F451702

General Info

Members Datasets Scaffolds Average Seq Length
477 254 466 276

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10422384|Ga0157372_104223842
Length 271
Sequence MKQIHAVHPEDFKKYDTATIRERFLLNDLFEKDKINFVYTHYDRMIAGGAMPTNRSLELPDFSILRADYFLERREMGIINVGGSGDEKFNLSKLDCLYIGKGSQKINFSSSDINQPAVFYILSAPAHTKYPTRLLQKKDAESTVLGALETSNQRTIYRYIHKNGIQSCQLVMGLTLLEKGSVWNTIPAHTHDRRMEVYFYFDVPENQIVFHYMGQQEETRHIVMKNYQAVASPPWSIHAGSATSNYGFIWGMAGENLEYSDMDVIQLNDLR

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
3 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
4 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2842682962 Bacillus sp. R-72492 Isolate Unclassified
7 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
8 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
9 2914759650 Rhizosphaericola mali Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
168 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
183 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
232 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
233 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
236 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
246 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0.21
Rhizoplane 0.63
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1017597 3300001904 Bacteria 1133
2 JGI24739J22299_10013373 3300001989 Bacteria 2997
3 JGI24737J22298_10005749 3300001990 Bacteria 4269
4 JGI24735J21928_10000013 3300002067 Bacteria 208663
5 rootH1_10001050 3300003316 Bacteria 47333
6 rootL2_10032000 3300003322 Bacteria 5067
7 rootL2_10146929 3300003322 Bacteria 2945
8 rootH1_10024035 3300003316 Bacteria 8072
9 rootH1_10024035 3300003323 Bacteria 75545
10 rootH1_10197073 3300003323 Bacteria 2545
11 JGI25160J50197_1000376 3300003354 Bacteria 29172
12 Ga0065714_10069557 3300005288 Bacteria 4163
13 Ga0065704_10164208 3300005289 Bacteria 1301
14 Ga0070658_10058950 3300005327 Bacteria 3126
15 Ga0070658_10089536 3300005327 Bacteria 2534
16 Ga0070658_10237411 3300005327 Bacteria 1545
17 Ga0070683_100034695 3300005329 Bacteria 4610
18 Ga0070690_100260562 3300005330 Bacteria 1230
19 Ga0070670_100032693 3300005331 Bacteria 4481
20 Ga0070670_100275341 3300005331 Bacteria 1469
21 Ga0068869_100007354 3300005334 Bacteria 7029
22 Ga0068869_100094402 3300005334 Unclassified 2255
23 Ga0068869_100272450 3300005334 Bacteria 1358
24 Ga0070666_10000042 3300005335 Bacteria 112296
25 Ga0070680_100000878 3300005336 Bacteria 21341
26 Ga0070680_100027359 3300005336 Bacteria 4566
27 Ga0070682_100001122 3300005337 Bacteria 15300
28 Ga0068868_100004734 3300005338 Bacteria 9556
29 Ga0068868_100271537 3300005338 Bacteria 1433
30 Ga0070660_100079286 3300005339 Bacteria 2576
31 Ga0070660_100168873 3300005339 Bacteria 1766
32 Ga0070691_10055513 3300005341 Bacteria 1897
33 Ga0070661_100028849 3300005344 Bacteria 4004
34 Ga0070692_10119637 3300005345 Unclassified 1467
35 Ga0070669_100378366 3300005353 Bacteria 1154
36 Ga0070675_100029413 3300005354 Bacteria 4431
37 Ga0070675_100154983 3300005354 Bacteria 1966
38 Ga0070671_100073637 3300005355 Bacteria 2853
39 Ga0070671_100236140 3300005355 Bacteria 1552
40 Ga0070671_100290019 3300005355 Bacteria 1392
41 Ga0070688_100160740 3300005365 Bacteria 1543
42 Ga0070659_100023248 3300005366 Bacteria 4741
43 Ga0070667_100044613 3300005367 Bacteria 3724
44 Ga0070667_100087465 3300005367 Bacteria 2675
45 Ga0070667_100729402 3300005367 Bacteria 918
46 Ga0070700_100212342 3300005441 Bacteria 1366
47 Ga0070663_100066019 3300005455 Bacteria 2621
48 Ga0070678_100364358 3300005456 Bacteria 1246
49 Ga0070681_10107427 3300005458 Bacteria 2731
50 Ga0068867_100371125 3300005459 Bacteria 1199
51 Ga0070679_100003316 3300005530 Bacteria 14753
52 Ga0070684_100384859 3300005535 Unclassified 1292
53 Ga0068853_100017299 3300005539 Bacteria 5952
54 Ga0070686_100350105 3300005544 Bacteria 1110
55 Ga0070693_100000650 3300005547 Bacteria 15328
56 Ga0070665_100000006 3300005548 Bacteria 718034
57 Ga0068855_100005029 3300005563 Bacteria 16134
58 Ga0068855_100021745 3300005563 Bacteria 7693
59 Ga0068855_100022488 3300005563 Bacteria 7555
60 Ga0068855_100268785 3300005563 Bacteria 1896
61 Ga0070664_100020776 3300005564 Bacteria 5409
62 Ga0070664_100459822 3300005564 Bacteria 1169
63 Ga0068857_100001316 3300005577 Bacteria 19543
64 Ga0068857_100430408 3300005577 Bacteria 1231
65 Ga0068854_100228082 3300005578 Bacteria 1477
66 Ga0068856_100050360 3300005614 Bacteria 4106
67 Ga0068856_100070615 3300005614 Bacteria 3455
68 Ga0068856_100097121 3300005614 Bacteria 2935
69 Ga0068856_100115232 3300005614 Bacteria 2687
70 Ga0068852_100000811 3300005616 Bacteria 20584
71 Ga0068852_100001166 3300005616 Bacteria 17391
72 Ga0068852_100009916 3300005616 Bacteria 7093
73 Ga0068852_100089660 3300005616 Bacteria 2749
74 Ga0068852_100568653 3300005616 Bacteria 1135
75 Ga0068852_100637843 3300005616 Bacteria 1072
76 Ga0068852_100670681 3300005616 Bacteria 1045
77 Ga0068859_100013654 3300005617 Bacteria 8143
78 Ga0068859_100067304 3300005617 Bacteria 3616
79 Ga0068859_100178142 3300005617 Bacteria 2208
80 Ga0068864_100009257 3300005618 Bacteria 8121
81 Ga0068864_100071098 3300005618 Bacteria 3029
82 Ga0068864_100207334 3300005618 Bacteria 1803
83 Ga0068864_100477920 3300005618 Unclassified 1196
84 Ga0068851_10012661 3300005834 Bacteria 3982
85 Ga0068851_10081459 3300005834 Bacteria 1691
86 Ga0068863_100005978 3300005841 Bacteria 11939
87 Ga0068863_100052271 3300005841 Bacteria 3872
88 Ga0068858_100046101 3300005842 Bacteria 4041
89 Ga0068860_100000005 3300005843 Bacteria 472349
90 Ga0068860_100002561 3300005843 Bacteria 19014
91 Ga0068860_100003920 3300005843 Bacteria 15287
92 Ga0068860_100027888 3300005843 Bacteria 5438
93 Ga0068860_100112440 3300005843 Bacteria 2604
94 Ga0068860_100451802 3300005843 Unclassified 1278
95 Ga0070716_100084569 3300006173 Bacteria 1903
96 Ga0075366_10008789 3300006195 Bacteria 5625
97 Ga0075366_10181895 3300006195 Bacteria 1277
98 Ga0097621_100002185 3300006237 Bacteria 13386
99 Ga0068871_100019766 3300006358 Bacteria 5146
100 Ga0075428_100080181 3300006844 Bacteria 3562
101 Ga0075430_100007454 3300006846 Bacteria 9235
102 Ga0075431_100055364 3300006847 Bacteria 4091
103 Ga0075429_100086160 3300006880 Bacteria 2738
104 Ga0097620_100013654 3300006931 Bacteria 8143
105 Ga0097620_100039542 3300006931 Bacteria 4732
106 Ga0097620_100067307 3300006931 Bacteria 3616
107 Ga0097620_100178146 3300006931 Bacteria 2208
108 Ga0105240_10001981 3300009093 Bacteria 33825
109 Ga0105240_10002364 3300009093 Bacteria 30415
110 Ga0105240_10008491 3300009093 Bacteria 14689
111 Ga0105240_10083819 3300009093 Bacteria 3910
112 Ga0105240_10186537 3300009093 Bacteria 2442
113 Ga0105240_10212651 3300009093 Bacteria 2258
114 Ga0105247_10022031 3300009101 Bacteria 3835
115 Ga0114129_10067557 3300009147 Bacteria 4985
116 Ga0105243_10105721 3300009148 Bacteria 2345
117 Ga0105241_10006161 3300009174 Bacteria 8845
118 Ga0105241_10009180 3300009174 Bacteria 7279
119 Ga0105241_10122505 3300009174 Bacteria 2096
120 Ga0105237_10002312 3300009545 Bacteria 23678
121 Ga0105237_10006705 3300009545 Bacteria 12727
122 Ga0105237_10011376 3300009545 Bacteria 9413
123 Ga0105237_10021911 3300009545 Bacteria 6562
124 Ga0105237_10103921 3300009545 Bacteria 2833
125 Ga0105237_10191041 3300009545 Bacteria 2048
126 Ga0105237_10387381 3300009545 Bacteria 1403
127 Ga0105237_10772888 3300009545 Bacteria 967
128 Ga0105249_10600628 3300009553 Bacteria 1155
129 Ga0105249_10850480 3300009553 Unclassified 978
130 Ga0105239_10006736 3300010375 Bacteria 13273
131 Ga0105239_10031088 3300010375 Bacteria 5874
132 Ga0105239_10243849 3300010375 Bacteria 2017
133 Ga0105239_10410474 3300010375 Bacteria 1533
134 Ga0105246_10062235 3300011119 Bacteria 2599
135 Ga0157373_10006957 3300013100 Bacteria 8423
136 Ga0157373_10137943 3300013100 Bacteria 1715
137 Ga0157371_10000242 3300013102 Bacteria 78183
138 Ga0157371_10007760 3300013102 Bacteria 8628
139 Ga0157371_10008547 3300013102 Bacteria 8147
140 Ga0157371_10033320 3300013102 Bacteria 3702
141 Ga0157371_10114507 3300013102 Bacteria 1915
142 Ga0157370_10007415 3300013104 Bacteria 11943
143 Ga0157370_10014024 3300013104 Bacteria 8228
144 Ga0157370_10062438 3300013104 Bacteria 3533
145 Ga0157370_10074087 3300013104 Bacteria 3212
146 Ga0157370_10156011 3300013104 Bacteria 2124
147 Ga0157369_10012301 3300013105 Bacteria 9720
148 Ga0157369_10036173 3300013105 Bacteria 5411
149 Ga0157369_10139752 3300013105 Bacteria 2563
150 Ga0157369_10224911 3300013105 Bacteria 1963
151 Ga0157369_10283965 3300013105 Unclassified 1724
152 Ga0157369_10556784 3300013105 Bacteria 1185
153 Ga0157374_10182361 3300013296 Bacteria 2051
154 Ga0157374_10300760 3300013296 Bacteria 1587
155 Ga0157378_10004167 3300013297 Bacteria 12765
156 Ga0157378_10044235 3300013297 Bacteria 3954
157 Ga0157378_10045074 3300013297 Bacteria 3918
158 Ga0157378_10072153 3300013297 Bacteria 3102
159 Ga0157378_10279820 3300013297 Bacteria 1608
160 Ga0157378_10436987 3300013297 Bacteria 1296
161 Ga0163162_10005547 3300013306 Bacteria 12200
162 Ga0163162_10031627 3300013306 Bacteria 5250
163 Ga0163162_10046772 3300013306 Bacteria 4338
164 Ga0163162_10229752 3300013306 Bacteria 1985
165 Ga0157372_10000052 3300013307 Bacteria 135497
166 Ga0157372_10000115 3300013307 Bacteria 84815
167 Ga0157372_10008424 3300013307 Bacteria 10946
168 Ga0157372_10011878 3300013307 Bacteria 9279
169 Ga0157372_10028489 3300013307 Bacteria 6095
170 Ga0157372_10045882 3300013307 Bacteria 4849
171 Ga0157372_10074816 3300013307 Bacteria 3820
172 Ga0157372_10081022 3300013307 Bacteria 3674
173 Ga0157372_10109475 3300013307 Bacteria 3164
174 Ga0157372_10115082 3300013307 Bacteria 3083
175 Ga0157372_10155631 3300013307 Bacteria 2640
176 Ga0157372_10422384 3300013307 Bacteria 1554
177 Ga0157372_10494999 3300013307 Bacteria 1425
178 Ga0157372_10581076 3300013307 Bacteria 1306
179 Ga0157372_10709006 3300013307 Bacteria 1171
180 Ga0157375_10192383 3300013308 Bacteria 2195
181 Ga0163163_10340249 3300014325 Bacteria 1555
182 Ga0163163_10394846 3300014325 Bacteria 1441
183 Ga0157380_10809862 3300014326 Bacteria 954
184 Ga0157379_10295979 3300014968 Bacteria 1474
185 Ga0157379_10475910 3300014968 Unclassified 1155
186 Ga0157376_10002899 3300014969 Bacteria 11760
187 Ga0182006_1000876 3300015261 Bacteria 20226
188 Ga0163161_10000905 3300017792 Bacteria 22916
189 Ga0213872_10011465 3300021361 Bacteria 4191
190 Ga0213876_10005187 3300021384 Bacteria 7187
191 Ga0209026_1000862 3300025250 Bacteria 15839
192 Ga0209233_1004147 3300025261 Bacteria 4986
193 Ga0207426_1000026 3300025302 Bacteria 515228
194 Ga0207697_10161336 3300025315 Bacteria 978
195 Ga0207656_10056065 3300025321 Bacteria 1717
196 Ga0207682_10117240 3300025893 Bacteria 1178
197 Ga0207710_10008199 3300025900 Bacteria 4410
198 Ga0207680_10000228 3300025903 Bacteria 27141
199 Ga0207647_10000480 3300025904 Bacteria 32267
200 Ga0207647_10007430 3300025904 Bacteria 7917
201 Ga0207647_10122070 3300025904 Bacteria 1536
202 Ga0207645_10022378 3300025907 Bacteria 4113
203 Ga0207645_10195536 3300025907 Bacteria 1329
204 Ga0207643_10134355 3300025908 Bacteria 1474
205 Ga0207705_10000015 3300025909 Bacteria 382901
206 Ga0207705_10004284 3300025909 Bacteria 10799
207 Ga0207654_10004675 3300025911 Bacteria 6924
208 Ga0207654_10017743 3300025911 Bacteria 3726
209 Ga0207654_10304322 3300025911 Bacteria 1085
210 Ga0207707_10000722 3300025912 Bacteria 32676
211 Ga0207707_10012266 3300025912 Bacteria 7450
212 Ga0207707_10087874 3300025912 Bacteria 2715
213 Ga0207695_10002702 3300025913 Bacteria 25862
214 Ga0207695_10023732 3300025913 Bacteria 6921
215 Ga0207695_10101098 3300025913 Bacteria 2878
216 Ga0207695_10186053 3300025913 Bacteria 1996
217 Ga0207671_10001247 3300025914 Bacteria 29996
218 Ga0207671_10001635 3300025914 Bacteria 25501
219 Ga0207671_10004787 3300025914 Bacteria 12757
220 Ga0207671_10006785 3300025914 Bacteria 10117
221 Ga0207671_10065245 3300025914 Bacteria 2707
222 Ga0207660_10004797 3300025917 Bacteria 8795
223 Ga0207660_10019465 3300025917 Bacteria 4538
224 Ga0207662_10135392 3300025918 Bacteria 1557
225 Ga0207657_10198998 3300025919 Bacteria 1613
226 Ga0207657_10210605 3300025919 Bacteria 1560
227 Ga0207657_10280592 3300025919 Bacteria 1323
228 Ga0207657_10371862 3300025919 Bacteria 1126
229 Ga0207652_10001022 3300025921 Bacteria 25679
230 Ga0207652_10006617 3300025921 Bacteria 9340
231 Ga0207694_10050498 3300025924 Bacteria 3221
232 Ga0207650_10110269 3300025925 Unclassified 2129
233 Ga0207650_10157283 3300025925 Bacteria 1798
234 Ga0207650_10266897 3300025925 Bacteria 1390
235 Ga0207644_10087314 3300025931 Bacteria 2318
236 Ga0207644_10217730 3300025931 Bacteria 1512
237 Ga0207690_10008826 3300025932 Bacteria 5981
238 Ga0207690_10030335 3300025932 Bacteria 3448
239 Ga0207709_10141262 3300025935 Unclassified 1655
240 Ga0207670_10340712 3300025936 Bacteria 1185
241 Ga0207669_10003972 3300025937 Bacteria 6459
242 Ga0207691_10021466 3300025940 Bacteria 6096
243 Ga0207691_10037667 3300025940 Bacteria 4477
244 Ga0207691_10160726 3300025940 Bacteria 1971
245 Ga0207691_10221128 3300025940 Bacteria 1642
246 Ga0207711_10000028 3300025941 Bacteria 214107
247 Ga0207689_10009695 3300025942 Bacteria 8295
248 Ga0207689_10078572 3300025942 Bacteria 2712
249 Ga0207661_10156025 3300025944 Bacteria 1977
250 Ga0207661_10220451 3300025944 Bacteria 1676
251 Ga0207679_10021840 3300025945 Bacteria 4347
252 Ga0207679_10121644 3300025945 Bacteria 2079
253 Ga0207679_10162180 3300025945 Bacteria 1831
254 Ga0207679_10373854 3300025945 Bacteria 1248
255 Ga0207667_10000009 3300025949 Bacteria 603135
256 Ga0207667_10001800 3300025949 Bacteria 27004
257 Ga0207667_10002024 3300025949 Bacteria 25418
258 Ga0207667_10011416 3300025949 Bacteria 10326
259 Ga0207667_10040996 3300025949 Bacteria 4927
260 Ga0207667_10160636 3300025949 Bacteria 2311
261 Ga0207651_10324120 3300025960 Bacteria 1289
262 Ga0207712_10009009 3300025961 Bacteria 6313
263 Ga0207712_10016687 3300025961 Bacteria 4759
264 Ga0207640_10084794 3300025981 Bacteria 2176
265 Ga0207640_10317146 3300025981 Bacteria 1239
266 Ga0207658_10064798 3300025986 Unclassified 2742
267 Ga0207658_10102615 3300025986 Bacteria 2244
268 Ga0207677_10494537 3300026023 Bacteria 1056
269 Ga0207703_10004767 3300026035 Bacteria 11059
270 Ga0207639_10029149 3300026041 Bacteria 4038
271 Ga0207639_10032202 3300026041 Bacteria 3858
272 Ga0207639_10464122 3300026041 Bacteria 1152
273 Ga0207678_10029748 3300026067 Bacteria 4769
274 Ga0207678_10341038 3300026067 Bacteria 1291
275 Ga0207708_10311876 3300026075 Bacteria 1282
276 Ga0207702_10058064 3300026078 Bacteria 3292
277 Ga0207702_10075338 3300026078 Bacteria 2915
278 Ga0207702_10356659 3300026078 Bacteria 1401
279 Ga0207641_10000158 3300026088 Bacteria 96378
280 Ga0207641_10006686 3300026088 Bacteria 9667
281 Ga0207641_10336642 3300026088 Bacteria 1435
282 Ga0207648_10001073 3300026089 Bacteria 30612
283 Ga0207676_10004127 3300026095 Bacteria 10254
284 Ga0207676_10054313 3300026095 Bacteria 3139
285 Ga0207676_10150795 3300026095 Bacteria 2002
286 Ga0207676_10207452 3300026095 Unclassified 1736
287 Ga0207674_10070485 3300026116 Bacteria 3515
288 Ga0207674_10162918 3300026116 Bacteria 2184
289 Ga0207675_100054038 3300026118 Bacteria 3747
290 Ga0207683_10042793 3300026121 Bacteria 3956
291 Ga0207698_10001170 3300026142 Bacteria 15290
292 Ga0207698_10001210 3300026142 Bacteria 15065
293 Ga0207698_10008221 3300026142 Bacteria 6582
294 Ga0207698_10049231 3300026142 Bacteria 3206
295 Ga0207698_10056355 3300026142 Bacteria 3034
296 Ga0207698_10166184 3300026142 Bacteria 1937
297 Ga0207698_10369743 3300026142 Bacteria 1360
298 Ga0207698_10805741 3300026142 Bacteria 942
299 Ga0209281_1008337 3300027111 Bacteria 2524
300 Ga0268266_10000010 3300028379 Bacteria 1030233
301 Ga0268265_10819947 3300028380 Unclassified 908
302 Ga0268264_10000012 3300028381 Bacteria 521740
303 Ga0268264_10005689 3300028381 Bacteria 10570
304 Ga0268264_10009194 3300028381 Bacteria 8187
305 Ga0268264_10031602 3300028381 Bacteria 4340
306 Ga0268264_10136542 3300028381 Bacteria 2181
307 Ga0307515_10000859 3300028794 Bacteria 69963
308 Ga0307515_10001136 3300028794 Bacteria 61007
309 Ga0265338_10029068 3300028800 Bacteria 5493
310 Ga0307511_10000850 3300030521 Bacteria 32503
311 Ga0265327_10000488 3300031251 Bacteria 69809
312 Ga0265327_10016774 3300031251 Bacteria 4629
313 Ga0265327_10169658 3300031251 Bacteria 1003
314 Ga0307513_10248806 3300031456 Unclassified 1576
315 Ga0307509_10037320 3300031507 Bacteria 5313
316 Ga0307408_100001972 3300031548 Bacteria 14821
317 Ga0307508_10001227 3300031616 Bacteria 29288
318 Ga0307412_10088207 3300031911 Bacteria 2163
319 Ga0307409_100120140 3300031995 Bacteria 2224
320 Ga0307416_100178995 3300032002 Bacteria 1985
321 Ga0307414_10158090 3300032004 Bacteria 1797
322 Ga0307415_100041291 3300032126 Bacteria 3062
323 Ga0316585_10028486 3300032137 Bacteria 1747
324 Ga0316580_10009432 3300032139 Bacteria 2934
325 Ga0307507_10020463 3300033179 Bacteria 7406
326 Ga0307510_10007660 3300033180 Bacteria 12874
327 Ga0373935_0136215 3300035692 Bacteria 1654
328 Ga0395899_0033581 3300037312 Bacteria 3852
329 Ga0395899_0093740 3300037312 Bacteria 2173
330 Ga0395899_0171142 3300037312 Bacteria 1529
331 Ga0395899_0265766 3300037312 Bacteria 1172
332 Ga0395900_0029481 3300037418 Bacteria 5628
333 Ga0395900_0077503 3300037418 Bacteria 3414
334 Ga0395900_0113365 3300037418 Bacteria 2783
335 Ga0395900_0275726 3300037418 Bacteria 1675
336 Ga0395900_0350884 3300037418 Unclassified 1449
337 Ga0395900_0400524 3300037418 Bacteria 1337
338 Ga0395898_0010470 3300037466 Bacteria 9694
339 Ga0395898_0068906 3300037466 Bacteria 3423
340 Ga0395898_0122628 3300037466 Unclassified 2490
341 Ga0395898_0154876 3300037466 Bacteria 2192
342 Ga0395905_0044479 3300037471 Bacteria 4168
343 Ga0395905_0082438 3300037471 Bacteria 3013
344 Ga0395905_0265783 3300037471 Bacteria 1601
345 Ga0395901_0071323 3300038443 Bacteria 3620
346 Ga0395901_0081828 3300038443 Bacteria 3373
347 Ga0395901_0741369 3300038443 Bacteria 976
348 Ga0436365_1251897 3300039437 Bacteria 24739
349 Ga0436365_1501550 3300039437 Unclassified 2102
350 Ga0436361_0544688 3300039447 Bacteria 4916
351 Ga0439436_0007176 3300041404 Bacteria 3429
352 Ga0439439_0000685 3300041406 Bacteria 5987
353 Ga0439466_0040771 3300041411 Bacteria 1552
354 Ga0451855_0034114 3300041511 Bacteria 3113
355 Ga0439433_0003295 3300041999 Bacteria 3460
356 Ga0439445_0053759 3300042004 Bacteria 1091
357 Ga0439449_0004582 3300042007 Bacteria 5343
358 Ga0439449_0004763 3300042007 Bacteria 5237
359 Ga0439449_0038234 3300042007 Bacteria 1785
360 Ga0439457_015664 3300042014 Bacteria 1692
361 Ga0439457_028009 3300042014 Bacteria 1247
362 Ga0439462_0001585 3300042015 Bacteria 5106
363 Ga0439462_0035363 3300042015 Bacteria 1328
364 Ga0439434_0023737 3300042435 Bacteria 1847
365 Ga0439434_0056571 3300042435 Bacteria 1222
366 Ga0451577_0010712 3300042876 Bacteria 8730
367 Ga0451577_0056136 3300042876 Bacteria 3512
368 Ga0451577_0140651 3300042876 Bacteria 2169
369 Ga0451577_0592703 3300042876 Bacteria 1006
370 Ga0453683_0007933 3300044673 Bacteria 7155
371 Ga0453683_0079499 3300044673 Bacteria 2053
372 Ga0453684_0000191 3300044712 Bacteria 267816
373 Ga0453684_0001431 3300044712 Bacteria 68233
374 Ga0453684_0125115 3300044712 Bacteria 3096
375 Ga0451576_0003347 3300045051 Bacteria 22204
376 Ga0451576_0004911 3300045051 Bacteria 17059
377 Ga0495638_0059936 3300046460 Bacteria 2355
378 Ga0495638_0161133 3300046460 Bacteria 1294
379 Ga0495651_0318377 3300046462 Bacteria 1038
380 Ga0495650_0000025 3300046471 Bacteria 486001
381 Ga0495585_0000290 3300046492 Bacteria 50496
382 Ga0495585_0000980 3300046492 Bacteria 23938
383 Ga0495585_0273334 3300046492 Bacteria 837
384 Ga0495606_0000035 3300046507 Bacteria 243820
385 Ga0495606_0010337 3300046507 Bacteria 7761
386 Ga0495606_0057220 3300046507 Bacteria 2512
387 Ga0495610_0001310 3300046512 Bacteria 22164
388 Ga0495610_0014425 3300046512 Bacteria 4641
389 Ga0495616_0012017 3300046513 Bacteria 4930
390 Ga0495637_0022925 3300046520 Bacteria 2842
391 Ga0495652_0139161 3300046529 Bacteria 1911
392 Ga0495652_0231095 3300046529 Bacteria 1383
393 Ga0495652_0562010 3300046529 Bacteria 783
394 Ga0495654_0031871 3300046530 Bacteria 2675
395 Ga0495654_0078093 3300046530 Bacteria 1557
396 Ga0495609_0010365 3300046538 Bacteria 4473
397 Ga0495609_0090612 3300046538 Bacteria 1330
398 Ga0495633_0000172 3300046558 Bacteria 84811
399 Ga0495633_0031931 3300046558 Bacteria 2547
400 Ga0495668_0000069 3300046616 Bacteria 174287
401 Ga0495668_0128064 3300046616 Bacteria 1390
402 Ga0495625_0000063 3300046660 Bacteria 176435
403 Ga0495625_0000385 3300046660 Bacteria 67419
404 Ga0495625_0000419 3300046660 Bacteria 63844
405 Ga0495661_0004990 3300046665 Bacteria 9477
406 Ga0495661_0040839 3300046665 Bacteria 2874
407 Ga0495658_0060081 3300046683 Bacteria 2179
408 Ga0495649_0000006 3300046694 Bacteria 542188
409 Ga0495672_0005283 3300047320 Bacteria 10282
410 Ga0495687_000243 3300047443 Bacteria 75026
411 Ga0495687_001958 3300047443 Bacteria 17588
412 Ga0495614_0067849 3300048089 Bacteria 1535
413 Ga0496114_0265998 3300048917 Unclassified 1511
414 Ga0496115_0164960 3300048918 Bacteria 1832
415 Ga0496123_0022358 3300048926 Bacteria 4875
416 Ga0496124_0003190 3300048927 Bacteria 20256
417 Ga0496124_0014329 3300048927 Bacteria 7669
418 Ga0496125_0004037 3300048928 Bacteria 17207
419 Ga0496126_0000153 3300048929 Bacteria 160642
420 Ga0501291_010833 3300049514 Unclassified 1304
421 Ga0501033_0042980 3300049570 Bacteria 3367
422 Ga0501033_0389698 3300049570 Unclassified 973
423 Ga0501034_0005663 3300049571 Bacteria 13592
424 Ga0501034_0016302 3300049571 Bacteria 7628
425 Ga0501034_0063913 3300049571 Unclassified 3694
426 Ga0501034_0300693 3300049571 Bacteria 1541
427 Ga0501036_0141203 3300049572 Bacteria 2032
428 Ga0501038_0055888 3300049574 Bacteria 3390
429 Ga0501039_0032992 3300049575 Bacteria 3994
430 Ga0501043_0003830 3300049579 Bacteria 12375
431 Ga0501046_0006720 3300049580 Bacteria 10156
432 Ga0501047_0010701 3300049581 Bacteria 8669
433 Ga0501070_0041260 3300049586 Bacteria 3845
434 Ga0501070_0427560 3300049586 Unclassified 1069
435 Ga0501073_0002013 3300049589 Bacteria 15173
436 Ga0501074_0002600 3300049590 Bacteria 12616
437 Ga0501202_029400 3300049652 Bacteria 1139
438 Ga0501223_002156 3300049663 Bacteria 4411
439 Ga0501233_006755 3300049668 Bacteria 2165
440 Ga0501235_028660 3300049669 Bacteria 1251
441 Ga0501240_009402 3300049673 Bacteria 1275
442 Ga0501243_004172 3300049675 Bacteria 2162
443 Ga0501243_008698 3300049675 Bacteria 1569
444 Ga0501225_0042448 3300049705 Bacteria 1256
445 Ga0501080_0018745 3300049742 Bacteria 6404
446 Ga0501080_0181426 3300049742 Bacteria 1937
447 Ga0501083_0012750 3300049744 Bacteria 5878
448 Ga0501035_0049062 3300049822 Bacteria 3784
449 Ga0501035_0079018 3300049822 Bacteria 2906
450 Ga0501044_0045316 3300049823 Bacteria 4557
451 Ga0501044_0251411 3300049823 Bacteria 1708
452 nmdc:mga0k408_190_c1 3300050493 Bacteria 31887
453 nmdc:mga0qj67_44943_c1 3300050509 Bacteria 3484
454 nmdc:mga06r32_117938_c1 3300050510 Bacteria 2616
455 Ga0500647_0124805 3300053091 Bacteria 1217
456 Ga0500583_0015747 3300053092 Unclassified 3001
457 Ga0500562_000047 3300053108 Bacteria 62430
458 Ga0500618_000001 3300053125 Bacteria 538477
459 Ga0500618_020344 3300053125 Bacteria 1626
460 Ga0500642_0010291 3300053130 Unclassified 3292
461 Ga0500616_0009931 3300053153 Bacteria 5729
462 Ga0500619_144813 3300053154 Bacteria 809
463 Ga0500622_0012858 3300053156 Bacteria 4523
464 Ga0500622_0049166 3300053156 Bacteria 2175
465 Ga0500645_017016 3300053730 Bacteria 2284
466 Ga0501082_0077751 3300060353 Bacteria 2861

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10156011 Ga0157370_101560112 232
2 3300013105 Ga0157369_10139752 Ga0157369_101397522 232
3 3300013307 Ga0157372_10011878 Ga0157372_100118785 232
4 3300046462 Ga0495651_0318377 Ga0495651_0318377_72_770 232
5 3300046492 Ga0495585_0000290 Ga0495585_0000290_34727_35425 232
6 3300046492 Ga0495585_0273334 Ga0495585_0273334_87_785 232
7 3300046520 Ga0495637_0022925 Ga0495637_0022925_760_1458 232
8 3300046529 Ga0495652_0139161 Ga0495652_0139161_93_791 232
9 3300046529 Ga0495652_0562010 Ga0495652_0562010_13_711 232
10 3300046538 Ga0495609_0090612 Ga0495609_0090612_21_719 232
11 3300053091 Ga0500647_0124805 Ga0500647_0124805_369_1067 232
12 3300053154 Ga0500619_144813 Ga0500619_144813_91_789 232
13 3300046507 Ga0495606_0010337 Ga0495606_0010337_3172_3927 251
14 3300005355 Ga0070671_100073637 Ga0070671_1000736371 252
15 3300021361 Ga0213872_10011465 Ga0213872_100114654 252
16 3300046558 Ga0495633_0000172 Ga0495633_0000172_48635_49393 252
17 3300046660 Ga0495625_0000385 Ga0495625_0000385_65410_66168 252
18 3300050493 nmdc:mga0k408_190_c1 nmdc:mga0k408_190_c1_28272_29030 252
19 3300042876 Ga0451577_0592703 Ga0451577_0592703_213_986 257
20 3300005614 Ga0068856_100070615 Ga0068856_1000706153 258
21 3300026078 Ga0207702_10075338 Ga0207702_100753381 258
22 3300005334 Ga0068869_100094402 Ga0068869_1000944022 262
23 3300006195 Ga0075366_10181895 Ga0075366_101818951 262
24 3300009148 Ga0105243_10105721 Ga0105243_101057212 262
25 3300026089 Ga0207648_10001073 Ga0207648_1000107318 262
26 3300039437 Ga0436365_1251897 Ga0436365_1251897_18236_19024 262
27 3300053125 Ga0500618_000001 Ga0500618_000001_482995_483798 267
28 3300013297 Ga0157378_10004167 Ga0157378_1000416714 270
29 3300013307 Ga0157372_10422384 Ga0157372_104223842 271
30 iso_pu_bacteria 2599185184 2599480322 272
31 iso_pu_bacteria 2738541273 2738700822 272
32 iso_pu_bacteria 2738543014 2739254571 272
33 iso_pu_bacteria 2791355222 2793182853 272
34 iso_pu_bacteria 2818991444 2819586664 272
35 iso_pu_bacteria 2904113452 2904119639 272
36 iso_pu_bacteria 2910245624 2910246141 272
37 iso_pu_bacteria 2914759650 2914760424 272
38 iso_pu_bacteria 2928078545 2928083427 272
39 iso_pu_bacteria 2928147474 2928151309 272
40 iso_pu_bacteria 2932082852 2932084610 272
41 iso_pu_bacteria 2842682962 2842687151 274
42 3300001904 JGI24736J21556_1017597 JGI24736J21556_10175972 276
43 3300001989 JGI24739J22299_10013373 JGI24739J22299_100133732 276
44 3300001990 JGI24737J22298_10005749 JGI24737J22298_100057492 276
45 3300002067 JGI24735J21928_10000013 JGI24735J21928_1000001355 276
46 3300003316 rootH1_10001050 rootH1_100010502 276
47 3300003322 rootL2_10032000 rootL2_100320006 276
48 3300003322 rootL2_10146929 rootL2_101469292 276
49 3300003323 rootH1_10024035 rootH1_100240354 276
50 3300003323 rootH1_10197073 rootH1_101970734 276
51 3300003354 JGI25160J50197_1000376 JGI25160J50197_100037613 276
52 3300005288 Ga0065714_10069557 Ga0065714_100695572 276
53 3300005289 Ga0065704_10164208 Ga0065704_101642082 276
54 3300005327 Ga0070658_10058950 Ga0070658_100589502 276
55 3300005327 Ga0070658_10089536 Ga0070658_100895362 276
56 3300005327 Ga0070658_10237411 Ga0070658_102374112 276
57 3300005329 Ga0070683_100034695 Ga0070683_1000346951 276
58 3300005330 Ga0070690_100260562 Ga0070690_1002605621 276
59 3300005331 Ga0070670_100032693 Ga0070670_1000326932 276
60 3300005331 Ga0070670_100275341 Ga0070670_1002753412 276
61 3300005334 Ga0068869_100007354 Ga0068869_1000073543 276
62 3300005334 Ga0068869_100272450 Ga0068869_1002724501 276
63 3300005335 Ga0070666_10000042 Ga0070666_10000042103 276
64 3300005336 Ga0070680_100000878 Ga0070680_10000087812 276
65 3300005336 Ga0070680_100027359 Ga0070680_1000273592 276
66 3300005337 Ga0070682_100001122 Ga0070682_10000112211 276
67 3300005338 Ga0068868_100004734 Ga0068868_1000047342 276
68 3300005338 Ga0068868_100271537 Ga0068868_1002715371 276
69 3300005339 Ga0070660_100079286 Ga0070660_1000792862 276
70 3300005339 Ga0070660_100168873 Ga0070660_1001688732 276
71 3300005341 Ga0070691_10055513 Ga0070691_100555132 276
72 3300005344 Ga0070661_100028849 Ga0070661_1000288493 276
73 3300005345 Ga0070692_10119637 Ga0070692_101196372 276
74 3300005353 Ga0070669_100378366 Ga0070669_1003783661 276
75 3300005354 Ga0070675_100029413 Ga0070675_1000294133 276
76 3300005354 Ga0070675_100154983 Ga0070675_1001549832 276
77 3300005355 Ga0070671_100236140 Ga0070671_1002361401 276
78 3300005355 Ga0070671_100290019 Ga0070671_1002900191 276
79 3300005365 Ga0070688_100160740 Ga0070688_1001607402 276
80 3300005366 Ga0070659_100023248 Ga0070659_1000232485 276
81 3300005367 Ga0070667_100044613 Ga0070667_1000446134 276
82 3300005367 Ga0070667_100087465 Ga0070667_1000874652 276
83 3300005367 Ga0070667_100729402 Ga0070667_1007294021 276
84 3300005441 Ga0070700_100212342 Ga0070700_1002123421 276
85 3300005455 Ga0070663_100066019 Ga0070663_1000660192 276
86 3300005456 Ga0070678_100364358 Ga0070678_1003643582 276
87 3300005458 Ga0070681_10107427 Ga0070681_101074272 276
88 3300005459 Ga0068867_100371125 Ga0068867_1003711252 276
89 3300005530 Ga0070679_100003316 Ga0070679_1000033167 276
90 3300005535 Ga0070684_100384859 Ga0070684_1003848592 276
91 3300005539 Ga0068853_100017299 Ga0068853_1000172994 276
92 3300005544 Ga0070686_100350105 Ga0070686_1003501052 276
93 3300005547 Ga0070693_100000650 Ga0070693_10000065010 276
94 3300005548 Ga0070665_100000006 Ga0070665_100000006115 276
95 3300005563 Ga0068855_100005029 Ga0068855_1000050295 276
96 3300005563 Ga0068855_100021745 Ga0068855_1000217452 276
97 3300005563 Ga0068855_100022488 Ga0068855_1000224884 276
98 3300005563 Ga0068855_100268785 Ga0068855_1002687853 276
99 3300005564 Ga0070664_100020776 Ga0070664_1000207763 276
100 3300005564 Ga0070664_100459822 Ga0070664_1004598222 276
101 3300005577 Ga0068857_100001316 Ga0068857_10000131614 276
102 3300005577 Ga0068857_100430408 Ga0068857_1004304081 276
103 3300005578 Ga0068854_100228082 Ga0068854_1002280822 276
104 3300005614 Ga0068856_100050360 Ga0068856_1000503603 276
105 3300005614 Ga0068856_100097121 Ga0068856_1000971213 276
106 3300005614 Ga0068856_100115232 Ga0068856_1001152321 276
107 3300005616 Ga0068852_100000811 Ga0068852_10000081112 276
108 3300005616 Ga0068852_100001166 Ga0068852_1000011668 276
109 3300005616 Ga0068852_100009916 Ga0068852_1000099165 276
110 3300005616 Ga0068852_100089660 Ga0068852_1000896603 276
111 3300005616 Ga0068852_100568653 Ga0068852_1005686531 276
112 3300005616 Ga0068852_100637843 Ga0068852_1006378431 276
113 3300005616 Ga0068852_100670681 Ga0068852_1006706812 276
114 3300005617 Ga0068859_100013654 Ga0068859_1000136542 276
115 3300005617 Ga0068859_100067304 Ga0068859_1000673041 276
116 3300005617 Ga0068859_100178142 Ga0068859_1001781422 276
117 3300005618 Ga0068864_100009257 Ga0068864_1000092574 276
118 3300005618 Ga0068864_100071098 Ga0068864_1000710982 276
119 3300005618 Ga0068864_100207334 Ga0068864_1002073342 276
120 3300005618 Ga0068864_100477920 Ga0068864_1004779201 276
121 3300005834 Ga0068851_10012661 Ga0068851_100126613 276
122 3300005834 Ga0068851_10081459 Ga0068851_100814592 276
123 3300005841 Ga0068863_100005978 Ga0068863_1000059782 276
124 3300005841 Ga0068863_100052271 Ga0068863_1000522715 276
125 3300005842 Ga0068858_100046101 Ga0068858_1000461012 276
126 3300005843 Ga0068860_100000005 Ga0068860_10000000557 276
127 3300005843 Ga0068860_100002561 Ga0068860_1000025617 276
128 3300005843 Ga0068860_100003920 Ga0068860_1000039208 276
129 3300005843 Ga0068860_100027888 Ga0068860_1000278882 276
130 3300005843 Ga0068860_100112440 Ga0068860_1001124402 276
131 3300005843 Ga0068860_100451802 Ga0068860_1004518022 276
132 3300006173 Ga0070716_100084569 Ga0070716_1000845694 276
133 3300006195 Ga0075366_10008789 Ga0075366_100087895 276
134 3300006237 Ga0097621_100002185 Ga0097621_1000021853 276
135 3300006358 Ga0068871_100019766 Ga0068871_1000197663 276
136 3300006844 Ga0075428_100080181 Ga0075428_1000801814 276
137 3300006846 Ga0075430_100007454 Ga0075430_1000074542 276
138 3300006847 Ga0075431_100055364 Ga0075431_1000553644 276
139 3300006880 Ga0075429_100086160 Ga0075429_1000861602 276
140 3300006931 Ga0097620_100013654 Ga0097620_1000136542 276
141 3300006931 Ga0097620_100039542 Ga0097620_1000395425 276
142 3300006931 Ga0097620_100067307 Ga0097620_1000673071 276
143 3300006931 Ga0097620_100178146 Ga0097620_1001781462 276
144 3300009093 Ga0105240_10001981 Ga0105240_1000198110 276
145 3300009093 Ga0105240_10002364 Ga0105240_1000236415 276
146 3300009093 Ga0105240_10008491 Ga0105240_1000849113 276
147 3300009093 Ga0105240_10083819 Ga0105240_100838193 276
148 3300009093 Ga0105240_10186537 Ga0105240_101865373 276
149 3300009093 Ga0105240_10212651 Ga0105240_102126514 276
150 3300009101 Ga0105247_10022031 Ga0105247_100220313 276
151 3300009147 Ga0114129_10067557 Ga0114129_100675573 276
152 3300009174 Ga0105241_10006161 Ga0105241_100061613 276
153 3300009174 Ga0105241_10009180 Ga0105241_100091803 276
154 3300009174 Ga0105241_10122505 Ga0105241_101225053 276
155 3300009545 Ga0105237_10002312 Ga0105237_1000231215 276
156 3300009545 Ga0105237_10006705 Ga0105237_100067052 276
157 3300009545 Ga0105237_10011376 Ga0105237_100113763 276
158 3300009545 Ga0105237_10021911 Ga0105237_100219116 276
159 3300009545 Ga0105237_10103921 Ga0105237_101039212 276
160 3300009545 Ga0105237_10191041 Ga0105237_101910413 276
161 3300009545 Ga0105237_10387381 Ga0105237_103873812 276
162 3300009545 Ga0105237_10772888 Ga0105237_107728881 276
163 3300009553 Ga0105249_10600628 Ga0105249_106006281 276
164 3300009553 Ga0105249_10850480 Ga0105249_108504801 276
165 3300010375 Ga0105239_10006736 Ga0105239_100067364 276
166 3300010375 Ga0105239_10031088 Ga0105239_100310884 276
167 3300010375 Ga0105239_10243849 Ga0105239_102438492 276
168 3300010375 Ga0105239_10410474 Ga0105239_104104742 276
169 3300011119 Ga0105246_10062235 Ga0105246_100622352 276
170 3300013100 Ga0157373_10006957 Ga0157373_100069573 276
171 3300013100 Ga0157373_10137943 Ga0157373_101379431 276
172 3300013102 Ga0157371_10000242 Ga0157371_100002429 276
173 3300013102 Ga0157371_10007760 Ga0157371_100077602 276
174 3300013102 Ga0157371_10008547 Ga0157371_100085477 276
175 3300013102 Ga0157371_10033320 Ga0157371_100333203 276
176 3300013102 Ga0157371_10114507 Ga0157371_101145072 276
177 3300013104 Ga0157370_10007415 Ga0157370_100074154 276
178 3300013104 Ga0157370_10014024 Ga0157370_100140243 276
179 3300013104 Ga0157370_10062438 Ga0157370_100624382 276
180 3300013104 Ga0157370_10074087 Ga0157370_100740874 276
181 3300013105 Ga0157369_10012301 Ga0157369_100123019 276
182 3300013105 Ga0157369_10036173 Ga0157369_100361733 276
183 3300013105 Ga0157369_10224911 Ga0157369_102249112 276
184 3300013105 Ga0157369_10283965 Ga0157369_102839652 276
185 3300013105 Ga0157369_10556784 Ga0157369_105567842 276
186 3300013296 Ga0157374_10182361 Ga0157374_101823613 276
187 3300013296 Ga0157374_10300760 Ga0157374_103007602 276
188 3300013297 Ga0157378_10044235 Ga0157378_100442352 276
189 3300013297 Ga0157378_10045074 Ga0157378_100450743 276
190 3300013297 Ga0157378_10072153 Ga0157378_100721531 276
191 3300013297 Ga0157378_10279820 Ga0157378_102798202 276
192 3300013297 Ga0157378_10436987 Ga0157378_104369872 276
193 3300013306 Ga0163162_10005547 Ga0163162_100055472 276
194 3300013306 Ga0163162_10031627 Ga0163162_100316272 276
195 3300013306 Ga0163162_10046772 Ga0163162_100467722 276
196 3300013306 Ga0163162_10229752 Ga0163162_102297521 276
197 3300013307 Ga0157372_10000052 Ga0157372_1000005241 276
198 3300013307 Ga0157372_10000115 Ga0157372_1000011542 276
199 3300013307 Ga0157372_10008424 Ga0157372_100084247 276
200 3300013307 Ga0157372_10028489 Ga0157372_100284892 276
201 3300013307 Ga0157372_10045882 Ga0157372_100458825 276
202 3300013307 Ga0157372_10074816 Ga0157372_100748162 276
203 3300013307 Ga0157372_10081022 Ga0157372_100810223 276
204 3300013307 Ga0157372_10109475 Ga0157372_101094752 276
205 3300013307 Ga0157372_10115082 Ga0157372_101150823 276
206 3300013307 Ga0157372_10155631 Ga0157372_101556313 276
207 3300013307 Ga0157372_10494999 Ga0157372_104949992 276
208 3300013307 Ga0157372_10581076 Ga0157372_105810762 276
209 3300013307 Ga0157372_10709006 Ga0157372_107090062 276
210 3300013308 Ga0157375_10192383 Ga0157375_101923832 276
211 3300014325 Ga0163163_10340249 Ga0163163_103402491 276
212 3300014325 Ga0163163_10394846 Ga0163163_103948462 276
213 3300014326 Ga0157380_10809862 Ga0157380_108098621 276
214 3300014968 Ga0157379_10295979 Ga0157379_102959792 276
215 3300014968 Ga0157379_10475910 Ga0157379_104759101 276
216 3300014969 Ga0157376_10002899 Ga0157376_100028991 276
217 3300015261 Ga0182006_1000876 Ga0182006_100087613 276
218 3300017792 Ga0163161_10000905 Ga0163161_100009056 276
219 3300021384 Ga0213876_10005187 Ga0213876_100051873 276
220 3300025250 Ga0209026_1000862 Ga0209026_100086210 276
221 3300025261 Ga0209233_1004147 Ga0209233_10041472 276
222 3300025302 Ga0207426_1000026 Ga0207426_1000026437 276
223 3300025315 Ga0207697_10161336 Ga0207697_101613361 276
224 3300025321 Ga0207656_10056065 Ga0207656_100560651 276
225 3300025893 Ga0207682_10117240 Ga0207682_101172402 276
226 3300025900 Ga0207710_10008199 Ga0207710_100081992 276
227 3300025903 Ga0207680_10000228 Ga0207680_1000022825 276
228 3300025904 Ga0207647_10000480 Ga0207647_1000048021 276
229 3300025904 Ga0207647_10007430 Ga0207647_100074307 276
230 3300025904 Ga0207647_10122070 Ga0207647_101220702 276
231 3300025907 Ga0207645_10022378 Ga0207645_100223782 276
232 3300025907 Ga0207645_10195536 Ga0207645_101955362 276
233 3300025908 Ga0207643_10134355 Ga0207643_101343552 276
234 3300025909 Ga0207705_10000015 Ga0207705_10000015159 276
235 3300025909 Ga0207705_10004284 Ga0207705_100042843 276
236 3300025911 Ga0207654_10004675 Ga0207654_100046755 276
237 3300025911 Ga0207654_10017743 Ga0207654_100177433 276
238 3300025911 Ga0207654_10304322 Ga0207654_103043221 276
239 3300025912 Ga0207707_10000722 Ga0207707_1000072214 276
240 3300025912 Ga0207707_10012266 Ga0207707_100122665 276
241 3300025912 Ga0207707_10087874 Ga0207707_100878742 276
242 3300025913 Ga0207695_10002702 Ga0207695_1000270217 276
243 3300025913 Ga0207695_10023732 Ga0207695_100237322 276
244 3300025913 Ga0207695_10101098 Ga0207695_101010982 276
245 3300025913 Ga0207695_10186053 Ga0207695_101860531 276
246 3300025914 Ga0207671_10001247 Ga0207671_1000124716 276
247 3300025914 Ga0207671_10001635 Ga0207671_100016353 276
248 3300025914 Ga0207671_10004787 Ga0207671_1000478713 276
249 3300025914 Ga0207671_10006785 Ga0207671_100067852 276
250 3300025914 Ga0207671_10065245 Ga0207671_100652452 276
251 3300025917 Ga0207660_10004797 Ga0207660_100047973 276
252 3300025917 Ga0207660_10019465 Ga0207660_100194654 276
253 3300025918 Ga0207662_10135392 Ga0207662_101353922 276
254 3300025919 Ga0207657_10198998 Ga0207657_101989981 276
255 3300025919 Ga0207657_10210605 Ga0207657_102106051 276
256 3300025919 Ga0207657_10280592 Ga0207657_102805921 276
257 3300025919 Ga0207657_10371862 Ga0207657_103718622 276
258 3300025921 Ga0207652_10001022 Ga0207652_100010229 276
259 3300025921 Ga0207652_10006617 Ga0207652_100066177 276
260 3300025924 Ga0207694_10050498 Ga0207694_100504983 276
261 3300025925 Ga0207650_10110269 Ga0207650_101102691 276
262 3300025925 Ga0207650_10157283 Ga0207650_101572832 276
263 3300025925 Ga0207650_10266897 Ga0207650_102668972 276
264 3300025931 Ga0207644_10087314 Ga0207644_100873141 276
265 3300025931 Ga0207644_10217730 Ga0207644_102177302 276
266 3300025932 Ga0207690_10008826 Ga0207690_100088263 276
267 3300025932 Ga0207690_10030335 Ga0207690_100303352 276
268 3300025935 Ga0207709_10141262 Ga0207709_101412622 276
269 3300025936 Ga0207670_10340712 Ga0207670_103407121 276
270 3300025937 Ga0207669_10003972 Ga0207669_100039722 276
271 3300025940 Ga0207691_10021466 Ga0207691_100214665 276
272 3300025940 Ga0207691_10037667 Ga0207691_100376675 276
273 3300025940 Ga0207691_10160726 Ga0207691_101607262 276
274 3300025940 Ga0207691_10221128 Ga0207691_102211282 276
275 3300025941 Ga0207711_10000028 Ga0207711_10000028142 276
276 3300025942 Ga0207689_10009695 Ga0207689_100096953 276
277 3300025942 Ga0207689_10078572 Ga0207689_100785722 276
278 3300025944 Ga0207661_10156025 Ga0207661_101560252 276
279 3300025944 Ga0207661_10220451 Ga0207661_102204512 276
280 3300025945 Ga0207679_10021840 Ga0207679_100218405 276
281 3300025945 Ga0207679_10121644 Ga0207679_101216442 276
282 3300025945 Ga0207679_10162180 Ga0207679_101621801 276
283 3300025945 Ga0207679_10373854 Ga0207679_103738542 276
284 3300025949 Ga0207667_10000009 Ga0207667_1000000910 276
285 3300025949 Ga0207667_10001800 Ga0207667_100018006 276
286 3300025949 Ga0207667_10002024 Ga0207667_1000202417 276
287 3300025949 Ga0207667_10011416 Ga0207667_100114168 276
288 3300025949 Ga0207667_10040996 Ga0207667_100409963 276
289 3300025949 Ga0207667_10160636 Ga0207667_101606362 276
290 3300025960 Ga0207651_10324120 Ga0207651_103241202 276
291 3300025961 Ga0207712_10009009 Ga0207712_100090094 276
292 3300025961 Ga0207712_10016687 Ga0207712_100166872 276
293 3300025981 Ga0207640_10084794 Ga0207640_100847942 276
294 3300025981 Ga0207640_10317146 Ga0207640_103171461 276
295 3300025986 Ga0207658_10064798 Ga0207658_100647982 276
296 3300025986 Ga0207658_10102615 Ga0207658_101026152 276
297 3300026023 Ga0207677_10494537 Ga0207677_104945372 276
298 3300026035 Ga0207703_10004767 Ga0207703_100047673 276
299 3300026041 Ga0207639_10029149 Ga0207639_100291493 276
300 3300026041 Ga0207639_10032202 Ga0207639_100322023 276
301 3300026041 Ga0207639_10464122 Ga0207639_104641222 276
302 3300026067 Ga0207678_10029748 Ga0207678_100297483 276
303 3300026067 Ga0207678_10341038 Ga0207678_103410381 276
304 3300026075 Ga0207708_10311876 Ga0207708_103118761 276
305 3300026078 Ga0207702_10058064 Ga0207702_100580642 276
306 3300026078 Ga0207702_10356659 Ga0207702_103566592 276
307 3300026088 Ga0207641_10000158 Ga0207641_100001583 276
308 3300026088 Ga0207641_10006686 Ga0207641_100066867 276
309 3300026088 Ga0207641_10336642 Ga0207641_103366422 276
310 3300026095 Ga0207676_10004127 Ga0207676_100041275 276
311 3300026095 Ga0207676_10054313 Ga0207676_100543132 276
312 3300026095 Ga0207676_10150795 Ga0207676_101507952 276
313 3300026095 Ga0207676_10207452 Ga0207676_102074522 276
314 3300026116 Ga0207674_10070485 Ga0207674_100704852 276
315 3300026116 Ga0207674_10162918 Ga0207674_101629182 276
316 3300026118 Ga0207675_100054038 Ga0207675_1000540382 276
317 3300026121 Ga0207683_10042793 Ga0207683_100427932 276
318 3300026142 Ga0207698_10001170 Ga0207698_100011706 276
319 3300026142 Ga0207698_10001210 Ga0207698_100012108 276
320 3300026142 Ga0207698_10008221 Ga0207698_100082213 276
321 3300026142 Ga0207698_10049231 Ga0207698_100492312 276
322 3300026142 Ga0207698_10056355 Ga0207698_100563553 276
323 3300026142 Ga0207698_10166184 Ga0207698_101661841 276
324 3300026142 Ga0207698_10369743 Ga0207698_103697432 276
325 3300026142 Ga0207698_10805741 Ga0207698_108057411 276
326 3300027111 Ga0209281_1008337 Ga0209281_10083372 276
327 3300028379 Ga0268266_10000010 Ga0268266_10000010195 276
328 3300028380 Ga0268265_10819947 Ga0268265_108199471 276
329 3300028381 Ga0268264_10000012 Ga0268264_1000001239 276
330 3300028381 Ga0268264_10005689 Ga0268264_100056892 276
331 3300028381 Ga0268264_10009194 Ga0268264_100091944 276
332 3300028381 Ga0268264_10031602 Ga0268264_100316024 276
333 3300028381 Ga0268264_10136542 Ga0268264_101365422 276
334 3300028794 Ga0307515_10000859 Ga0307515_1000085943 276
335 3300028794 Ga0307515_10001136 Ga0307515_1000113611 276
336 3300028800 Ga0265338_10029068 Ga0265338_100290682 276
337 3300030521 Ga0307511_10000850 Ga0307511_1000085017 276
338 3300031251 Ga0265327_10000488 Ga0265327_100004889 276
339 3300031251 Ga0265327_10016774 Ga0265327_100167743 276
340 3300031251 Ga0265327_10169658 Ga0265327_101696581 276
341 3300031456 Ga0307513_10248806 Ga0307513_102488062 276
342 3300031507 Ga0307509_10037320 Ga0307509_100373202 276
343 3300031548 Ga0307408_100001972 Ga0307408_1000019723 276
344 3300031616 Ga0307508_10001227 Ga0307508_1000122715 276
345 3300031911 Ga0307412_10088207 Ga0307412_100882072 276
346 3300031995 Ga0307409_100120140 Ga0307409_1001201402 276
347 3300032002 Ga0307416_100178995 Ga0307416_1001789952 276
348 3300032004 Ga0307414_10158090 Ga0307414_101580902 276
349 3300032126 Ga0307415_100041291 Ga0307415_1000412911 276
350 3300032137 Ga0316585_10028486 Ga0316585_100284862 276
351 3300032139 Ga0316580_10009432 Ga0316580_100094322 276
352 3300033179 Ga0307507_10020463 Ga0307507_100204638 276
353 3300033180 Ga0307510_10007660 Ga0307510_100076607 276
354 3300035692 Ga0373935_0136215 Ga0373935_0136215_742_1572 276
355 3300037312 Ga0395899_0033581 Ga0395899_0033581_1697_2527 276
356 3300037312 Ga0395899_0093740 Ga0395899_0093740_933_1775 276
357 3300037312 Ga0395899_0171142 Ga0395899_0171142_253_1092 276
358 3300037312 Ga0395899_0265766 Ga0395899_0265766_203_1033 276
359 3300037418 Ga0395900_0029481 Ga0395900_0029481_4507_5349 276
360 3300037418 Ga0395900_0077503 Ga0395900_0077503_1229_2059 276
361 3300037418 Ga0395900_0113365 Ga0395900_0113365_1090_1920 276
362 3300037418 Ga0395900_0275726 Ga0395900_0275726_453_1283 276
363 3300037418 Ga0395900_0350884 Ga0395900_0350884_252_1082 276
364 3300037418 Ga0395900_0400524 Ga0395900_0400524_173_1003 276
365 3300037466 Ga0395898_0010470 Ga0395898_0010470_3761_4600 276
366 3300037466 Ga0395898_0068906 Ga0395898_0068906_1115_1957 276
367 3300037466 Ga0395898_0122628 Ga0395898_0122628_1041_1871 276
368 3300037466 Ga0395898_0154876 Ga0395898_0154876_159_1001 276
369 3300037471 Ga0395905_0044479 Ga0395905_0044479_2964_3794 276
370 3300037471 Ga0395905_0082438 Ga0395905_0082438_1702_2532 276
371 3300037471 Ga0395905_0265783 Ga0395905_0265783_231_1073 276
372 3300038443 Ga0395901_0071323 Ga0395901_0071323_768_1610 276
373 3300038443 Ga0395901_0081828 Ga0395901_0081828_2487_3317 276
374 3300038443 Ga0395901_0741369 Ga0395901_0741369_11_853 276
375 3300039437 Ga0436365_1501550 Ga0436365_1501550_136_966 276
376 3300039447 Ga0436361_0544688 Ga0436361_0544688_3263_4093 276
377 3300041404 Ga0439436_0007176 Ga0439436_0007176_225_1055 276
378 3300041406 Ga0439439_0000685 Ga0439439_0000685_260_1090 276
379 3300041411 Ga0439466_0040771 Ga0439466_0040771_486_1316 276
380 3300041511 Ga0451855_0034114 Ga0451855_0034114_709_1548 276
381 3300041999 Ga0439433_0003295 Ga0439433_0003295_252_1082 276
382 3300042004 Ga0439445_0053759 Ga0439445_0053759_27_857 276
383 3300042007 Ga0439449_0004582 Ga0439449_0004582_2992_3822 276
384 3300042007 Ga0439449_0004763 Ga0439449_0004763_682_1512 276
385 3300042007 Ga0439449_0038234 Ga0439449_0038234_332_1162 276
386 3300042014 Ga0439457_015664 Ga0439457_015664_634_1464 276
387 3300042014 Ga0439457_028009 Ga0439457_028009_147_977 276
388 3300042015 Ga0439462_0001585 Ga0439462_0001585_199_1029 276
389 3300042015 Ga0439462_0035363 Ga0439462_0035363_258_1088 276
390 3300042435 Ga0439434_0023737 Ga0439434_0023737_514_1344 276
391 3300042435 Ga0439434_0056571 Ga0439434_0056571_354_1184 276
392 3300042876 Ga0451577_0010712 Ga0451577_0010712_7402_8244 276
393 3300042876 Ga0451577_0056136 Ga0451577_0056136_2264_3094 276
394 3300042876 Ga0451577_0140651 Ga0451577_0140651_643_1485 276
395 3300044673 Ga0453683_0007933 Ga0453683_0007933_1359_2201 276
396 3300044673 Ga0453683_0079499 Ga0453683_0079499_455_1297 276
397 3300044712 Ga0453684_0000191 Ga0453684_0000191_15766_16608 276
398 3300044712 Ga0453684_0001431 Ga0453684_0001431_44846_45688 276
399 3300044712 Ga0453684_0125115 Ga0453684_0125115_1114_1956 276
400 3300045051 Ga0451576_0003347 Ga0451576_0003347_5597_6439 276
401 3300045051 Ga0451576_0004911 Ga0451576_0004911_7349_8191 276
402 3300046460 Ga0495638_0059936 Ga0495638_0059936_1078_1908 276
403 3300046460 Ga0495638_0161133 Ga0495638_0161133_285_1115 276
404 3300046471 Ga0495650_0000025 Ga0495650_0000025_347853_348683 276
405 3300046492 Ga0495585_0000980 Ga0495585_0000980_18494_19333 276
406 3300046507 Ga0495606_0000035 Ga0495606_0000035_18870_19700 276
407 3300046507 Ga0495606_0057220 Ga0495606_0057220_723_1553 276
408 3300046512 Ga0495610_0001310 Ga0495610_0001310_10355_11185 276
409 3300046512 Ga0495610_0014425 Ga0495610_0014425_2341_3171 276
410 3300046513 Ga0495616_0012017 Ga0495616_0012017_2292_3122 276
411 3300046529 Ga0495652_0231095 Ga0495652_0231095_35_865 276
412 3300046530 Ga0495654_0031871 Ga0495654_0031871_189_1019 276
413 3300046530 Ga0495654_0078093 Ga0495654_0078093_376_1215 276
414 3300046538 Ga0495609_0010365 Ga0495609_0010365_65_904 276
415 3300046558 Ga0495633_0031931 Ga0495633_0031931_19_849 276
416 3300046616 Ga0495668_0000069 Ga0495668_0000069_152467_153306 276
417 3300046616 Ga0495668_0128064 Ga0495668_0128064_511_1341 276
418 3300046660 Ga0495625_0000063 Ga0495625_0000063_2352_3182 276
419 3300046660 Ga0495625_0000419 Ga0495625_0000419_56971_57810 276
420 3300046665 Ga0495661_0004990 Ga0495661_0004990_3810_4640 276
421 3300046665 Ga0495661_0040839 Ga0495661_0040839_1145_1975 276
422 3300046683 Ga0495658_0060081 Ga0495658_0060081_303_1142 276
423 3300046694 Ga0495649_0000006 Ga0495649_0000006_194337_195167 276
424 3300047320 Ga0495672_0005283 Ga0495672_0005283_237_1067 276
425 3300047443 Ga0495687_000243 Ga0495687_000243_56668_57498 276
426 3300047443 Ga0495687_001958 Ga0495687_001958_2638_3468 276
427 3300048089 Ga0495614_0067849 Ga0495614_0067849_25_864 276
428 3300048917 Ga0496114_0265998 Ga0496114_0265998_275_1105 276
429 3300048918 Ga0496115_0164960 Ga0496115_0164960_635_1465 276
430 3300048926 Ga0496123_0022358 Ga0496123_0022358_2806_3636 276
431 3300048927 Ga0496124_0003190 Ga0496124_0003190_8342_9172 276
432 3300048927 Ga0496124_0014329 Ga0496124_0014329_6429_7259 276
433 3300048928 Ga0496125_0004037 Ga0496125_0004037_13569_14399 276
434 3300048929 Ga0496126_0000153 Ga0496126_0000153_97897_98733 276
435 3300049514 Ga0501291_010833 Ga0501291_010833_139_969 276
436 3300049570 Ga0501033_0042980 Ga0501033_0042980_2267_3103 276
437 3300049570 Ga0501033_0389698 Ga0501033_0389698_57_887 276
438 3300049571 Ga0501034_0005663 Ga0501034_0005663_11832_12662 276
439 3300049571 Ga0501034_0016302 Ga0501034_0016302_1573_2403 276
440 3300049571 Ga0501034_0063913 Ga0501034_0063913_2829_3659 276
441 3300049571 Ga0501034_0300693 Ga0501034_0300693_676_1506 276
442 3300049572 Ga0501036_0141203 Ga0501036_0141203_741_1571 276
443 3300049574 Ga0501038_0055888 Ga0501038_0055888_573_1403 276
444 3300049575 Ga0501039_0032992 Ga0501039_0032992_2560_3390 276
445 3300049579 Ga0501043_0003830 Ga0501043_0003830_947_1777 276
446 3300049580 Ga0501046_0006720 Ga0501046_0006720_5463_6293 276
447 3300049581 Ga0501047_0010701 Ga0501047_0010701_4356_5186 276
448 3300049586 Ga0501070_0041260 Ga0501070_0041260_2458_3288 276
449 3300049586 Ga0501070_0427560 Ga0501070_0427560_199_1029 276
450 3300049589 Ga0501073_0002013 Ga0501073_0002013_9065_9895 276
451 3300049590 Ga0501074_0002600 Ga0501074_0002600_7758_8588 276
452 3300049652 Ga0501202_029400 Ga0501202_029400_74_904 276
453 3300049663 Ga0501223_002156 Ga0501223_002156_50_886 276
454 3300049668 Ga0501233_006755 Ga0501233_006755_1325_2155 276
455 3300049669 Ga0501235_028660 Ga0501235_028660_391_1221 276
456 3300049673 Ga0501240_009402 Ga0501240_009402_212_1042 276
457 3300049675 Ga0501243_004172 Ga0501243_004172_612_1448 276
458 3300049675 Ga0501243_008698 Ga0501243_008698_359_1189 276
459 3300049705 Ga0501225_0042448 Ga0501225_0042448_120_950 276
460 3300049742 Ga0501080_0018745 Ga0501080_0018745_2101_2931 276
461 3300049742 Ga0501080_0181426 Ga0501080_0181426_59_970 276
462 3300049744 Ga0501083_0012750 Ga0501083_0012750_2616_3446 276
463 3300049822 Ga0501035_0049062 Ga0501035_0049062_2361_3191 276
464 3300049822 Ga0501035_0079018 Ga0501035_0079018_1960_2871 276
465 3300049823 Ga0501044_0045316 Ga0501044_0045316_1015_1845 276
466 3300049823 Ga0501044_0251411 Ga0501044_0251411_441_1352 276
467 3300050509 nmdc:mga0qj67_44943_c1 nmdc:mga0qj67_44943_c1_1296_2126 276
468 3300050510 nmdc:mga06r32_117938_c1 nmdc:mga06r32_117938_c1_682_1512 276
469 3300053092 Ga0500583_0015747 Ga0500583_0015747_395_1261 276
470 3300053108 Ga0500562_000047 Ga0500562_000047_3020_3850 276
471 3300053125 Ga0500618_020344 Ga0500618_020344_378_1208 276
472 3300053130 Ga0500642_0010291 Ga0500642_0010291_1684_2550 276
473 3300053153 Ga0500616_0009931 Ga0500616_0009931_3179_4009 276
474 3300053156 Ga0500622_0012858 Ga0500622_0012858_2248_3114 276
475 3300053156 Ga0500622_0049166 Ga0500622_0049166_1190_2020 276
476 3300053730 Ga0500645_017016 Ga0500645_017016_546_1376 276
477 3300060353 Ga0501082_0077751 Ga0501082_0077751_1545_2426 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04962

KduI

KduI/IolB family

26

267

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xru-assembly1.cif.gz_A crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli 0.9827 2 274
1ywk-assembly3.cif.gz_C crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9826 2 259
1ywk-assembly6.cif.gz_F crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9803 2 260
1x8m-assembly1.cif.gz_A x-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from escherichia coli 0.9772 1 264
7yrs-assembly4.cif.gz_D crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops 0.9758 2 261
ID Description Score Start End Superfamily
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9838 26 263 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9802 2 260 2.60.120.10
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9677 26 263 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9612 2 260 2.60.120.10
1x8mA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9587 140 264 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q3G1I0-F1-model_v4 deleted 0.9972 1 143
AF-A0A4Q3L616-F1-model_v4 deleted 0.9956 1 253
AF-A0A351RGT4-F1-model_v4 deleted 0.9953 1 135
AF-A0A4Q5YMU5-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9941 1 239 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A484YH81-F1-model_v4 5-keto-4-deoxyuronate isomerase (EC 5.3.1.17) 0.9938 67 140 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.8 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map