_1000270217 | 276 |
| 243 | 3300025913 | Ga0207695_10023732 | Ga0207695_100237322 | 276 |
| 244 | 3300025913 | Ga0207695_10101098 | Ga0207695_101010982 | 276 |
| 245 | 3300025913 | Ga0207695_10186053 | Ga0207695_101860531 | 276 |
| 246 | 3300025914 | Ga0207671_10001247 | Ga0207671_1000124716 | 276 |
| 247 | 3300025914 | Ga0207671_10001635 | Ga0207671_100016353 | 276 |
| 248 | 3300025914 | Ga0207671_10004787 | Ga0207671_1000478713 | 276 |
| 249 | 3300025914 | Ga0207671_10006785 | Ga0207671_100067852 | 276 |
| 250 | 3300025914 | Ga0207671_10065245 | Ga0207671_100652452 | 276 |
| 251 | 3300025917 | Ga0207660_10004797 | Ga0207660_100047973 | 276 |
| 252 | 3300025917 | Ga0207660_10019465 | Ga0207660_100194654 | 276 |
| 253 | 3300025918 | Ga0207662_10135392 | Ga0207662_101353922 | 276 |
| 254 | 3300025919 | Ga0207657_10198998 | Ga0207657_101989981 | 276 |
| 255 | 3300025919 | Ga0207657_10210605 | Ga0207657_102106051 | 276 |
| 256 | 3300025919 | Ga0207657_10280592 | Ga0207657_102805921 | 276 |
| 257 | 3300025919 | Ga0207657_10371862 | Ga0207657_103718622 | 276 |
| 258 | 3300025921 | Ga0207652_10001022 | Ga0207652_100010229 | 276 |
| 259 | 3300025921 | Ga0207652_10006617 | Ga0207652_100066177 | 276 |
| 260 | 3300025924 | Ga0207694_10050498 | Ga0207694_100504983 | 276 |
| 261 | 3300025925 | Ga0207650_10110269 | Ga0207650_101102691 | 276 |
| 262 | 3300025925 | Ga0207650_10157283 | Ga0207650_101572832 | 276 |
| 263 | 3300025925 | Ga0207650_10266897 | Ga0207650_102668972 | 276 |
| 264 | 3300025931 | Ga0207644_10087314 | Ga0207644_100873141 | 276 |
| 265 | 3300025931 | Ga0207644_10217730 | Ga0207644_102177302 | 276 |
| 266 | 3300025932 | Ga0207690_10008826 | Ga0207690_100088263 | 276 |
| 267 | 3300025932 | Ga0207690_10030335 | Ga0207690_100303352 | 276 |
| 268 | 3300025935 | Ga0207709_10141262 | Ga0207709_101412622 | 276 |
| 269 | 3300025936 | Ga0207670_10340712 | Ga0207670_103407121 | 276 |
| 270 | 3300025937 | Ga0207669_10003972 | Ga0207669_100039722 | 276 |
| 271 | 3300025940 | Ga0207691_10021466 | Ga0207691_100214665 | 276 |
| 272 | 3300025940 | Ga0207691_10037667 | Ga0207691_100376675 | 276 |
| 273 | 3300025940 | Ga0207691_10160726 | Ga0207691_101607262 | 276 |
| 274 | 3300025940 | Ga0207691_10221128 | Ga0207691_102211282 | 276 |
| 275 | 3300025941 | Ga0207711_10000028 | Ga0207711_10000028142 | 276 |
| 276 | 3300025942 | Ga0207689_10009695 | Ga0207689_100096953 | 276 |
| 277 | 3300025942 | Ga0207689_10078572 | Ga0207689_100785722 | 276 |
| 278 | 3300025944 | Ga0207661_10156025 | Ga0207661_101560252 | 276 |
| 279 | 3300025944 | Ga0207661_10220451 | Ga0207661_102204512 | 276 |
| 280 | 3300025945 | Ga0207679_10021840 | Ga0207679_100218405 | 276 |
| 281 | 3300025945 | Ga0207679_10121644 | Ga0207679_101216442 | 276 |
| 282 | 3300025945 | Ga0207679_10162180 | Ga0207679_101621801 | 276 |
| 283 | 3300025945 | Ga0207679_10373854 | Ga0207679_103738542 | 276 |
| 284 | 3300025949 | Ga0207667_10000009 | Ga0207667_1000000910 | 276 |
| 285 | 3300025949 | Ga0207667_10001800 | Ga0207667_100018006 | 276 |
| 286 | 3300025949 | Ga0207667_10002024 | Ga0207667_1000202417 | 276 |
| 287 | 3300025949 | Ga0207667_10011416 | Ga0207667_100114168 | 276 |
| 288 | 3300025949 | Ga0207667_10040996 | Ga0207667_100409963 | 276 |
| 289 | 3300025949 | Ga0207667_10160636 | Ga0207667_101606362 | 276 |
| 290 | 3300025960 | Ga0207651_10324120 | Ga0207651_103241202 | 276 |
| 291 | 3300025961 | Ga0207712_10009009 | Ga0207712_100090094 | 276 |
| 292 | 3300025961 | Ga0207712_10016687 | Ga0207712_100166872 | 276 |
| 293 | 3300025981 | Ga0207640_10084794 | Ga0207640_100847942 | 276 |
| 294 | 3300025981 | Ga0207640_10317146 | Ga0207640_103171461 | 276 |
| 295 | 3300025986 | Ga0207658_10064798 | Ga0207658_100647982 | 276 |
| 296 | 3300025986 | Ga0207658_10102615 | Ga0207658_101026152 | 276 |
| 297 | 3300026023 | Ga0207677_10494537 | Ga0207677_104945372 | 276 |
| 298 | 3300026035 | Ga0207703_10004767 | Ga0207703_100047673 | 276 |
| 299 | 3300026041 | Ga0207639_10029149 | Ga0207639_100291493 | 276 |
| 300 | 3300026041 | Ga0207639_10032202 | Ga0207639_100322023 | 276 |
| 301 | 3300026041 | Ga0207639_10464122 | Ga0207639_104641222 | 276 |
| 302 | 3300026067 | Ga0207678_10029748 | Ga0207678_100297483 | 276 |
| 303 | 3300026067 | Ga0207678_10341038 | Ga0207678_103410381 | 276 |
| 304 | 3300026075 | Ga0207708_10311876 | Ga0207708_103118761 | 276 |
| 305 | 3300026078 | Ga0207702_10058064 | Ga0207702_100580642 | 276 |
| 306 | 3300026078 | Ga0207702_10356659 | Ga0207702_103566592 | 276 |
| 307 | 3300026088 | Ga0207641_10000158 | Ga0207641_100001583 | 276 |
| 308 | 3300026088 | Ga0207641_10006686 | Ga0207641_100066867 | 276 |
| 309 | 3300026088 | Ga0207641_10336642 | Ga0207641_103366422 | 276 |
| 310 | 3300026095 | Ga0207676_10004127 | Ga0207676_100041275 | 276 |
| 311 | 3300026095 | Ga0207676_10054313 | Ga0207676_100543132 | 276 |
| 312 | 3300026095 | Ga0207676_10150795 | Ga0207676_101507952 | 276 |
| 313 | 3300026095 | Ga0207676_10207452 | Ga0207676_102074522 | 276 |
| 314 | 3300026116 | Ga0207674_10070485 | Ga0207674_100704852 | 276 |
| 315 | 3300026116 | Ga0207674_10162918 | Ga0207674_101629182 | 276 |
| 316 | 3300026118 | Ga0207675_100054038 | Ga0207675_1000540382 | 276 |
| 317 | 3300026121 | Ga0207683_10042793 | Ga0207683_100427932 | 276 |
| 318 | 3300026142 | Ga0207698_10001170 | Ga0207698_100011706 | 276 |
| 319 | 3300026142 | Ga0207698_10001210 | Ga0207698_100012108 | 276 |
| 320 | 3300026142 | Ga0207698_10008221 | Ga0207698_100082213 | 276 |
| 321 | 3300026142 | Ga0207698_10049231 | Ga0207698_100492312 | 276 |
| 322 | 3300026142 | Ga0207698_10056355 | Ga0207698_100563553 | 276 |
| 323 | 3300026142 | Ga0207698_10166184 | Ga0207698_101661841 | 276 |
| 324 | 3300026142 | Ga0207698_10369743 | Ga0207698_103697432 | 276 |
| 325 | 3300026142 | Ga0207698_10805741 | Ga0207698_108057411 | 276 |
| 326 | 3300027111 | Ga0209281_1008337 | Ga0209281_10083372 | 276 |
| 327 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010195 | 276 |
| 328 | 3300028380 | Ga0268265_10819947 | Ga0268265_108199471 | 276 |
| 329 | 3300028381 | Ga0268264_10000012 | Ga0268264_1000001239 | 276 |
| 330 | 3300028381 | Ga0268264_10005689 | Ga0268264_100056892 | 276 |
| 331 | 3300028381 | Ga0268264_10009194 | Ga0268264_100091944 | 276 |
| 332 | 3300028381 | Ga0268264_10031602 | Ga0268264_100316024 | 276 |
| 333 | 3300028381 | Ga0268264_10136542 | Ga0268264_101365422 | 276 |
| 334 | 3300028794 | Ga0307515_10000859 | Ga0307515_1000085943 | 276 |
| 335 | 3300028794 | Ga0307515_10001136 | Ga0307515_1000113611 | 276 |
| 336 | 3300028800 | Ga0265338_10029068 | Ga0265338_100290682 | 276 |
| 337 | 3300030521 | Ga0307511_10000850 | Ga0307511_1000085017 | 276 |
| 338 | 3300031251 | Ga0265327_10000488 | Ga0265327_100004889 | 276 |
| 339 | 3300031251 | Ga0265327_10016774 | Ga0265327_100167743 | 276 |
| 340 | 3300031251 | Ga0265327_10169658 | Ga0265327_101696581 | 276 |
| 341 | 3300031456 | Ga0307513_10248806 | Ga0307513_102488062 | 276 |
| 342 | 3300031507 | Ga0307509_10037320 | Ga0307509_100373202 | 276 |
| 343 | 3300031548 | Ga0307408_100001972 | Ga0307408_1000019723 | 276 |
| 344 | 3300031616 | Ga0307508_10001227 | Ga0307508_1000122715 | 276 |
| 345 | 3300031911 | Ga0307412_10088207 | Ga0307412_100882072 | 276 |
| 346 | 3300031995 | Ga0307409_100120140 | Ga0307409_1001201402 | 276 |
| 347 | 3300032002 | Ga0307416_100178995 | Ga0307416_1001789952 | 276 |
| 348 | 3300032004 | Ga0307414_10158090 | Ga0307414_101580902 | 276 |
| 349 | 3300032126 | Ga0307415_100041291 | Ga0307415_1000412911 | 276 |
| 350 | 3300032137 | Ga0316585_10028486 | Ga0316585_100284862 | 276 |
| 351 | 3300032139 | Ga0316580_10009432 | Ga0316580_100094322 | 276 |
| 352 | 3300033179 | Ga0307507_10020463 | Ga0307507_100204638 | 276 |
| 353 | 3300033180 | Ga0307510_10007660 | Ga0307510_100076607 | 276 |
| 354 | 3300035692 | Ga0373935_0136215 | Ga0373935_0136215_742_1572 | 276 |
| 355 | 3300037312 | Ga0395899_0033581 | Ga0395899_0033581_1697_2527 | 276 |
| 356 | 3300037312 | Ga0395899_0093740 | Ga0395899_0093740_933_1775 | 276 |
| 357 | 3300037312 | Ga0395899_0171142 | Ga0395899_0171142_253_1092 | 276 |
| 358 | 3300037312 | Ga0395899_0265766 | Ga0395899_0265766_203_1033 | 276 |
| 359 | 3300037418 | Ga0395900_0029481 | Ga0395900_0029481_4507_5349 | 276 |
| 360 | 3300037418 | Ga0395900_0077503 | Ga0395900_0077503_1229_2059 | 276 |
| 361 | 3300037418 | Ga0395900_0113365 | Ga0395900_0113365_1090_1920 | 276 |
| 362 | 3300037418 | Ga0395900_0275726 | Ga0395900_0275726_453_1283 | 276 |
| 363 | 3300037418 | Ga0395900_0350884 | Ga0395900_0350884_252_1082 | 276 |
| 364 | 3300037418 | Ga0395900_0400524 | Ga0395900_0400524_173_1003 | 276 |
| 365 | 3300037466 | Ga0395898_0010470 | Ga0395898_0010470_3761_4600 | 276 |
| 366 | 3300037466 | Ga0395898_0068906 | Ga0395898_0068906_1115_1957 | 276 |
| 367 | 3300037466 | Ga0395898_0122628 | Ga0395898_0122628_1041_1871 | 276 |
| 368 | 3300037466 | Ga0395898_0154876 | Ga0395898_0154876_159_1001 | 276 |
| 369 | 3300037471 | Ga0395905_0044479 | Ga0395905_0044479_2964_3794 | 276 |
| 370 | 3300037471 | Ga0395905_0082438 | Ga0395905_0082438_1702_2532 | 276 |
| 371 | 3300037471 | Ga0395905_0265783 | Ga0395905_0265783_231_1073 | 276 |
| 372 | 3300038443 | Ga0395901_0071323 | Ga0395901_0071323_768_1610 | 276 |
| 373 | 3300038443 | Ga0395901_0081828 | Ga0395901_0081828_2487_3317 | 276 |
| 374 | 3300038443 | Ga0395901_0741369 | Ga0395901_0741369_11_853 | 276 |
| 375 | 3300039437 | Ga0436365_1501550 | Ga0436365_1501550_136_966 | 276 |
| 376 | 3300039447 | Ga0436361_0544688 | Ga0436361_0544688_3263_4093 | 276 |
| 377 | 3300041404 | Ga0439436_0007176 | Ga0439436_0007176_225_1055 | 276 |
| 378 | 3300041406 | Ga0439439_0000685 | Ga0439439_0000685_260_1090 | 276 |
| 379 | 3300041411 | Ga0439466_0040771 | Ga0439466_0040771_486_1316 | 276 |
| 380 | 3300041511 | Ga0451855_0034114 | Ga0451855_0034114_709_1548 | 276 |
| 381 | 3300041999 | Ga0439433_0003295 | Ga0439433_0003295_252_1082 | 276 |
| 382 | 3300042004 | Ga0439445_0053759 | Ga0439445_0053759_27_857 | 276 |
| 383 | 3300042007 | Ga0439449_0004582 | Ga0439449_0004582_2992_3822 | 276 |
| 384 | 3300042007 | Ga0439449_0004763 | Ga0439449_0004763_682_1512 | 276 |
| 385 | 3300042007 | Ga0439449_0038234 | Ga0439449_0038234_332_1162 | 276 |
| 386 | 3300042014 | Ga0439457_015664 | Ga0439457_015664_634_1464 | 276 |
| 387 | 3300042014 | Ga0439457_028009 | Ga0439457_028009_147_977 | 276 |
| 388 | 3300042015 | Ga0439462_0001585 | Ga0439462_0001585_199_1029 | 276 |
| 389 | 3300042015 | Ga0439462_0035363 | Ga0439462_0035363_258_1088 | 276 |
| 390 | 3300042435 | Ga0439434_0023737 | Ga0439434_0023737_514_1344 | 276 |
| 391 | 3300042435 | Ga0439434_0056571 | Ga0439434_0056571_354_1184 | 276 |
| 392 | 3300042876 | Ga0451577_0010712 | Ga0451577_0010712_7402_8244 | 276 |
| 393 | 3300042876 | Ga0451577_0056136 | Ga0451577_0056136_2264_3094 | 276 |
| 394 | 3300042876 | Ga0451577_0140651 | Ga0451577_0140651_643_1485 | 276 |
| 395 | 3300044673 | Ga0453683_0007933 | Ga0453683_0007933_1359_2201 | 276 |
| 396 | 3300044673 | Ga0453683_0079499 | Ga0453683_0079499_455_1297 | 276 |
| 397 | 3300044712 | Ga0453684_0000191 | Ga0453684_0000191_15766_16608 | 276 |
| 398 | 3300044712 | Ga0453684_0001431 | Ga0453684_0001431_44846_45688 | 276 |
| 399 | 3300044712 | Ga0453684_0125115 | Ga0453684_0125115_1114_1956 | 276 |
| 400 | 3300045051 | Ga0451576_0003347 | Ga0451576_0003347_5597_6439 | 276 |
| 401 | 3300045051 | Ga0451576_0004911 | Ga0451576_0004911_7349_8191 | 276 |
| 402 | 3300046460 | Ga0495638_0059936 | Ga0495638_0059936_1078_1908 | 276 |
| 403 | 3300046460 | Ga0495638_0161133 | Ga0495638_0161133_285_1115 | 276 |
| 404 | 3300046471 | Ga0495650_0000025 | Ga0495650_0000025_347853_348683 | 276 |
| 405 | 3300046492 | Ga0495585_0000980 | Ga0495585_0000980_18494_19333 | 276 |
| 406 | 3300046507 | Ga0495606_0000035 | Ga0495606_0000035_18870_19700 | 276 |
| 407 | 3300046507 | Ga0495606_0057220 | Ga0495606_0057220_723_1553 | 276 |
| 408 | 3300046512 | Ga0495610_0001310 | Ga0495610_0001310_10355_11185 | 276 |
| 409 | 3300046512 | Ga0495610_0014425 | Ga0495610_0014425_2341_3171 | 276 |
| 410 | 3300046513 | Ga0495616_0012017 | Ga0495616_0012017_2292_3122 | 276 |
| 411 | 3300046529 | Ga0495652_0231095 | Ga0495652_0231095_35_865 | 276 |
| 412 | 3300046530 | Ga0495654_0031871 | Ga0495654_0031871_189_1019 | 276 |
| 413 | 3300046530 | Ga0495654_0078093 | Ga0495654_0078093_376_1215 | 276 |
| 414 | 3300046538 | Ga0495609_0010365 | Ga0495609_0010365_65_904 | 276 |
| 415 | 3300046558 | Ga0495633_0031931 | Ga0495633_0031931_19_849 | 276 |
| 416 | 3300046616 | Ga0495668_0000069 | Ga0495668_0000069_152467_153306 | 276 |
| 417 | 3300046616 | Ga0495668_0128064 | Ga0495668_0128064_511_1341 | 276 |
| 418 | 3300046660 | Ga0495625_0000063 | Ga0495625_0000063_2352_3182 | 276 |
| 419 | 3300046660 | Ga0495625_0000419 | Ga0495625_0000419_56971_57810 | 276 |
| 420 | 3300046665 | Ga0495661_0004990 | Ga0495661_0004990_3810_4640 | 276 |
| 421 | 3300046665 | Ga0495661_0040839 | Ga0495661_0040839_1145_1975 | 276 |
| 422 | 3300046683 | Ga0495658_0060081 | Ga0495658_0060081_303_1142 | 276 |
| 423 | 3300046694 | Ga0495649_0000006 | Ga0495649_0000006_194337_195167 | 276 |
| 424 | 3300047320 | Ga0495672_0005283 | Ga0495672_0005283_237_1067 | 276 |
| 425 | 3300047443 | Ga0495687_000243 | Ga0495687_000243_56668_57498 | 276 |
| 426 | 3300047443 | Ga0495687_001958 | Ga0495687_001958_2638_3468 | 276 |
| 427 | 3300048089 | Ga0495614_0067849 | Ga0495614_0067849_25_864 | 276 |
| 428 | 3300048917 | Ga0496114_0265998 | Ga0496114_0265998_275_1105 | 276 |
| 429 | 3300048918 | Ga0496115_0164960 | Ga0496115_0164960_635_1465 | 276 |
| 430 | 3300048926 | Ga0496123_0022358 | Ga0496123_0022358_2806_3636 | 276 |
| 431 | 3300048927 | Ga0496124_0003190 | Ga0496124_0003190_8342_9172 | 276 |
| 432 | 3300048927 | Ga0496124_0014329 | Ga0496124_0014329_6429_7259 | 276 |
| 433 | 3300048928 | Ga0496125_0004037 | Ga0496125_0004037_13569_14399 | 276 |
| 434 | 3300048929 | Ga0496126_0000153 | Ga0496126_0000153_97897_98733 | 276 |
| 435 | 3300049514 | Ga0501291_010833 | Ga0501291_010833_139_969 | 276 |
| 436 | 3300049570 | Ga0501033_0042980 | Ga0501033_0042980_2267_3103 | 276 |
| 437 | 3300049570 | Ga0501033_0389698 | Ga0501033_0389698_57_887 | 276 |
| 438 | 3300049571 | Ga0501034_0005663 | Ga0501034_0005663_11832_12662 | 276 |
| 439 | 3300049571 | Ga0501034_0016302 | Ga0501034_0016302_1573_2403 | 276 |
| 440 | 3300049571 | Ga0501034_0063913 | Ga0501034_0063913_2829_3659 | 276 |
| 441 | 3300049571 | Ga0501034_0300693 | Ga0501034_0300693_676_1506 | 276 |
| 442 | 3300049572 | Ga0501036_0141203 | Ga0501036_0141203_741_1571 | 276 |
| 443 | 3300049574 | Ga0501038_0055888 | Ga0501038_0055888_573_1403 | 276 |
| 444 | 3300049575 | Ga0501039_0032992 | Ga0501039_0032992_2560_3390 | 276 |
| 445 | 3300049579 | Ga0501043_0003830 | Ga0501043_0003830_947_1777 | 276 |
| 446 | 3300049580 | Ga0501046_0006720 | Ga0501046_0006720_5463_6293 | 276 |
| 447 | 3300049581 | Ga0501047_0010701 | Ga0501047_0010701_4356_5186 | 276 |
| 448 | 3300049586 | Ga0501070_0041260 | Ga0501070_0041260_2458_3288 | 276 |
| 449 | 3300049586 | Ga0501070_0427560 | Ga0501070_0427560_199_1029 | 276 |
| 450 | 3300049589 | Ga0501073_0002013 | Ga0501073_0002013_9065_9895 | 276 |
| 451 | 3300049590 | Ga0501074_0002600 | Ga0501074_0002600_7758_8588 | 276 |
| 452 | 3300049652 | Ga0501202_029400 | Ga0501202_029400_74_904 | 276 |
| 453 | 3300049663 | Ga0501223_002156 | Ga0501223_002156_50_886 | 276 |
| 454 | 3300049668 | Ga0501233_006755 | Ga0501233_006755_1325_2155 | 276 |
| 455 | 3300049669 | Ga0501235_028660 | Ga0501235_028660_391_1221 | 276 |
| 456 | 3300049673 | Ga0501240_009402 | Ga0501240_009402_212_1042 | 276 |
| 457 | 3300049675 | Ga0501243_004172 | Ga0501243_004172_612_1448 | 276 |
| 458 | 3300049675 | Ga0501243_008698 | Ga0501243_008698_359_1189 | 276 |
| 459 | 3300049705 | Ga0501225_0042448 | Ga0501225_0042448_120_950 | 276 |
| 460 | 3300049742 | Ga0501080_0018745 | Ga0501080_0018745_2101_2931 | 276 |
| 461 | 3300049742 | Ga0501080_0181426 | Ga0501080_0181426_59_970 | 276 |
| 462 | 3300049744 | Ga0501083_0012750 | Ga0501083_0012750_2616_3446 | 276 |
| 463 | 3300049822 | Ga0501035_0049062 | Ga0501035_0049062_2361_3191 | 276 |
| 464 | 3300049822 | Ga0501035_0079018 | Ga0501035_0079018_1960_2871 | 276 |
| 465 | 3300049823 | Ga0501044_0045316 | Ga0501044_0045316_1015_1845 | 276 |
| 466 | 3300049823 | Ga0501044_0251411 | Ga0501044_0251411_441_1352 | 276 |
| 467 | 3300050509 | nmdc:mga0qj67_44943_c1 | nmdc:mga0qj67_44943_c1_1296_2126 | 276 |
| 468 | 3300050510 | nmdc:mga06r32_117938_c1 | nmdc:mga06r32_117938_c1_682_1512 | 276 |
| 469 | 3300053092 | Ga0500583_0015747 | Ga0500583_0015747_395_1261 | 276 |
| 470 | 3300053108 | Ga0500562_000047 | Ga0500562_000047_3020_3850 | 276 |
| 471 | 3300053125 | Ga0500618_020344 | Ga0500618_020344_378_1208 | 276 |
| 472 | 3300053130 | Ga0500642_0010291 | Ga0500642_0010291_1684_2550 | 276 |
| 473 | 3300053153 | Ga0500616_0009931 | Ga0500616_0009931_3179_4009 | 276 |
| 474 | 3300053156 | Ga0500622_0012858 | Ga0500622_0012858_2248_3114 | 276 |
| 475 | 3300053156 | Ga0500622_0049166 | Ga0500622_0049166_1190_2020 | 276 |
| 476 | 3300053730 | Ga0500645_017016 | Ga0500645_017016_546_1376 | 276 |
| 477 | 3300060353 | Ga0501082_0077751 | Ga0501082_0077751_1545_2426 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xru-assembly1.cif.gz_A | crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli | 0.9827 | 2 | 274 |
| 1ywk-assembly3.cif.gz_C | crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis | 0.9826 | 2 | 259 |
| 1ywk-assembly6.cif.gz_F | crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis | 0.9803 | 2 | 260 |
| 1x8m-assembly1.cif.gz_A | x-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from escherichia coli | 0.9772 | 1 | 264 |
| 7yrs-assembly4.cif.gz_D | crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops | 0.9758 | 2 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9838 | 26 | 263 | 2.60.120.10 |
| 1ywkB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9802 | 2 | 260 | 2.60.120.10 |
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9677 | 26 | 263 | 2.60.120.10 |
| 1ywkB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9612 | 2 | 260 | 2.60.120.10 |
| 1x8mA02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9587 | 140 | 264 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3G1I0-F1-model_v4 | deleted | 0.9972 | 1 | 143 |
|
| AF-A0A4Q3L616-F1-model_v4 | deleted | 0.9956 | 1 | 253 |
|
| AF-A0A351RGT4-F1-model_v4 | deleted | 0.9953 | 1 | 135 |
|
| AF-A0A4Q5YMU5-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.9941 | 1 | 239 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A484YH81-F1-model_v4 | 5-keto-4-deoxyuronate isomerase (EC 5.3.1.17) | 0.9938 | 67 | 140 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar