F451661

General Info

Members Datasets Scaffolds Average Seq Length
477 204 954 155

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100378028|Ga0068863_1003780283
Length 174
Sequence MGRSATWRMAQSKGFGRVIASLLIALAAQSGATKLPPAQALPPPVAEEQAVLAPLNALFAAFEAGDSAAALRVVYPDGRVTAVGTLRSGTGLRQESWTQFAARLKPGEGFQESISDPAIEIDGDIAMVWAPFVVRVGGKVSNCGVDHFDLVRANGAWKVMNISFSSRTTGCPAQ

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
146 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
200 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
201 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
202 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
203 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 4.82
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100378028 3300005841 Bacteria 1383
2 MBSR1b_contig_7912942 2162886012 Bacteria 919
3 JGI24739J22299_10061083 3300001989 Bacteria 1191
4 JGI24737J22298_10001021 3300001990 Bacteria 9917
5 JGI24737J22298_10028898 3300001990 Bacteria 1741
6 JGI25165J46597_1000380 3300003214 Bacteria 48650
7 Ga0065715_10014203 3300005293 Bacteria 2796
8 Ga0065715_10399727 3300005293 Bacteria 882
9 Ga0070658_10106273 3300005327 Bacteria 2322
10 Ga0070658_10168990 3300005327 Bacteria 1837
11 Ga0070676_10044363 3300005328 Bacteria 2587
12 Ga0070676_10158005 3300005328 Bacteria 1457
13 Ga0070676_10363841 3300005328 Bacteria 997
14 Ga0070670_100025449 3300005331 Bacteria 5093
15 Ga0070670_100043937 3300005331 Bacteria 3841
16 Ga0070670_100047825 3300005331 Bacteria 3681
17 Ga0070670_100056953 3300005331 Bacteria 3355
18 Ga0070670_100671191 3300005331 Bacteria 931
19 Ga0070677_10494064 3300005333 Bacteria 662
20 Ga0068869_100017490 3300005334 Bacteria 4861
21 Ga0068869_100350923 3300005334 Bacteria 1202
22 Ga0068869_100430775 3300005334 Bacteria 1090
23 Ga0068869_100435233 3300005334 Bacteria 1085
24 Ga0068869_100738929 3300005334 Bacteria 842
25 Ga0068869_101420067 3300005334 Unclassified 615
26 Ga0070666_10125666 3300005335 Bacteria 1780
27 Ga0070666_10144901 3300005335 Bacteria 1655
28 Ga0068868_100040785 3300005338 Bacteria 3614
29 Ga0068868_100269559 3300005338 Bacteria 1438
30 Ga0068868_101200844 3300005338 Bacteria 701
31 Ga0070660_100027596 3300005339 Bacteria 4238
32 Ga0070660_100225975 3300005339 Bacteria 1522
33 Ga0070660_100231758 3300005339 Bacteria 1503
34 Ga0070689_100704683 3300005340 Bacteria 882
35 Ga0070661_100117625 3300005344 Bacteria 1988
36 Ga0070661_100117705 3300005344 Bacteria 1988
37 Ga0070661_100129348 3300005344 Bacteria 1896
38 Ga0070668_100001994 3300005347 Bacteria 14923
39 Ga0070668_100065018 3300005347 Bacteria 2829
40 Ga0070668_100544507 3300005347 Bacteria 1009
41 Ga0070668_100688192 3300005347 Bacteria 901
42 Ga0070668_100696329 3300005347 Bacteria 896
43 Ga0070668_101037410 3300005347 Bacteria 738
44 Ga0070668_101067231 3300005347 Bacteria 728
45 Ga0070668_101136982 3300005347 Bacteria 706
46 Ga0070669_100062579 3300005353 Bacteria 2737
47 Ga0070669_100080650 3300005353 Bacteria 2422
48 Ga0070669_100283619 3300005353 Bacteria 1328
49 Ga0070669_100364414 3300005353 Bacteria 1176
50 Ga0070669_100732330 3300005353 Bacteria 837
51 Ga0070675_100003126 3300005354 Bacteria 12521
52 Ga0070675_100195625 3300005354 Bacteria 1753
53 Ga0070675_100727572 3300005354 Bacteria 905
54 Ga0070675_101154003 3300005354 Bacteria 713
55 Ga0070671_100124125 3300005355 Bacteria 2173
56 Ga0070671_100203226 3300005355 Bacteria 1680
57 Ga0070671_100268674 3300005355 Bacteria 1450
58 Ga0070671_100417699 3300005355 Bacteria 1149
59 Ga0070671_100594361 3300005355 Bacteria 956
60 Ga0070671_100714856 3300005355 Bacteria 869
61 Ga0070674_100114430 3300005356 Bacteria 1987
62 Ga0070674_100121707 3300005356 Bacteria 1933
63 Ga0070673_100079158 3300005364 Bacteria 2660
64 Ga0070673_100096148 3300005364 Bacteria 2430
65 Ga0070673_100402146 3300005364 Bacteria 1225
66 Ga0070673_100861934 3300005364 Unclassified 838
67 Ga0070659_100013052 3300005366 Bacteria 6178
68 Ga0070659_100106761 3300005366 Bacteria 2257
69 Ga0070659_100245896 3300005366 Bacteria 1482
70 Ga0070667_100019875 3300005367 Bacteria 5573
71 Ga0070667_100047620 3300005367 Bacteria 3607
72 Ga0070667_100122687 3300005367 Bacteria 2261
73 Ga0070667_100391042 3300005367 Bacteria 1264
74 Ga0070667_100867396 3300005367 Bacteria 839
75 Ga0070667_100925916 3300005367 Bacteria 812
76 Ga0070663_100261252 3300005455 Bacteria 1373
77 Ga0070678_100058694 3300005456 Bacteria 2825
78 Ga0070678_100124040 3300005456 Bacteria 2041
79 Ga0070678_100432635 3300005456 Bacteria 1149
80 Ga0070662_100006344 3300005457 Bacteria 7618
81 Ga0070662_100010375 3300005457 Bacteria 6109
82 Ga0070662_100042766 3300005457 Bacteria 3237
83 Ga0070662_100483768 3300005457 Bacteria 1031
84 Ga0070662_100628638 3300005457 Bacteria 905
85 Ga0068867_100226692 3300005459 Bacteria 1508
86 Ga0070679_100031222 3300005530 Bacteria 5262
87 Ga0068853_100424050 3300005539 Bacteria 1248
88 Ga0068853_100848970 3300005539 Bacteria 876
89 Ga0070672_100205673 3300005543 Bacteria 1647
90 Ga0070672_100363363 3300005543 Bacteria 1236
91 Ga0070672_100565217 3300005543 Bacteria 988
92 Ga0070672_101058071 3300005543 Bacteria 720
93 Ga0070693_100287002 3300005547 Bacteria 1104
94 Ga0070665_100011559 3300005548 Bacteria 8924
95 Ga0070665_100037719 3300005548 Bacteria 4858
96 Ga0070665_100635280 3300005548 Bacteria 1081
97 Ga0068855_100029462 3300005563 Bacteria 6561
98 Ga0068855_100958802 3300005563 Bacteria 901
99 Ga0070664_100016939 3300005564 Bacteria 5980
100 Ga0070664_100037362 3300005564 Bacteria 4083
101 Ga0070664_100272836 3300005564 Bacteria 1524
102 Ga0070664_100295119 3300005564 Bacteria 1464
103 Ga0068857_100106758 3300005577 Bacteria 2515
104 Ga0068857_100678871 3300005577 Bacteria 978
105 Ga0068857_101717270 3300005577 Bacteria 614
106 Ga0068854_100265147 3300005578 Bacteria 1377
107 Ga0068854_100605622 3300005578 Bacteria 936
108 Ga0068856_102014674 3300005614 Unclassified 587
109 Ga0068852_100283922 3300005616 Bacteria 1597
110 Ga0068852_100679234 3300005616 Bacteria 1039
111 Ga0068852_101105777 3300005616 Bacteria 813
112 Ga0068859_100000323 3300005617 Bacteria 47637
113 Ga0068859_100187979 3300005617 Bacteria 2150
114 Ga0068859_100483438 3300005617 Bacteria 1334
115 Ga0068859_100642242 3300005617 Bacteria 1153
116 Ga0068864_100000078 3300005618 Bacteria 103622
117 Ga0068864_100171671 3300005618 Bacteria 1977
118 Ga0068864_100180889 3300005618 Bacteria 1928
119 Ga0068864_100332659 3300005618 Bacteria 1429
120 Ga0068863_100000759 3300005841 Bacteria 32340
121 Ga0068863_100026038 3300005841 Bacteria 5581
122 Ga0068863_100058867 3300005841 Bacteria 3635
123 Ga0068863_100139663 3300005841 Bacteria 2315
124 Ga0068863_100929824 3300005841 Bacteria 871
125 Ga0068863_102248374 3300005841 Bacteria 555
126 Ga0068858_100000952 3300005842 Bacteria 29929
127 Ga0068858_100008369 3300005842 Bacteria 9950
128 Ga0068858_100116389 3300005842 Bacteria 2498
129 Ga0068858_100225081 3300005842 Bacteria 1777
130 Ga0068858_100263017 3300005842 Bacteria 1640
131 Ga0068860_100001691 3300005843 Bacteria 23583
132 Ga0068860_100007296 3300005843 Bacteria 11055
133 Ga0068860_100079880 3300005843 Bacteria 3110
134 Ga0068860_100217721 3300005843 Bacteria 1854
135 Ga0068860_100228511 3300005843 Bacteria 1808
136 Ga0068860_100232755 3300005843 Bacteria 1790
137 Ga0068862_100046594 3300005844 Bacteria 3698
138 Ga0068862_100102860 3300005844 Bacteria 2501
139 Ga0068862_100185413 3300005844 Bacteria 1869
140 Ga0068862_100188851 3300005844 Bacteria 1853
141 Ga0068862_100328091 3300005844 Bacteria 1414
142 Ga0068862_101458333 3300005844 Bacteria 689
143 Ga0081540_1165204 3300005983 Bacteria 852
144 Ga0097621_100030604 3300006237 Bacteria 4262
145 Ga0097621_100138597 3300006237 Bacteria 2077
146 Ga0097621_101071314 3300006237 Bacteria 756
147 Ga0068871_100295930 3300006358 Bacteria 1419
148 Ga0068871_100554148 3300006358 Bacteria 1041
149 Ga0075428_101198989 3300006844 Bacteria 800
150 Ga0075434_101006930 3300006871 Bacteria 847
151 Ga0068865_100646148 3300006881 Bacteria 899
152 Ga0068865_101736200 3300006881 Bacteria 563
153 Ga0097620_100000323 3300006931 Bacteria 47637
154 Ga0097620_100187967 3300006931 Bacteria 2150
155 Ga0097620_100483432 3300006931 Bacteria 1334
156 Ga0097620_100642262 3300006931 Bacteria 1153
157 Ga0105250_10013694 3300009092 Bacteria 3341
158 Ga0105240_10000341 3300009093 Bacteria 87370
159 Ga0105240_10363277 3300009093 Bacteria 1639
160 Ga0105245_10002989 3300009098 Bacteria 15157
161 Ga0114129_10395678 3300009147 Bacteria 1822
162 Ga0105243_10284403 3300009148 Bacteria 1491
163 Ga0105241_10798807 3300009174 Bacteria 869
164 Ga0105242_10619753 3300009176 Bacteria 1048
165 Ga0105248_10000317 3300009177 Bacteria 57281
166 Ga0105248_10080577 3300009177 Bacteria 3659
167 Ga0105248_10173988 3300009177 Bacteria 2427
168 Ga0105248_10233726 3300009177 Bacteria 2069
169 Ga0105248_10337729 3300009177 Bacteria 1696
170 Ga0105237_12102857 3300009545 Bacteria 574
171 Ga0105249_10039184 3300009553 Bacteria 4302
172 Ga0105249_10072930 3300009553 Bacteria 3175
173 Ga0105249_11809167 3300009553 Unclassified 683
174 Ga0105239_10858076 3300010375 Bacteria 1041
175 Ga0105239_11653097 3300010375 Bacteria 741
176 Ga0105246_10180657 3300011119 Bacteria 1624
177 Ga0105246_10318934 3300011119 Bacteria 1262
178 Ga0105246_10682730 3300011119 Bacteria 898
179 Ga0157373_10262277 3300013100 Bacteria 1223
180 Ga0157373_10735476 3300013100 Bacteria 724
181 Ga0157371_10184750 3300013102 Bacteria 1492
182 Ga0157371_10681024 3300013102 Bacteria 769
183 Ga0157369_10539625 3300013105 Bacteria 1206
184 Ga0157369_10795390 3300013105 Bacteria 972
185 Ga0157374_10061410 3300013296 Bacteria 3520
186 Ga0157374_10420265 3300013296 Bacteria 1336
187 Ga0157374_10789958 3300013296 Bacteria 965
188 Ga0157374_10913626 3300013296 Bacteria 896
189 Ga0157378_10364452 3300013297 Bacteria 1415
190 Ga0157378_10555163 3300013297 Bacteria 1154
191 Ga0157378_10614434 3300013297 Bacteria 1099
192 Ga0157378_12269745 3300013297 Bacteria 594
193 Ga0163162_10081893 3300013306 Bacteria 3299
194 Ga0163162_10312422 3300013306 Bacteria 1704
195 Ga0157375_10017127 3300013308 Bacteria 6533
196 Ga0157375_10110817 3300013308 Bacteria 2842
197 Ga0157375_10435500 3300013308 Bacteria 1477
198 Ga0157375_10625397 3300013308 Bacteria 1234
199 Ga0163163_10000774 3300014325 Bacteria 27125
200 Ga0157380_10037002 3300014326 Bacteria 3781
201 Ga0157380_10237908 3300014326 Bacteria 1640
202 Ga0157379_10084075 3300014968 Bacteria 2853
203 Ga0207697_10007476 3300025315 Bacteria 4871
204 Ga0207697_10357223 3300025315 Bacteria 649
205 Ga0207656_10088892 3300025321 Bacteria 1399
206 Ga0207682_10014531 3300025893 Bacteria 3069
207 Ga0207682_10348051 3300025893 Bacteria 698
208 Ga0207688_10017534 3300025901 Bacteria 3892
209 Ga0207688_10113769 3300025901 Bacteria 1573
210 Ga0207680_10092422 3300025903 Bacteria 1927
211 Ga0207680_10361550 3300025903 Bacteria 1021
212 Ga0207680_10413758 3300025903 Bacteria 954
213 Ga0207647_10001423 3300025904 Bacteria 18343
214 Ga0207647_10148196 3300025904 Bacteria 1372
215 Ga0207647_10171472 3300025904 Bacteria 1263
216 Ga0207645_10177777 3300025907 Bacteria 1396
217 Ga0207705_10004209 3300025909 Bacteria 10913
218 Ga0207705_10010078 3300025909 Bacteria 6879
219 Ga0207705_10011716 3300025909 Bacteria 6335
220 Ga0207705_10046864 3300025909 Bacteria 3108
221 Ga0207657_10003819 3300025919 Bacteria 16001
222 Ga0207657_10102137 3300025919 Bacteria 2378
223 Ga0207649_10038555 3300025920 Bacteria 2893
224 Ga0207649_10061644 3300025920 Bacteria 2361
225 Ga0207652_10025820 3300025921 Bacteria 4888
226 Ga0207681_10022313 3300025923 Bacteria 4037
227 Ga0207681_10030604 3300025923 Bacteria 3510
228 Ga0207681_10105031 3300025923 Bacteria 2044
229 Ga0207681_10333410 3300025923 Bacteria 1210
230 Ga0207650_10037098 3300025925 Bacteria 3550
231 Ga0207650_10157727 3300025925 Bacteria 1796
232 Ga0207650_10175991 3300025925 Bacteria 1703
233 Ga0207650_10422419 3300025925 Bacteria 1106
234 Ga0207659_10180332 3300025926 Bacteria 1673
235 Ga0207687_10000724 3300025927 Bacteria 22410
236 Ga0207644_10005433 3300025931 Bacteria 8308
237 Ga0207644_10119123 3300025931 Bacteria 2007
238 Ga0207644_10321504 3300025931 Bacteria 1251
239 Ga0207644_10383269 3300025931 Bacteria 1147
240 Ga0207690_10009171 3300025932 Bacteria 5873
241 Ga0207706_10002847 3300025933 Bacteria 16784
242 Ga0207706_10013126 3300025933 Bacteria 7536
243 Ga0207706_10065570 3300025933 Bacteria 3198
244 Ga0207706_10103431 3300025933 Bacteria 2505
245 Ga0207706_10141407 3300025933 Bacteria 2117
246 Ga0207706_10246638 3300025933 Bacteria 1560
247 Ga0207706_10277818 3300025933 Bacteria 1461
248 Ga0207686_11101524 3300025934 Bacteria 647
249 Ga0207709_10163297 3300025935 Bacteria 1556
250 Ga0207669_11077843 3300025937 Bacteria 677
251 Ga0207704_10394869 3300025938 Bacteria 1090
252 Ga0207704_10943818 3300025938 Bacteria 727
253 Ga0207704_11056055 3300025938 Bacteria 689
254 Ga0207691_10009611 3300025940 Bacteria 9279
255 Ga0207691_10105871 3300025940 Bacteria 2505
256 Ga0207691_10111003 3300025940 Bacteria 2438
257 Ga0207691_10174530 3300025940 Bacteria 1881
258 Ga0207711_10000042 3300025941 Bacteria 158782
259 Ga0207711_10057456 3300025941 Bacteria 3345
260 Ga0207711_10160080 3300025941 Bacteria 2037
261 Ga0207711_10469254 3300025941 Bacteria 1172
262 Ga0207689_10056865 3300025942 Bacteria 3219
263 Ga0207689_10145125 3300025942 Bacteria 1955
264 Ga0207689_10390100 3300025942 Bacteria 1160
265 Ga0207679_10016043 3300025945 Bacteria 4966
266 Ga0207679_10046210 3300025945 Bacteria 3155
267 Ga0207679_10157645 3300025945 Bacteria 1855
268 Ga0207667_10038372 3300025949 Bacteria 5117
269 Ga0207651_10010444 3300025960 Bacteria 5148
270 Ga0207651_10024908 3300025960 Bacteria 3709
271 Ga0207651_10034582 3300025960 Bacteria 3274
272 Ga0207651_10167063 3300025960 Bacteria 1731
273 Ga0207651_10290889 3300025960 Bacteria 1354
274 Ga0207651_11975165 3300025960 Bacteria 524
275 Ga0207712_10001181 3300025961 Bacteria 18076
276 Ga0207712_10002353 3300025961 Bacteria 12255
277 Ga0207668_10001155 3300025972 Bacteria 15698
278 Ga0207668_10169453 3300025972 Bacteria 1711
279 Ga0207668_10379575 3300025972 Bacteria 1189
280 Ga0207668_10597318 3300025972 Bacteria 961
281 Ga0207668_11647475 3300025972 Bacteria 579
282 Ga0207640_10329975 3300025981 Bacteria 1218
283 Ga0207658_10012422 3300025986 Bacteria 5817
284 Ga0207658_10103168 3300025986 Bacteria 2238
285 Ga0207658_10137950 3300025986 Bacteria 1969
286 Ga0207658_10191560 3300025986 Bacteria 1700
287 Ga0207658_10548006 3300025986 Bacteria 1035
288 Ga0207658_10679403 3300025986 Bacteria 929
289 Ga0207658_10704603 3300025986 Bacteria 912
290 Ga0207658_10773471 3300025986 Bacteria 870
291 Ga0207677_10027917 3300026023 Bacteria 3563
292 Ga0207677_10052117 3300026023 Bacteria 2778
293 Ga0207677_10310821 3300026023 Bacteria 1306
294 Ga0207677_10386838 3300026023 Bacteria 1182
295 Ga0207703_10000767 3300026035 Bacteria 31611
296 Ga0207703_10001889 3300026035 Bacteria 18588
297 Ga0207703_10068924 3300026035 Bacteria 2915
298 Ga0207703_10181989 3300026035 Bacteria 1855
299 Ga0207703_10231476 3300026035 Bacteria 1657
300 Ga0207639_10284966 3300026041 Bacteria 1454
301 Ga0207639_10571689 3300026041 Bacteria 1040
302 Ga0207678_10154613 3300026067 Bacteria 1958
303 Ga0207678_10274446 3300026067 Bacteria 1446
304 Ga0207678_10529974 3300026067 Bacteria 1028
305 Ga0207641_10000444 3300026088 Bacteria 47425
306 Ga0207641_10056658 3300026088 Bacteria 3331
307 Ga0207641_10344040 3300026088 Bacteria 1420
308 Ga0207641_10517387 3300026088 Bacteria 1160
309 Ga0207641_11027288 3300026088 Bacteria 821
310 Ga0207648_10043542 3300026089 Bacteria 3940
311 Ga0207676_10000435 3300026095 Bacteria 35291
312 Ga0207676_10008383 3300026095 Bacteria 7346
313 Ga0207676_10316173 3300026095 Bacteria 1431
314 Ga0207676_10473679 3300026095 Bacteria 1184
315 Ga0207674_10039642 3300026116 Bacteria 4883
316 Ga0207674_10268338 3300026116 Bacteria 1654
317 Ga0207674_11419100 3300026116 Bacteria 664
318 Ga0207675_102260930 3300026118 Bacteria 558
319 Ga0207683_10063636 3300026121 Bacteria 3249
320 Ga0207683_10068104 3300026121 Bacteria 3141
321 Ga0207683_10242236 3300026121 Bacteria 1645
322 Ga0207698_10066796 3300026142 Bacteria 2832
323 Ga0209981_1001284 3300027378 Bacteria 3187
324 Ga0209974_10063819 3300027876 Bacteria 1249
325 Ga0268266_10106197 3300028379 Bacteria 2482
326 Ga0268266_10244191 3300028379 Bacteria 1658
327 Ga0268266_10311736 3300028379 Bacteria 1470
328 Ga0268265_10007924 3300028380 Bacteria 7168
329 Ga0268265_10072330 3300028380 Bacteria 2689
330 Ga0268265_10091700 3300028380 Bacteria 2430
331 Ga0268265_10095314 3300028380 Bacteria 2389
332 Ga0268265_10262804 3300028380 Bacteria 1535
333 Ga0268265_10622204 3300028380 Bacteria 1034
334 Ga0268265_10735577 3300028380 Bacteria 956
335 Ga0268265_10991832 3300028380 Bacteria 829
336 Ga0268264_10001602 3300028381 Bacteria 20938
337 Ga0268264_10001741 3300028381 Bacteria 19981
338 Ga0268264_10189525 3300028381 Bacteria 1874
339 Ga0268264_10189734 3300028381 Bacteria 1873
340 Ga0268264_10355818 3300028381 Bacteria 1395
341 Ga0268264_10818785 3300028381 Bacteria 931
342 Ga0307509_10191458 3300031507 Bacteria 1896
343 Ga0307408_100138664 3300031548 Bacteria 1906
344 Ga0307408_100303509 3300031548 Bacteria 1338
345 Ga0307408_100332141 3300031548 Bacteria 1284
346 Ga0307508_10001848 3300031616 Bacteria 23383
347 Ga0307405_10061109 3300031731 Bacteria 2380
348 Ga0307405_10091774 3300031731 Bacteria 2013
349 Ga0307405_10160372 3300031731 Bacteria 1592
350 Ga0307405_10816806 3300031731 Bacteria 782
351 Ga0307405_11415342 3300031731 Bacteria 608
352 Ga0307413_10018368 3300031824 Bacteria 3668
353 Ga0307413_10163245 3300031824 Bacteria 1567
354 Ga0307410_10002101 3300031852 Bacteria 9448
355 Ga0307410_10037853 3300031852 Bacteria 3155
356 Ga0307410_10120956 3300031852 Bacteria 1909
357 Ga0307406_10043283 3300031901 Bacteria 2815
358 Ga0307406_10080869 3300031901 Bacteria 2159
359 Ga0307406_10148816 3300031901 Bacteria 1667
360 Ga0307407_10026465 3300031903 Bacteria 3072
361 Ga0307407_10109158 3300031903 Bacteria 1734
362 Ga0307407_10347195 3300031903 Bacteria 1050
363 Ga0307412_10014518 3300031911 Bacteria 4646
364 Ga0307412_10084170 3300031911 Bacteria 2207
365 Ga0307412_10237204 3300031911 Bacteria 1408
366 Ga0307412_10315555 3300031911 Bacteria 1241
367 Ga0307412_10342488 3300031911 Bacteria 1197
368 Ga0307412_10645239 3300031911 Bacteria 902
369 Ga0307409_100028666 3300031995 Bacteria 3971
370 Ga0307409_100049933 3300031995 Bacteria 3192
371 Ga0307409_100639431 3300031995 Bacteria 1056
372 Ga0307416_100001612 3300032002 Bacteria 12401
373 Ga0307416_100009985 3300032002 Bacteria 6248
374 Ga0307416_100027700 3300032002 Bacteria 4201
375 Ga0307416_100469630 3300032002 Bacteria 1315
376 Ga0307416_100749384 3300032002 Bacteria 1069
377 Ga0307414_10133647 3300032004 Bacteria 1930
378 Ga0307414_10380932 3300032004 Bacteria 1219
379 Ga0307411_10002841 3300032005 Bacteria 7816
380 Ga0307411_10033541 3300032005 Bacteria 3185
381 Ga0307411_10069155 3300032005 Bacteria 2383
382 Ga0307411_10195639 3300032005 Bacteria 1548
383 Ga0307411_10332653 3300032005 Bacteria 1231
384 Ga0307411_10783286 3300032005 Bacteria 838
385 Ga0307415_100004443 3300032126 Bacteria 7273
386 Ga0307415_100014842 3300032126 Bacteria 4594
387 Ga0307415_100186843 3300032126 Bacteria 1631
388 Ga0307415_100200708 3300032126 Bacteria 1582
389 Ga0307415_100205353 3300032126 Bacteria 1567
390 Ga0307415_100320949 3300032126 Bacteria 1291
391 Ga0307415_100343753 3300032126 Bacteria 1253
392 Ga0395900_0008723 3300037418 Bacteria 10411
393 Ga0395900_0087680 3300037418 Bacteria 3198
394 Ga0395905_0061458 3300037471 Bacteria 3514
395 Ga0395905_0361706 3300037471 Bacteria 1344
396 Ga0395905_0543705 3300037471 Bacteria 1063
397 Ga0395905_0745649 3300037471 Bacteria 882
398 Ga0395901_0034176 3300038443 Bacteria 5250
399 Ga0395901_0679013 3300038443 Bacteria 1030
400 Ga0439436_0193378 3300041404 Bacteria 581
401 Ga0439445_0028893 3300042004 Bacteria 1431
402 Ga0439448_0115061 3300042005 Bacteria 920
403 Ga0439432_102044 3300042006 Bacteria 857
404 Ga0439450_082423 3300042008 Bacteria 801
405 Ga0439455_0017369 3300042012 Bacteria 1676
406 Ga0450920_037588 3300042122 Bacteria 962
407 Ga0450910_057653 3300042147 Bacteria 651
408 Ga0439434_0125102 3300042435 Bacteria 841
409 Ga0439464_0036335 3300042439 Bacteria 1393
410 Ga0450918_044237 3300042531 Bacteria 803
411 Ga0451577_0184253 3300042876 Bacteria 1883
412 Ga0466963_0005887 3300044694 Bacteria 7225
413 Ga0466967_0872571 3300045976 Bacteria 894
414 Ga0495638_0028641 3300046460 Bacteria 3594
415 Ga0495639_0057163 3300046475 Bacteria 1782
416 Ga0495585_0008238 3300046492 Bacteria 6328
417 Ga0495607_0135844 3300046501 Bacteria 1274
418 Ga0495631_0151846 3300046518 Bacteria 994
419 Ga0495663_0008446 3300046525 Bacteria 2853
420 Ga0495652_0904516 3300046529 Bacteria 582
421 Ga0495621_0000790 3300046539 Bacteria 8004
422 Ga0495633_0003747 3300046558 Bacteria 9997
423 Ga0495668_0011734 3300046616 Bacteria 5231
424 Ga0495668_0084181 3300046616 Bacteria 1744
425 Ga0495668_0433747 3300046616 Unclassified 723
426 Ga0495625_0000150 3300046660 Bacteria 106314
427 Ga0495669_0015881 3300046684 Bacteria 3224
428 Ga0495669_0023399 3300046684 Bacteria 2688
429 Ga0495670_0003309 3300046691 Bacteria 7941
430 Ga0495687_000061 3300047443 Bacteria 176412
431 Ga0496100_0032479 3300048903 Bacteria 3256
432 Ga0496101_0022923 3300048904 Bacteria 4305
433 Ga0496101_0105866 3300048904 Bacteria 2111
434 Ga0496102_0340651 3300048905 Bacteria 1412
435 Ga0496102_0416497 3300048905 Bacteria 1262
436 Ga0496103_0654482 3300048906 Bacteria 667
437 Ga0496105_0731033 3300048908 Bacteria 757
438 Ga0496106_0225618 3300048909 Bacteria 1495
439 Ga0496106_0394296 3300048909 Bacteria 1112
440 Ga0496107_0822193 3300048910 Unclassified 679
441 Ga0496108_0051775 3300048911 Bacteria 3440
442 Ga0496109_0004784 3300048912 Bacteria 11303
443 Ga0496109_0247918 3300048912 Bacteria 1677
444 Ga0496109_1867022 3300048912 Bacteria 533
445 Ga0496110_0001467 3300048913 Bacteria 17102
446 Ga0496110_1086403 3300048913 Bacteria 708
447 Ga0496111_0008331 3300048914 Bacteria 6853
448 Ga0496112_0293079 3300048915 Bacteria 1573
449 Ga0496113_0021130 3300048916 Bacteria 4588
450 Ga0496113_0308184 3300048916 Bacteria 1268
451 Ga0496114_0000381 3300048917 Bacteria 32736
452 Ga0496114_1111801 3300048917 Bacteria 675
453 Ga0496115_0219743 3300048918 Bacteria 1568
454 Ga0496116_0110706 3300048919 Bacteria 1615
455 Ga0496119_0154009 3300048922 Bacteria 1229
456 Ga0496120_0019552 3300048923 Bacteria 4330
457 Ga0496121_0103297 3300048924 Bacteria 2193
458 Ga0496122_0160528 3300048925 Bacteria 1371
459 Ga0496123_0006656 3300048926 Bacteria 11143
460 Ga0496125_0055265 3300048928 Bacteria 3237
461 Ga0496125_0112816 3300048928 Bacteria 1963
462 Ga0501223_078700 3300049663 Bacteria 658
463 nmdc:mga0n895_920123_c1 3300050512 Bacteria 859
464 Ga0500647_0065560 3300053091 Bacteria 1747
465 Ga0500594_0029950 3300053118 Bacteria 1426
466 Ga0500595_009820 3300053119 Bacteria 3843
467 Ga0500608_000104 3300053122 Bacteria 34635
468 Ga0500614_130124 3300053123 Bacteria 747
469 Ga0500658_0000255 3300053134 Bacteria 24692
470 Ga0500559_0040819 3300053136 Bacteria 2021
471 Ga0500573_0061718 3300053140 Bacteria 2147
472 Ga0500585_078064 3300053144 Bacteria 1196
473 Ga0500588_0348810 3300053146 Unclassified 562
474 Ga0500567_002603 3300053723 Bacteria 7790
475 Ga0500625_000002 3300053729 Bacteria 371909
476 Ga0587070_139117 3300059491 Bacteria 598
477 2885431869 2885429604 Bacteria 3642894
478 Ga0068863_100378028
479 MBSR1b_contig_7912942
480 JGI24739J22299_10061083
481 JGI24737J22298_10001021
482 JGI24737J22298_10028898
483 JGI25165J46597_1000380
484 Ga0065715_10014203
485 Ga0065715_10399727
486 Ga0070658_10106273
487 Ga0070658_10168990
488 Ga0070676_10044363
489 Ga0070676_10158005
490 Ga0070676_10363841
491 Ga0070670_100025449
492 Ga0070670_100043937
493 Ga0070670_100047825
494 Ga0070670_100056953
495 Ga0070670_100671191
496 Ga0070677_10494064
497 Ga0068869_100017490
498 Ga0068869_100350923
499 Ga0068869_100430775
500 Ga0068869_100435233
501 Ga0068869_100738929
502 Ga0068869_101420067
503 Ga0070666_10125666
504 Ga0070666_10144901
505 Ga0068868_100040785
506 Ga0068868_100269559
507 Ga0068868_101200844
508 Ga0070660_100027596
509 Ga0070660_100225975
510 Ga0070660_100231758
511 Ga0070689_100704683
512 Ga0070661_100117625
513 Ga0070661_100117705
514 Ga0070661_100129348
515 Ga0070668_100001994
516 Ga0070668_100065018
517 Ga0070668_100544507
518 Ga0070668_100688192
519 Ga0070668_100696329
520 Ga0070668_101037410
521 Ga0070668_101067231
522 Ga0070668_101136982
523 Ga0070669_100062579
524 Ga0070669_100080650
525 Ga0070669_100283619
526 Ga0070669_100364414
527 Ga0070669_100732330
528 Ga0070675_100003126
529 Ga0070675_100195625
530 Ga0070675_100727572
531 Ga0070675_101154003
532 Ga0070671_100124125
533 Ga0070671_100203226
534 Ga0070671_100268674
535 Ga0070671_100417699
536 Ga0070671_100594361
537 Ga0070671_100714856
538 Ga0070674_100114430
539 Ga0070674_100121707
540 Ga0070673_100079158
541 Ga0070673_100096148
542 Ga0070673_100402146
543 Ga0070673_100861934
544 Ga0070659_100013052
545 Ga0070659_100106761
546 Ga0070659_100245896
547 Ga0070667_100019875
548 Ga0070667_100047620
549 Ga0070667_100122687
550 Ga0070667_100391042
551 Ga0070667_100867396
552 Ga0070667_100925916
553 Ga0070663_100261252
554 Ga0070678_100058694
555 Ga0070678_100124040
556 Ga0070678_100432635
557 Ga0070662_100006344
558 Ga0070662_100010375
559 Ga0070662_100042766
560 Ga0070662_100483768
561 Ga0070662_100628638
562 Ga0068867_100226692
563 Ga0070679_100031222
564 Ga0068853_100424050
565 Ga0068853_100848970
566 Ga0070672_100205673
567 Ga0070672_100363363
568 Ga0070672_100565217
569 Ga0070672_101058071
570 Ga0070693_100287002
571 Ga0070665_100011559
572 Ga0070665_100037719
573 Ga0070665_100635280
574 Ga0068855_100029462
575 Ga0068855_100958802
576 Ga0070664_100016939
577 Ga0070664_100037362
578 Ga0070664_100272836
579 Ga0070664_100295119
580 Ga0068857_100106758
581 Ga0068857_100678871
582 Ga0068857_101717270
583 Ga0068854_100265147
584 Ga0068854_100605622
585 Ga0068856_102014674
586 Ga0068852_100283922
587 Ga0068852_100679234
588 Ga0068852_101105777
589 Ga0068859_100000323
590 Ga0068859_100187979
591 Ga0068859_100483438
592 Ga0068859_100642242
593 Ga0068864_100000078
594 Ga0068864_100171671
595 Ga0068864_100180889
596 Ga0068864_100332659
597 Ga0068863_100000759
598 Ga0068863_100026038
599 Ga0068863_100058867
600 Ga0068863_100139663
601 Ga0068863_100929824
602 Ga0068863_102248374
603 Ga0068858_100000952
604 Ga0068858_100008369
605 Ga0068858_100116389
606 Ga0068858_100225081
607 Ga0068858_100263017
608 Ga0068860_100001691
609 Ga0068860_100007296
610 Ga0068860_100079880
611 Ga0068860_100217721
612 Ga0068860_100228511
613 Ga0068860_100232755
614 Ga0068862_100046594
615 Ga0068862_100102860
616 Ga0068862_100185413
617 Ga0068862_100188851
618 Ga0068862_100328091
619 Ga0068862_101458333
620 Ga0081540_1165204
621 Ga0097621_100030604
622 Ga0097621_100138597
623 Ga0097621_101071314
624 Ga0068871_100295930
625 Ga0068871_100554148
626 Ga0075428_101198989
627 Ga0075434_101006930
628 Ga0068865_100646148
629 Ga0068865_101736200
630 Ga0097620_100000323
631 Ga0097620_100187967
632 Ga0097620_100483432
633 Ga0097620_100642262
634 Ga0105250_10013694
635 Ga0105240_10000341
636 Ga0105240_10363277
637 Ga0105245_10002989
638 Ga0114129_10395678
639 Ga0105243_10284403
640 Ga0105241_10798807
641 Ga0105242_10619753
642 Ga0105248_10000317
643 Ga0105248_10080577
644 Ga0105248_10173988
645 Ga0105248_10233726
646 Ga0105248_10337729
647 Ga0105237_12102857
648 Ga0105249_10039184
649 Ga0105249_10072930
650 Ga0105249_11809167
651 Ga0105239_10858076
652 Ga0105239_11653097
653 Ga0105246_10180657
654 Ga0105246_10318934
655 Ga0105246_10682730
656 Ga0157373_10262277
657 Ga0157373_10735476
658 Ga0157371_10184750
659 Ga0157371_10681024
660 Ga0157369_10539625
661 Ga0157369_10795390
662 Ga0157374_10061410
663 Ga0157374_10420265
664 Ga0157374_10789958
665 Ga0157374_10913626
666 Ga0157378_10364452
667 Ga0157378_10555163
668 Ga0157378_10614434
669 Ga0157378_12269745
670 Ga0163162_10081893
671 Ga0163162_10312422
672 Ga0157375_10017127
673 Ga0157375_10110817
674 Ga0157375_10435500
675 Ga0157375_10625397
676 Ga0163163_10000774
677 Ga0157380_10037002
678 Ga0157380_10237908
679 Ga0157379_10084075
680 Ga0207697_10007476
681 Ga0207697_10357223
682 Ga0207656_10088892
683 Ga0207682_10014531
684 Ga0207682_10348051
685 Ga0207688_10017534
686 Ga0207688_10113769
687 Ga0207680_10092422
688 Ga0207680_10361550
689 Ga0207680_10413758
690 Ga0207647_10001423
691 Ga0207647_10148196
692 Ga0207647_10171472
693 Ga0207645_10177777
694 Ga0207705_10004209
695 Ga0207705_10010078
696 Ga0207705_10011716
697 Ga0207705_10046864
698 Ga0207657_10003819
699 Ga0207657_10102137
700 Ga0207649_10038555
701 Ga0207649_10061644
702 Ga0207652_10025820
703 Ga0207681_10022313
704 Ga0207681_10030604
705 Ga0207681_10105031
706 Ga0207681_10333410
707 Ga0207650_10037098
708 Ga0207650_10157727
709 Ga0207650_10175991
710 Ga0207650_10422419
711 Ga0207659_10180332
712 Ga0207687_10000724
713 Ga0207644_10005433
714 Ga0207644_10119123
715 Ga0207644_10321504
716 Ga0207644_10383269
717 Ga0207690_10009171
718 Ga0207706_10002847
719 Ga0207706_10013126
720 Ga0207706_10065570
721 Ga0207706_10103431
722 Ga0207706_10141407
723 Ga0207706_10246638
724 Ga0207706_10277818
725 Ga0207686_11101524
726 Ga0207709_10163297
727 Ga0207669_11077843
728 Ga0207704_10394869
729 Ga0207704_10943818
730 Ga0207704_11056055
731 Ga0207691_10009611
732 Ga0207691_10105871
733 Ga0207691_10111003
734 Ga0207691_10174530
735 Ga0207711_10000042
736 Ga0207711_10057456
737 Ga0207711_10160080
738 Ga0207711_10469254
739 Ga0207689_10056865
740 Ga0207689_10145125
741 Ga0207689_10390100
742 Ga0207679_10016043
743 Ga0207679_10046210
744 Ga0207679_10157645
745 Ga0207667_10038372
746 Ga0207651_10010444
747 Ga0207651_10024908
748 Ga0207651_10034582
749 Ga0207651_10167063
750 Ga0207651_10290889
751 Ga0207651_11975165
752 Ga0207712_10001181
753 Ga0207712_10002353
754 Ga0207668_10001155
755 Ga0207668_10169453
756 Ga0207668_10379575
757 Ga0207668_10597318
758 Ga0207668_11647475
759 Ga0207640_10329975
760 Ga0207658_10012422
761 Ga0207658_10103168
762 Ga0207658_10137950
763 Ga0207658_10191560
764 Ga0207658_10548006
765 Ga0207658_10679403
766 Ga0207658_10704603
767 Ga0207658_10773471
768 Ga0207677_10027917
769 Ga0207677_10052117
770 Ga0207677_10310821
771 Ga0207677_10386838
772 Ga0207703_10000767
773 Ga0207703_10001889
774 Ga0207703_10068924
775 Ga0207703_10181989
776 Ga0207703_10231476
777 Ga0207639_10284966
778 Ga0207639_10571689
779 Ga0207678_10154613
780 Ga0207678_10274446
781 Ga0207678_10529974
782 Ga0207641_10000444
783 Ga0207641_10056658
784 Ga0207641_10344040
785 Ga0207641_10517387
786 Ga0207641_11027288
787 Ga0207648_10043542
788 Ga0207676_10000435
789 Ga0207676_10008383
790 Ga0207676_10316173
791 Ga0207676_10473679
792 Ga0207674_10039642
793 Ga0207674_10268338
794 Ga0207674_11419100
795 Ga0207675_102260930
796 Ga0207683_10063636
797 Ga0207683_10068104
798 Ga0207683_10242236
799 Ga0207698_10066796
800 Ga0209981_1001284
801 Ga0209974_10063819
802 Ga0268266_10106197
803 Ga0268266_10244191
804 Ga0268266_10311736
805 Ga0268265_10007924
806 Ga0268265_10072330
807 Ga0268265_10091700
808 Ga0268265_10095314
809 Ga0268265_10262804
810 Ga0268265_10622204
811 Ga0268265_10735577
812 Ga0268265_10991832
813 Ga0268264_10001602
814 Ga0268264_10001741
815 Ga0268264_10189525
816 Ga0268264_10189734
817 Ga0268264_10355818
818 Ga0268264_10818785
819 Ga0307509_10191458
820 Ga0307408_100138664
821 Ga0307408_100303509
822 Ga0307408_100332141
823 Ga0307508_10001848
824 Ga0307405_10061109
825 Ga0307405_10091774
826 Ga0307405_10160372
827 Ga0307405_10816806
828 Ga0307405_11415342
829 Ga0307413_10018368
830 Ga0307413_10163245
831 Ga0307410_10002101
832 Ga0307410_10037853
833 Ga0307410_10120956
834 Ga0307406_10043283
835 Ga0307406_10080869
836 Ga0307406_10148816
837 Ga0307407_10026465
838 Ga0307407_10109158
839 Ga0307407_10347195
840 Ga0307412_10014518
841 Ga0307412_10084170
842 Ga0307412_10237204
843 Ga0307412_10315555
844 Ga0307412_10342488
845 Ga0307412_10645239
846 Ga0307409_100028666
847 Ga0307409_100049933
848 Ga0307409_100639431
849 Ga0307416_100001612
850 Ga0307416_100009985
851 Ga0307416_100027700
852 Ga0307416_100469630
853 Ga0307416_100749384
854 Ga0307414_10133647
855 Ga0307414_10380932
856 Ga0307411_10002841
857 Ga0307411_10033541
858 Ga0307411_10069155
859 Ga0307411_10195639
860 Ga0307411_10332653
861 Ga0307411_10783286
862 Ga0307415_100004443
863 Ga0307415_100014842
864 Ga0307415_100186843
865 Ga0307415_100200708
866 Ga0307415_100205353
867 Ga0307415_100320949
868 Ga0307415_100343753
869 Ga0395900_0008723
870 Ga0395900_0087680
871 Ga0395905_0061458
872 Ga0395905_0361706
873 Ga0395905_0543705
874 Ga0395905_0745649
875 Ga0395901_0034176
876 Ga0395901_0679013
877 Ga0439436_0193378
878 Ga0439445_0028893
879 Ga0439448_0115061
880 Ga0439432_102044
881 Ga0439450_082423
882 Ga0439455_0017369
883 Ga0450920_037588
884 Ga0450910_057653
885 Ga0439434_0125102
886 Ga0439464_0036335
887 Ga0450918_044237
888 Ga0451577_0184253
889 Ga0466963_0005887
890 Ga0466967_0872571
891 Ga0495638_0028641
892 Ga0495639_0057163
893 Ga0495585_0008238
894 Ga0495607_0135844
895 Ga0495631_0151846
896 Ga0495663_0008446
897 Ga0495652_0904516
898 Ga0495621_0000790
899 Ga0495633_0003747
900 Ga0495668_0011734
901 Ga0495668_0084181
902 Ga0495668_0433747
903 Ga0495625_0000150
904 Ga0495669_0015881
905 Ga0495669_0023399
906 Ga0495670_0003309
907 Ga0495687_000061
908 Ga0496100_0032479
909 Ga0496101_0022923
910 Ga0496101_0105866
911 Ga0496102_0340651
912 Ga0496102_0416497
913 Ga0496103_0654482
914 Ga0496105_0731033
915 Ga0496106_0225618
916 Ga0496106_0394296
917 Ga0496107_0822193
918 Ga0496108_0051775
919 Ga0496109_0004784
920 Ga0496109_0247918
921 Ga0496109_1867022
922 Ga0496110_0001467
923 Ga0496110_1086403
924 Ga0496111_0008331
925 Ga0496112_0293079
926 Ga0496113_0021130
927 Ga0496113_0308184
928 Ga0496114_0000381
929 Ga0496114_1111801
930 Ga0496115_0219743
931 Ga0496116_0110706
932 Ga0496119_0154009
933 Ga0496120_0019552
934 Ga0496121_0103297
935 Ga0496122_0160528
936 Ga0496123_0006656
937 Ga0496125_0055265
938 Ga0496125_0112816
939 Ga0501223_078700
940 nmdc:mga0n895_920123_c1
941 Ga0500647_0065560
942 Ga0500594_0029950
943 Ga0500595_009820
944 Ga0500608_000104
945 Ga0500614_130124
946 Ga0500658_0000255
947 Ga0500559_0040819
948 Ga0500573_0061718
949 Ga0500585_078064
950 Ga0500588_0348810
951 Ga0500567_002603
952 Ga0500625_000002
953 Ga0587070_139117
954 2885431869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12893

Lumazine_bd_2

Putative lumazine-binding

46

165

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o21-assembly1.cif.gz_B structure of bdellovibrio bacteriovorus bd1075 0.8088 36 145
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.7941 36 151
3ejv-assembly1.cif.gz_A crystal structure of a cystatin-like protein (saro_2766) from novosphingobium aromaticivorans dsm at 1.40 a resolution 0.7928 25 152
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.792 25 148
6of8-assembly1.cif.gz_G-2 structure of thr354asn, glu355gln, thr412asn, ile414met, ile464his, and phe467met mutant human camkii-alpha hub domain 0.7887 27 146
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8112 28 148 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7986 28 148 3.10.450.50
4ovmC00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7914 26 147 3.10.450.50
3ejvA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7905 27 148 3.10.450.50
af_G4RVA5_16_138_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7848 32 148 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1I6MBG7-F1-model_v4 Putative lumazine-binding 0.9253 22 155
AF-A0A1I6MBG7-F1-model_v4 Putative lumazine-binding 0.9184 22 155
AF-A0A1M6ND86-F1-model_v4 SnoaL-like domain-containing protein 0.915 25 152
AF-A0A7V4GZN2-F1-model_v4 Nuclear transport factor 2 family protein 0.9112 44 152
AF-A0A1L6I3J8-F1-model_v4 DUF4440 domain-containing protein 0.9107 21 148

Map