F451549

General Info

Members Datasets Scaffolds Average Seq Length
476 259 952 95

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100124018|Ga0307416_1001240182
Length 112
Sequence MADPAGERVAHDHEASTINFVAFVLSLAHTAAVHFGDVPDPISGQASPANLQAAQQMIDILALLEEKTRGNLSAEERQLLEQVLFELRMRFVEIQNGAGATAEEPKSRIILP

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.26
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 15.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100124018 3300032002 Bacteria 2310
2 JGI24751J29686_10005716 3300002459 Unclassified 2534
3 JGI24751J29686_10040233 3300002459 Bacteria 968
4 Ga0065714_10093097 3300005288 Bacteria 1857
5 Ga0065712_10090609 3300005290 Bacteria 2392
6 Ga0065712_10474776 3300005290 Bacteria 667
7 Ga0065712_10761818 3300005290 Bacteria 525
8 Ga0065715_10126338 3300005293 Bacteria 2111
9 Ga0065715_10194271 3300005293 Bacteria 1397
10 Ga0065707_10498017 3300005295 Bacteria 759
11 Ga0065707_10573123 3300005295 Bacteria 707
12 Ga0065707_11069346 3300005295 Unclassified 522
13 Ga0070690_100480708 3300005330 Unclassified 926
14 Ga0070670_100003569 3300005331 Bacteria 12941
15 Ga0070670_100043097 3300005331 Unclassified 3880
16 Ga0068869_101210424 3300005334 Unclassified 664
17 Ga0070666_11443593 3300005335 Unclassified 514
18 Ga0070680_100617427 3300005336 Bacteria 931
19 Ga0070682_100226980 3300005337 Bacteria 1333
20 Ga0068868_100680872 3300005338 Bacteria 918
21 Ga0070689_100025388 3300005340 Bacteria 4450
22 Ga0070689_100217005 3300005340 Unclassified 1568
23 Ga0070687_101440021 3300005343 Bacteria 516
24 Ga0070661_100268719 3300005344 Bacteria 1320
25 Ga0070668_100165079 3300005347 Bacteria 1799
26 Ga0070668_100931221 3300005347 Unclassified 778
27 Ga0070668_101745867 3300005347 Bacteria 572
28 Ga0070675_100005932 3300005354 Bacteria 9359
29 Ga0070675_100080317 3300005354 Bacteria 2718
30 Ga0070675_100725211 3300005354 Bacteria 906
31 Ga0070675_101823501 3300005354 Bacteria 561
32 Ga0070671_101576268 3300005355 Bacteria 582
33 Ga0070674_100309888 3300005356 Bacteria 1262
34 Ga0070674_100781243 3300005356 Unclassified 823
35 Ga0070673_100017046 3300005364 Bacteria 5153
36 Ga0070688_100028596 3300005365 Bacteria 3329
37 Ga0070709_10051546 3300005434 Bacteria 2583
38 Ga0070713_100324978 3300005436 Unclassified 1421
39 Ga0070710_10425635 3300005437 Bacteria 895
40 Ga0070701_10179939 3300005438 Bacteria 1237
41 Ga0070711_100350305 3300005439 Bacteria 1187
42 Ga0070711_100862243 3300005439 Bacteria 771
43 Ga0070705_100002104 3300005440 Bacteria 10142
44 Ga0070705_100842612 3300005440 Unclassified 733
45 Ga0070705_101244662 3300005440 Bacteria 615
46 Ga0070700_101277944 3300005441 Unclassified 616
47 Ga0070694_100042408 3300005444 Bacteria 3039
48 Ga0070708_100728443 3300005445 Bacteria 933
49 Ga0070662_100714489 3300005457 Bacteria 848
50 Ga0070681_11242952 3300005458 Bacteria 667
51 Ga0070681_11328875 3300005458 Bacteria 642
52 Ga0068867_100101693 3300005459 Bacteria 2196
53 Ga0068867_100417258 3300005459 Bacteria 1136
54 Ga0070685_10108596 3300005466 Bacteria 1706
55 Ga0070706_100271764 3300005467 Bacteria 1582
56 Ga0070706_100868257 3300005467 Bacteria 834
57 Ga0070707_100065728 3300005468 Bacteria 3485
58 Ga0070698_102137281 3300005471 Unclassified 513
59 Ga0070699_101203151 3300005518 Bacteria 695
60 Ga0070679_100529670 3300005530 Bacteria 1122
61 Ga0070679_102125024 3300005530 Bacteria 511
62 Ga0070684_100050126 3300005535 Bacteria 3626
63 Ga0070684_100343409 3300005535 Bacteria 1373
64 Ga0070697_100859380 3300005536 Bacteria 804
65 Ga0070672_100472175 3300005543 Bacteria 1082
66 Ga0070672_101101446 3300005543 Bacteria 706
67 Ga0070686_100079792 3300005544 Bacteria 2164
68 Ga0070686_100120283 3300005544 Bacteria 1802
69 Ga0070695_100003478 3300005545 Bacteria 9199
70 Ga0070695_100194137 3300005545 Bacteria 1447
71 Ga0070695_100428343 3300005545 Bacteria 1009
72 Ga0070695_100493364 3300005545 Bacteria 946
73 Ga0070695_100732965 3300005545 Bacteria 787
74 Ga0070696_100008957 3300005546 Bacteria 6698
75 Ga0070696_100258452 3300005546 Bacteria 1320
76 Ga0070693_100628685 3300005547 Bacteria 778
77 Ga0070704_100119429 3300005549 Bacteria 2022
78 Ga0070704_100130807 3300005549 Bacteria 1945
79 Ga0070704_100299112 3300005549 Bacteria 1340
80 Ga0070704_100566238 3300005549 Bacteria 995
81 Ga0070664_100110576 3300005564 Bacteria 2398
82 Ga0070664_101489387 3300005564 Bacteria 640
83 Ga0068857_100239180 3300005577 Unclassified 1662
84 Ga0068857_100416525 3300005577 Unclassified 1252
85 Ga0068856_100049371 3300005614 Bacteria 4148
86 Ga0070702_100721736 3300005615 Bacteria 762
87 Ga0068859_100026243 3300005617 Bacteria 5842
88 Ga0068859_100221939 3300005617 Bacteria 1978
89 Ga0068859_100778783 3300005617 Bacteria 1045
90 Ga0068859_100910306 3300005617 Bacteria 964
91 Ga0068859_101508932 3300005617 Bacteria 742
92 Ga0068864_100096552 3300005618 Unclassified 2615
93 Ga0068864_100423095 3300005618 Bacteria 1269
94 Ga0068866_10079160 3300005718 Bacteria 1760
95 Ga0068851_10183457 3300005834 Bacteria 1160
96 Ga0068870_10554395 3300005840 Unclassified 774
97 Ga0068870_11230946 3300005840 Bacteria 543
98 Ga0068863_100503595 3300005841 Bacteria 1193
99 Ga0068858_100009268 3300005842 Bacteria 9400
100 Ga0068858_100122112 3300005842 Bacteria 2437
101 Ga0068858_100708223 3300005842 Unclassified 980
102 Ga0068858_102317576 3300005842 Bacteria 531
103 Ga0068860_100443437 3300005843 Bacteria 1290
104 Ga0068860_100472042 3300005843 Bacteria 1250
105 Ga0068860_100700254 3300005843 Bacteria 1023
106 Ga0068860_101182606 3300005843 Unclassified 785
107 Ga0068862_100682996 3300005844 Bacteria 993
108 Ga0068862_101188107 3300005844 Bacteria 761
109 Ga0081455_10642545 3300005937 Unclassified 685
110 Ga0081539_10012639 3300005985 Bacteria 6474
111 Ga0070717_10243176 3300006028 Bacteria 1588
112 Ga0075432_10145107 3300006058 Bacteria 908
113 Ga0075432_10267339 3300006058 Bacteria 699
114 Ga0070715_10354125 3300006163 Bacteria 803
115 Ga0097621_100194365 3300006237 Bacteria 1758
116 Ga0097621_101800218 3300006237 Bacteria 584
117 Ga0097621_102116357 3300006237 Bacteria 538
118 Ga0068871_100017938 3300006358 Bacteria 5368
119 Ga0075428_100774111 3300006844 Bacteria 1021
120 Ga0075431_100048295 3300006847 Bacteria 4390
121 Ga0075433_10149900 3300006852 Bacteria 2074
122 Ga0075433_10159706 3300006852 Bacteria 2006
123 Ga0075434_100001663 3300006871 Bacteria 18964
124 Ga0075434_100006046 3300006871 Bacteria 11068
125 Ga0075434_100074765 3300006871 Bacteria 3381
126 Ga0075434_100263993 3300006871 Unclassified 1741
127 Ga0075434_100730224 3300006871 Bacteria 1007
128 Ga0075434_100780685 3300006871 Bacteria 972
129 Ga0075434_100911347 3300006871 Bacteria 894
130 Ga0075434_100934656 3300006871 Bacteria 882
131 Ga0075434_100995594 3300006871 Unclassified 852
132 Ga0075434_101035597 3300006871 Bacteria 834
133 Ga0075434_101065622 3300006871 Bacteria 822
134 Ga0075434_101123846 3300006871 Bacteria 799
135 Ga0075429_100124167 3300006880 Bacteria 2257
136 Ga0075429_101253485 3300006880 Bacteria 647
137 Ga0075429_101806043 3300006880 Bacteria 530
138 Ga0075436_100004000 3300006914 Bacteria 10111
139 Ga0075436_100012014 3300006914 Bacteria 5939
140 Ga0075436_100289491 3300006914 Bacteria 1172
141 Ga0075436_100785174 3300006914 Bacteria 708
142 Ga0097620_100026243 3300006931 Bacteria 5842
143 Ga0097620_100221942 3300006931 Bacteria 1978
144 Ga0097620_100778796 3300006931 Bacteria 1045
145 Ga0097620_100910368 3300006931 Bacteria 964
146 Ga0097620_101509122 3300006931 Bacteria 742
147 Ga0075435_100000054 3300007076 Bacteria 58537
148 Ga0075435_100009536 3300007076 Bacteria 7037
149 Ga0075435_100012107 3300007076 Bacteria 6376
150 Ga0075435_100040783 3300007076 Bacteria 3709
151 Ga0075435_100041567 3300007076 Bacteria 3676
152 Ga0075435_100043209 3300007076 Bacteria 3607
153 Ga0075435_100141149 3300007076 Bacteria 2021
154 Ga0075435_100638903 3300007076 Bacteria 924
155 Ga0105240_10006705 3300009093 Bacteria 16868
156 Ga0105240_10057958 3300009093 Bacteria 4836
157 Ga0105240_11396802 3300009093 Bacteria 736
158 Ga0105240_12634749 3300009093 Bacteria 519
159 Ga0111539_10000481 3300009094 Bacteria 50448
160 Ga0111539_10003324 3300009094 Bacteria 21234
161 Ga0111539_10041700 3300009094 Bacteria 5516
162 Ga0111539_13121434 3300009094 Bacteria 534
163 Ga0105245_10647942 3300009098 Bacteria 1086
164 Ga0105247_10013233 3300009101 Bacteria 4949
165 Ga0114129_10018227 3300009147 Bacteria 9996
166 Ga0114129_10053517 3300009147 Bacteria 5661
167 Ga0114129_10088012 3300009147 Bacteria 4306
168 Ga0114129_10334210 3300009147 Bacteria 2011
169 Ga0114129_12950113 3300009147 Unclassified 561
170 Ga0105243_10087856 3300009148 Bacteria 2553
171 Ga0105242_12756890 3300009176 Unclassified 541
172 Ga0105248_10058984 3300009177 Bacteria 4310
173 Ga0105248_10068920 3300009177 Bacteria 3971
174 Ga0105248_10806728 3300009177 Unclassified 1059
175 Ga0105248_11397053 3300009177 Bacteria 792
176 Ga0105248_12378128 3300009177 Bacteria 603
177 Ga0105249_10844008 3300009553 Bacteria 981
178 Ga0105249_11226498 3300009553 Unclassified 821
179 Ga0105249_11256757 3300009553 Bacteria 812
180 Ga0105249_11948986 3300009553 Unclassified 660
181 Ga0105246_10426702 3300011119 Unclassified 1108
182 Ga0157373_11462602 3300013100 Unclassified 521
183 Ga0157370_11136735 3300013104 Bacteria 705
184 Ga0157369_11183534 3300013105 Bacteria 780
185 Ga0157369_11683317 3300013105 Unclassified 645
186 Ga0157374_10208234 3300013296 Bacteria 1917
187 Ga0163162_12288241 3300013306 Bacteria 621
188 Ga0157372_11070056 3300013307 Unclassified 933
189 Ga0157375_10696477 3300013308 Bacteria 1170
190 Ga0157375_11389184 3300013308 Bacteria 827
191 Ga0163163_10017338 3300014325 Bacteria 6715
192 Ga0163163_10128948 3300014325 Bacteria 2569
193 Ga0163163_11840040 3300014325 Bacteria 666
194 Ga0163163_11921992 3300014325 Bacteria 652
195 Ga0157380_12659562 3300014326 Bacteria 567
196 Ga0157377_10012659 3300014745 Bacteria 4247
197 Ga0157377_10062656 3300014745 Bacteria 2128
198 Ga0157377_10952460 3300014745 Unclassified 646
199 Ga0157379_10012609 3300014968 Bacteria 7383
200 Ga0157379_10532939 3300014968 Bacteria 1091
201 Ga0157379_10896116 3300014968 Bacteria 841
202 Ga0157379_11672470 3300014968 Bacteria 623
203 Ga0157376_10020354 3300014969 Bacteria 5131
204 Ga0157376_10366282 3300014969 Bacteria 1384
205 Ga0157376_10733329 3300014969 Bacteria 996
206 Ga0207697_10166140 3300025315 Bacteria 964
207 Ga0207710_10013888 3300025900 Bacteria 3391
208 Ga0207685_10488342 3300025905 Bacteria 646
209 Ga0207645_10144514 3300025907 Bacteria 1550
210 Ga0207643_10112921 3300025908 Bacteria 1602
211 Ga0207684_10391557 3300025910 Bacteria 1195
212 Ga0207684_11255308 3300025910 Bacteria 612
213 Ga0207684_11285167 3300025910 Bacteria 603
214 Ga0207695_10418695 3300025913 Bacteria 1224
215 Ga0207695_10477199 3300025913 Unclassified 1129
216 Ga0207663_10495812 3300025916 Bacteria 948
217 Ga0207660_10525812 3300025917 Bacteria 961
218 Ga0207662_10131769 3300025918 Bacteria 1577
219 Ga0207662_10734231 3300025918 Bacteria 693
220 Ga0207649_10890921 3300025920 Unclassified 697
221 Ga0207652_10436253 3300025921 Unclassified 1181
222 Ga0207646_10100330 3300025922 Bacteria 2595
223 Ga0207646_11600511 3300025922 Bacteria 562
224 Ga0207650_10039000 3300025925 Bacteria 3472
225 Ga0207650_10042303 3300025925 Bacteria 3342
226 Ga0207650_11470120 3300025925 Bacteria 579
227 Ga0207659_10000607 3300025926 Bacteria 21418
228 Ga0207659_10183345 3300025926 Bacteria 1660
229 Ga0207659_10609119 3300025926 Bacteria 931
230 Ga0207659_11060673 3300025926 Bacteria 697
231 Ga0207687_10384311 3300025927 Bacteria 1151
232 Ga0207700_10978484 3300025928 Unclassified 757
233 Ga0207644_11438624 3300025931 Bacteria 579
234 Ga0207706_10964689 3300025933 Unclassified 718
235 Ga0207706_11613463 3300025933 Bacteria 525
236 Ga0207709_10202026 3300025935 Bacteria 1420
237 Ga0207709_11572431 3300025935 Bacteria 546
238 Ga0207670_10009541 3300025936 Bacteria 5542
239 Ga0207670_10209726 3300025936 Unclassified 1485
240 Ga0207669_10174521 3300025937 Bacteria 1534
241 Ga0207669_11888606 3300025937 Bacteria 510
242 Ga0207704_11131139 3300025938 Bacteria 666
243 Ga0207691_10011924 3300025940 Bacteria 8340
244 Ga0207711_10246408 3300025941 Bacteria 1639
245 Ga0207711_10543205 3300025941 Bacteria 1084
246 Ga0207689_10737195 3300025942 Bacteria 831
247 Ga0207679_10229885 3300025945 Bacteria 1565
248 Ga0207712_10218687 3300025961 Bacteria 1522
249 Ga0207668_10144251 3300025972 Bacteria 1835
250 Ga0207668_11953266 3300025972 Bacteria 529
251 Ga0207677_10614875 3300026023 Bacteria 955
252 Ga0207703_10032825 3300026035 Bacteria 4112
253 Ga0207703_10169572 3300026035 Bacteria 1919
254 Ga0207639_11922976 3300026041 Bacteria 552
255 Ga0207708_12032544 3300026075 Bacteria 503
256 Ga0207702_10564935 3300026078 Bacteria 1114
257 Ga0207641_10609918 3300026088 Unclassified 1069
258 Ga0207648_10051925 3300026089 Bacteria 3584
259 Ga0207676_10446321 3300026095 Bacteria 1218
260 Ga0207674_10128200 3300026116 Bacteria 2502
261 Ga0207674_10207569 3300026116 Unclassified 1908
262 Ga0207675_102342539 3300026118 Bacteria 547
263 Ga0209983_1060318 3300027665 Bacteria 838
264 Ga0209971_1003520 3300027682 Bacteria 3705
265 Ga0207428_10001413 3300027907 Bacteria 25302
266 Ga0207428_10061129 3300027907 Bacteria 2983
267 Ga0207428_10332022 3300027907 Bacteria 1121
268 Ga0268265_10339141 3300028380 Bacteria 1368
269 Ga0268264_10110788 3300028381 Bacteria 2404
270 Ga0268264_10408236 3300028381 Bacteria 1307
271 Ga0268264_11432957 3300028381 Bacteria 701
272 Ga0268264_11735390 3300028381 Bacteria 635
273 Ga0265332_10390577 3300031238 Unclassified 575
274 Ga0265316_11209237 3300031344 Unclassified 523
275 Ga0307408_100068646 3300031548 Bacteria 2611
276 Ga0307405_10010471 3300031731 Bacteria 4808
277 Ga0307405_10161612 3300031731 Bacteria 1587
278 Ga0307410_10003186 3300031852 Bacteria 8171
279 Ga0307406_10023656 3300031901 Bacteria 3659
280 Ga0307412_10006366 3300031911 Bacteria 6672
281 Ga0307412_10127359 3300031911 Bacteria 1844
282 Ga0307409_100086120 3300031995 Bacteria 2556
283 Ga0307409_100703554 3300031995 Unclassified 1010
284 Ga0307409_101714033 3300031995 Bacteria 657
285 Ga0307416_100026065 3300032002 Bacteria 4301
286 Ga0307416_100186242 3300032002 Bacteria 1951
287 Ga0307416_100576173 3300032002 Bacteria 1202
288 Ga0307416_101088493 3300032002 Bacteria 904
289 Ga0307416_103577682 3300032002 Unclassified 520
290 Ga0307416_103585764 3300032002 Bacteria 519
291 Ga0307414_10049125 3300032004 Bacteria 2915
292 Ga0307411_10001766 3300032005 Bacteria 9126
293 Ga0307411_10134575 3300032005 Bacteria 1812
294 Ga0307415_100012552 3300032126 Bacteria 4903
295 Ga0307415_100752573 3300032126 Unclassified 885
296 Ga0373934_0120552 3300035086 Bacteria 1067
297 Ga0373952_0286507 3300035092 Bacteria 509
298 Ga0373923_0019701 3300035111 Bacteria 2615
299 Ga0373923_0273500 3300035111 Bacteria 795
300 Ga0373936_0075150 3300035113 Bacteria 1399
301 Ga0373936_0354059 3300035113 Bacteria 669
302 Ga0373939_0031827 3300035114 Bacteria 1528
303 Ga0373939_0301242 3300035114 Unclassified 639
304 Ga0373954_0670848 3300035118 Unclassified 514
305 Ga0373956_0131470 3300035119 Bacteria 1172
306 Ga0373943_0003534 3300035170 Bacteria 7116
307 Ga0373943_0770231 3300035170 Unclassified 572
308 Ga0373946_0016834 3300035171 Bacteria 2790
309 Ga0373946_0064272 3300035171 Bacteria 1569
310 Ga0373946_0141299 3300035171 Bacteria 1116
311 Ga0373955_0092762 3300035172 Bacteria 1723
312 Ga0373924_0009672 3300035410 Bacteria 3541
313 Ga0373931_0211568 3300035691 Bacteria 1163
314 Ga0373931_0383326 3300035691 Bacteria 887
315 Ga0373935_0098029 3300035692 Bacteria 1929
316 Ga0373935_0109449 3300035692 Bacteria 1832
317 Ga0373927_0992659 3300035695 Unclassified 554
318 Ga0373933_0233927 3300035724 Bacteria 1181
319 Ga0373947_0025060 3300035725 Bacteria 3478
320 Ga0373947_0035333 3300035725 Bacteria 2959
321 Ga0373937_0080475 3300036401 Bacteria 3013
322 Ga0373937_0289015 3300036401 Bacteria 1549
323 Ga0373937_0817637 3300036401 Bacteria 880
324 Ga0373925_0088349 3300037068 Bacteria 2367
325 Ga0373925_0264195 3300037068 Bacteria 1383
326 Ga0395905_0723010 3300037471 Bacteria 898
327 Ga0395901_2018333 3300038443 Bacteria 523
328 Ga0436363_0551366 3300039450 Unclassified 570
329 Ga0439439_0016796 3300041406 Bacteria 1795
330 Ga0439439_0164075 3300041406 Bacteria 635
331 Ga0451839_1214633 3300041496 Unclassified 625
332 Ga0439435_0009408 3300042436 Bacteria 2292
333 Ga0439464_0024114 3300042439 Bacteria 1682
334 Ga0450918_048178 3300042531 Bacteria 773
335 Ga0451577_0028531 3300042876 Bacteria 5047
336 Ga0451577_0537020 3300042876 Bacteria 1062
337 Ga0453684_0098486 3300044712 Bacteria 3584
338 Ga0466957_0853432 3300044842 Unclassified 649
339 Ga0451576_0029350 3300045051 Bacteria 5886
340 Ga0451576_0056435 3300045051 Bacteria 4107
341 Ga0451576_0433260 3300045051 Bacteria 1380
342 Ga0451576_0788435 3300045051 Bacteria 998
343 Ga0466967_0216277 3300045976 Bacteria 1819
344 Ga0466967_2198704 3300045976 Bacteria 548
345 Ga0466967_2560626 3300045976 Unclassified 505
346 Ga0495592_0021324 3300046454 Bacteria 4928
347 Ga0495592_0087576 3300046454 Bacteria 2240
348 Ga0495651_0063657 3300046462 Bacteria 2819
349 Ga0495653_0596103 3300046463 Bacteria 680
350 Ga0495580_0313652 3300046472 Bacteria 1066
351 Ga0495664_0126572 3300046477 Bacteria 1546
352 Ga0495584_0011055 3300046491 Bacteria 4629
353 Ga0495608_0010869 3300046511 Bacteria 6345
354 Ga0495618_0144700 3300046514 Unclassified 1520
355 Ga0495618_0683063 3300046514 Unclassified 605
356 Ga0495618_0875411 3300046514 Bacteria 520
357 Ga0495628_0312034 3300046516 Unclassified 1162
358 Ga0495628_0403190 3300046516 Bacteria 998
359 Ga0495628_0647349 3300046516 Bacteria 751
360 Ga0495630_0168979 3300046517 Bacteria 1666
361 Ga0495630_0615372 3300046517 Bacteria 832
362 Ga0495637_0340598 3300046520 Bacteria 527
363 Ga0495652_0252849 3300046529 Unclassified 1305
364 Ga0495652_0399169 3300046529 Bacteria 974
365 Ga0495640_0770664 3300046533 Bacteria 574
366 Ga0495587_0044714 3300046536 Bacteria 2634
367 Ga0495598_0037140 3300046537 Bacteria 1404
368 Ga0495645_0178567 3300046543 Bacteria 1456
369 Ga0495645_0270891 3300046543 Bacteria 1121
370 Ga0495633_0021215 3300046558 Bacteria 3252
371 Ga0495633_0159823 3300046558 Bacteria 1040
372 Ga0495667_0052162 3300046559 Bacteria 2696
373 Ga0495667_0860308 3300046559 Unclassified 557
374 Ga0495656_0268911 3300046615 Bacteria 866
375 Ga0495634_0049238 3300046642 Bacteria 2834
376 Ga0495634_0433662 3300046642 Bacteria 777
377 Ga0495635_0780279 3300046663 Bacteria 617
378 Ga0495659_0033203 3300046664 Bacteria 1810
379 Ga0495659_0034287 3300046664 Bacteria 1784
380 Ga0495659_0135660 3300046664 Bacteria 979
381 Ga0495599_0630131 3300046678 Bacteria 623
382 Ga0495623_0451194 3300046679 Bacteria 685
383 Ga0495647_0133579 3300046681 Bacteria 1053
384 Ga0495658_0037578 3300046683 Bacteria 2677
385 Ga0495658_0955628 3300046683 Unclassified 547
386 Ga0495669_0008523 3300046684 Bacteria 4315
387 Ga0495613_0012828 3300046689 Bacteria 6230
388 Ga0495670_0328282 3300046691 Bacteria 822
389 Ga0495600_0117011 3300046809 Bacteria 1735
390 Ga0495604_0020185 3300047317 Bacteria 5325
391 Ga0495636_0625645 3300047318 Bacteria 527
392 Ga0495674_0048798 3300047319 Bacteria 3744
393 Ga0495680_0270602 3300047322 Bacteria 1200
394 Ga0495680_0321042 3300047322 Bacteria 1084
395 Ga0495680_0818536 3300047322 Bacteria 607
396 Ga0495684_0004863 3300047471 Bacteria 10480
397 Ga0495602_0363441 3300048088 Unclassified 1041
398 Ga0496106_0835766 3300048909 Bacteria 729
399 Ga0496108_0305135 3300048911 Bacteria 1387
400 Ga0496109_0234224 3300048912 Unclassified 1728
401 Ga0496110_0043118 3300048913 Bacteria 3939
402 Ga0496111_0082598 3300048914 Bacteria 2347
403 Ga0496112_0626631 3300048915 Bacteria 1006
404 Ga0501032_0334211 3300049569 Bacteria 977
405 Ga0501034_0111968 3300049571 Bacteria 2720
406 Ga0501037_0600220 3300049573 Bacteria 739
407 Ga0501038_0673407 3300049574 Bacteria 777
408 Ga0501040_1436824 3300049576 Unclassified 501
409 Ga0501043_0074822 3300049579 Bacteria 2661
410 Ga0501048_0930707 3300049582 Bacteria 625
411 Ga0501070_1540239 3300049586 Unclassified 502
412 Ga0501071_1076550 3300049587 Unclassified 621
413 Ga0501073_0499612 3300049589 Bacteria 841
414 Ga0501074_0333953 3300049590 Bacteria 1076
415 Ga0501080_0441146 3300049742 Bacteria 1168
416 Ga0501081_0198666 3300049743 Unclassified 1454
417 Ga0501083_0096274 3300049744 Bacteria 1953
418 Ga0501044_0020774 3300049823 Bacteria 7007
419 Ga0501045_0580632 3300049824 Bacteria 831
420 Ga0501212_080335 3300049851 Bacteria 589
421 nmdc:mga05p37_1466053_c1 3300050507 Unclassified 682
422 nmdc:mga05p37_270697_c1 3300050507 Bacteria 2030
423 nmdc:mga05p37_27973_c1 3300050507 Bacteria 6868
424 nmdc:mga05p37_331284_c1 3300050507 Bacteria 1798
425 nmdc:mga05p37_614951_c1 3300050507 Unclassified 1224
426 nmdc:mga09592_147552_c1 3300050508 Bacteria 2028
427 nmdc:mga09592_343612_c1 3300050508 Unclassified 1292
428 nmdc:mga09592_785702_c1 3300050508 Bacteria 806
429 nmdc:mga0qj67_745431_c1 3300050509 Unclassified 777
430 nmdc:mga06r32_145756_c1 3300050510 Bacteria 2345
431 nmdc:mga06r32_31373_c1 3300050510 Bacteria 4990
432 nmdc:mga08y16_2054_c1 3300050511 Bacteria 20614
433 nmdc:mga08y16_34932_c1 3300050511 Bacteria 5282
434 nmdc:mga08y16_9568_c1 3300050511 Bacteria 10172
435 nmdc:mga0n895_1015955_c1 3300050512 Bacteria 810
436 nmdc:mga0n895_1437030_c1 3300050512 Bacteria 657
437 nmdc:mga0n895_1470009_c1 3300050512 Bacteria 648
438 nmdc:mga0n895_1501042_c1 3300050512 Unclassified 640
439 nmdc:mga0n895_184962_c1 3300050512 Bacteria 2115
440 nmdc:mga0n895_190281_c1 3300050512 Bacteria 2083
441 nmdc:mga0n895_29945_c1 3300050512 Bacteria 5197
442 nmdc:mga0n895_3855_c1 3300050512 Bacteria 12172
443 nmdc:mga0n895_43518_c1 3300050512 Bacteria 4376
444 nmdc:mga0n895_592148_c1 3300050512 Bacteria 1112
445 nmdc:mga0n895_76929_c1 3300050512 Bacteria 3318
446 nmdc:mga0n895_882598_c1 3300050512 Bacteria 880
447 nmdc:mga0rr50_116997_c1 3300050513 Bacteria 2117
448 nmdc:mga0rr50_125877_c1 3300050513 Bacteria 2046
449 nmdc:mga0rr50_176126_c1 3300050513 Bacteria 1746
450 nmdc:mga0rr50_1891719_c1 3300050513 Bacteria 501
451 nmdc:mga0rr50_193179_c1 3300050513 Bacteria 1669
452 nmdc:mga0rr50_274341_c1 3300050513 Bacteria 1406
453 nmdc:mga0rr50_388461_c1 3300050513 Bacteria 1177
454 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
455 nmdc:mga0rr50_93758_c1 3300050513 Bacteria 2343
456 nmdc:mga08x19_11981_c1 3300050514 Bacteria 5219
457 nmdc:mga08x19_178530_c1 3300050514 Bacteria 1449
458 nmdc:mga08x19_406_c1 3300050514 Bacteria 30257
459 nmdc:mga08x19_407255_c1 3300050514 Bacteria 955
460 nmdc:mga0a205_1338302_c1 3300050515 Bacteria 564
461 nmdc:mga0a205_1375462_c1 3300050515 Unclassified 554
462 nmdc:mga0a205_145778_c1 3300050515 Bacteria 2268
463 nmdc:mga0a205_488839_c1 3300050515 Bacteria 1088
464 nmdc:mga0a205_63920_c1 3300050515 Bacteria 3555
465 nmdc:mga0a205_90323_c1 3300050515 Bacteria 2960
466 Ga0495601_0005971 3300053077 Bacteria 7105
467 Ga0495601_0240990 3300053077 Bacteria 1181
468 Ga0495595_0110941 3300053084 Bacteria 1330
469 Ga0495595_0144982 3300053084 Unclassified 1166
470 Ga0495619_0003455 3300053085 Bacteria 10194
471 Ga0495619_0313098 3300053085 Unclassified 1087
472 Ga0495619_0525848 3300053085 Unclassified 812
473 Ga0590071_000852 3300059421 Bacteria 8507
474 Ga0590074_000269 3300059423 Bacteria 7025
475 Ga0590075_007974 3300059424 Bacteria 2521
476 Ga0530510_0821949 3300061734 Bacteria 709
477 Ga0307416_100124018
478 JGI24751J29686_10005716
479 JGI24751J29686_10040233
480 Ga0065714_10093097
481 Ga0065712_10090609
482 Ga0065712_10474776
483 Ga0065712_10761818
484 Ga0065715_10126338
485 Ga0065715_10194271
486 Ga0065707_10498017
487 Ga0065707_10573123
488 Ga0065707_11069346
489 Ga0070690_100480708
490 Ga0070670_100003569
491 Ga0070670_100043097
492 Ga0068869_101210424
493 Ga0070666_11443593
494 Ga0070680_100617427
495 Ga0070682_100226980
496 Ga0068868_100680872
497 Ga0070689_100025388
498 Ga0070689_100217005
499 Ga0070687_101440021
500 Ga0070661_100268719
501 Ga0070668_100165079
502 Ga0070668_100931221
503 Ga0070668_101745867
504 Ga0070675_100005932
505 Ga0070675_100080317
506 Ga0070675_100725211
507 Ga0070675_101823501
508 Ga0070671_101576268
509 Ga0070674_100309888
510 Ga0070674_100781243
511 Ga0070673_100017046
512 Ga0070688_100028596
513 Ga0070709_10051546
514 Ga0070713_100324978
515 Ga0070710_10425635
516 Ga0070701_10179939
517 Ga0070711_100350305
518 Ga0070711_100862243
519 Ga0070705_100002104
520 Ga0070705_100842612
521 Ga0070705_101244662
522 Ga0070700_101277944
523 Ga0070694_100042408
524 Ga0070708_100728443
525 Ga0070662_100714489
526 Ga0070681_11242952
527 Ga0070681_11328875
528 Ga0068867_100101693
529 Ga0068867_100417258
530 Ga0070685_10108596
531 Ga0070706_100271764
532 Ga0070706_100868257
533 Ga0070707_100065728
534 Ga0070698_102137281
535 Ga0070699_101203151
536 Ga0070679_100529670
537 Ga0070679_102125024
538 Ga0070684_100050126
539 Ga0070684_100343409
540 Ga0070697_100859380
541 Ga0070672_100472175
542 Ga0070672_101101446
543 Ga0070686_100079792
544 Ga0070686_100120283
545 Ga0070695_100003478
546 Ga0070695_100194137
547 Ga0070695_100428343
548 Ga0070695_100493364
549 Ga0070695_100732965
550 Ga0070696_100008957
551 Ga0070696_100258452
552 Ga0070693_100628685
553 Ga0070704_100119429
554 Ga0070704_100130807
555 Ga0070704_100299112
556 Ga0070704_100566238
557 Ga0070664_100110576
558 Ga0070664_101489387
559 Ga0068857_100239180
560 Ga0068857_100416525
561 Ga0068856_100049371
562 Ga0070702_100721736
563 Ga0068859_100026243
564 Ga0068859_100221939
565 Ga0068859_100778783
566 Ga0068859_100910306
567 Ga0068859_101508932
568 Ga0068864_100096552
569 Ga0068864_100423095
570 Ga0068866_10079160
571 Ga0068851_10183457
572 Ga0068870_10554395
573 Ga0068870_11230946
574 Ga0068863_100503595
575 Ga0068858_100009268
576 Ga0068858_100122112
577 Ga0068858_100708223
578 Ga0068858_102317576
579 Ga0068860_100443437
580 Ga0068860_100472042
581 Ga0068860_100700254
582 Ga0068860_101182606
583 Ga0068862_100682996
584 Ga0068862_101188107
585 Ga0081455_10642545
586 Ga0081539_10012639
587 Ga0070717_10243176
588 Ga0075432_10145107
589 Ga0075432_10267339
590 Ga0070715_10354125
591 Ga0097621_100194365
592 Ga0097621_101800218
593 Ga0097621_102116357
594 Ga0068871_100017938
595 Ga0075428_100774111
596 Ga0075431_100048295
597 Ga0075433_10149900
598 Ga0075433_10159706
599 Ga0075434_100001663
600 Ga0075434_100006046
601 Ga0075434_100074765
602 Ga0075434_100263993
603 Ga0075434_100730224
604 Ga0075434_100780685
605 Ga0075434_100911347
606 Ga0075434_100934656
607 Ga0075434_100995594
608 Ga0075434_101035597
609 Ga0075434_101065622
610 Ga0075434_101123846
611 Ga0075429_100124167
612 Ga0075429_101253485
613 Ga0075429_101806043
614 Ga0075436_100004000
615 Ga0075436_100012014
616 Ga0075436_100289491
617 Ga0075436_100785174
618 Ga0097620_100026243
619 Ga0097620_100221942
620 Ga0097620_100778796
621 Ga0097620_100910368
622 Ga0097620_101509122
623 Ga0075435_100000054
624 Ga0075435_100009536
625 Ga0075435_100012107
626 Ga0075435_100040783
627 Ga0075435_100041567
628 Ga0075435_100043209
629 Ga0075435_100141149
630 Ga0075435_100638903
631 Ga0105240_10006705
632 Ga0105240_10057958
633 Ga0105240_11396802
634 Ga0105240_12634749
635 Ga0111539_10000481
636 Ga0111539_10003324
637 Ga0111539_10041700
638 Ga0111539_13121434
639 Ga0105245_10647942
640 Ga0105247_10013233
641 Ga0114129_10018227
642 Ga0114129_10053517
643 Ga0114129_10088012
644 Ga0114129_10334210
645 Ga0114129_12950113
646 Ga0105243_10087856
647 Ga0105242_12756890
648 Ga0105248_10058984
649 Ga0105248_10068920
650 Ga0105248_10806728
651 Ga0105248_11397053
652 Ga0105248_12378128
653 Ga0105249_10844008
654 Ga0105249_11226498
655 Ga0105249_11256757
656 Ga0105249_11948986
657 Ga0105246_10426702
658 Ga0157373_11462602
659 Ga0157370_11136735
660 Ga0157369_11183534
661 Ga0157369_11683317
662 Ga0157374_10208234
663 Ga0163162_12288241
664 Ga0157372_11070056
665 Ga0157375_10696477
666 Ga0157375_11389184
667 Ga0163163_10017338
668 Ga0163163_10128948
669 Ga0163163_11840040
670 Ga0163163_11921992
671 Ga0157380_12659562
672 Ga0157377_10012659
673 Ga0157377_10062656
674 Ga0157377_10952460
675 Ga0157379_10012609
676 Ga0157379_10532939
677 Ga0157379_10896116
678 Ga0157379_11672470
679 Ga0157376_10020354
680 Ga0157376_10366282
681 Ga0157376_10733329
682 Ga0207697_10166140
683 Ga0207710_10013888
684 Ga0207685_10488342
685 Ga0207645_10144514
686 Ga0207643_10112921
687 Ga0207684_10391557
688 Ga0207684_11255308
689 Ga0207684_11285167
690 Ga0207695_10418695
691 Ga0207695_10477199
692 Ga0207663_10495812
693 Ga0207660_10525812
694 Ga0207662_10131769
695 Ga0207662_10734231
696 Ga0207649_10890921
697 Ga0207652_10436253
698 Ga0207646_10100330
699 Ga0207646_11600511
700 Ga0207650_10039000
701 Ga0207650_10042303
702 Ga0207650_11470120
703 Ga0207659_10000607
704 Ga0207659_10183345
705 Ga0207659_10609119
706 Ga0207659_11060673
707 Ga0207687_10384311
708 Ga0207700_10978484
709 Ga0207644_11438624
710 Ga0207706_10964689
711 Ga0207706_11613463
712 Ga0207709_10202026
713 Ga0207709_11572431
714 Ga0207670_10009541
715 Ga0207670_10209726
716 Ga0207669_10174521
717 Ga0207669_11888606
718 Ga0207704_11131139
719 Ga0207691_10011924
720 Ga0207711_10246408
721 Ga0207711_10543205
722 Ga0207689_10737195
723 Ga0207679_10229885
724 Ga0207712_10218687
725 Ga0207668_10144251
726 Ga0207668_11953266
727 Ga0207677_10614875
728 Ga0207703_10032825
729 Ga0207703_10169572
730 Ga0207639_11922976
731 Ga0207708_12032544
732 Ga0207702_10564935
733 Ga0207641_10609918
734 Ga0207648_10051925
735 Ga0207676_10446321
736 Ga0207674_10128200
737 Ga0207674_10207569
738 Ga0207675_102342539
739 Ga0209983_1060318
740 Ga0209971_1003520
741 Ga0207428_10001413
742 Ga0207428_10061129
743 Ga0207428_10332022
744 Ga0268265_10339141
745 Ga0268264_10110788
746 Ga0268264_10408236
747 Ga0268264_11432957
748 Ga0268264_11735390
749 Ga0265332_10390577
750 Ga0265316_11209237
751 Ga0307408_100068646
752 Ga0307405_10010471
753 Ga0307405_10161612
754 Ga0307410_10003186
755 Ga0307406_10023656
756 Ga0307412_10006366
757 Ga0307412_10127359
758 Ga0307409_100086120
759 Ga0307409_100703554
760 Ga0307409_101714033
761 Ga0307416_100026065
762 Ga0307416_100186242
763 Ga0307416_100576173
764 Ga0307416_101088493
765 Ga0307416_103577682
766 Ga0307416_103585764
767 Ga0307414_10049125
768 Ga0307411_10001766
769 Ga0307411_10134575
770 Ga0307415_100012552
771 Ga0307415_100752573
772 Ga0373934_0120552
773 Ga0373952_0286507
774 Ga0373923_0019701
775 Ga0373923_0273500
776 Ga0373936_0075150
777 Ga0373936_0354059
778 Ga0373939_0031827
779 Ga0373939_0301242
780 Ga0373954_0670848
781 Ga0373956_0131470
782 Ga0373943_0003534
783 Ga0373943_0770231
784 Ga0373946_0016834
785 Ga0373946_0064272
786 Ga0373946_0141299
787 Ga0373955_0092762
788 Ga0373924_0009672
789 Ga0373931_0211568
790 Ga0373931_0383326
791 Ga0373935_0098029
792 Ga0373935_0109449
793 Ga0373927_0992659
794 Ga0373933_0233927
795 Ga0373947_0025060
796 Ga0373947_0035333
797 Ga0373937_0080475
798 Ga0373937_0289015
799 Ga0373937_0817637
800 Ga0373925_0088349
801 Ga0373925_0264195
802 Ga0395905_0723010
803 Ga0395901_2018333
804 Ga0436363_0551366
805 Ga0439439_0016796
806 Ga0439439_0164075
807 Ga0451839_1214633
808 Ga0439435_0009408
809 Ga0439464_0024114
810 Ga0450918_048178
811 Ga0451577_0028531
812 Ga0451577_0537020
813 Ga0453684_0098486
814 Ga0466957_0853432
815 Ga0451576_0029350
816 Ga0451576_0056435
817 Ga0451576_0433260
818 Ga0451576_0788435
819 Ga0466967_0216277
820 Ga0466967_2198704
821 Ga0466967_2560626
822 Ga0495592_0021324
823 Ga0495592_0087576
824 Ga0495651_0063657
825 Ga0495653_0596103
826 Ga0495580_0313652
827 Ga0495664_0126572
828 Ga0495584_0011055
829 Ga0495608_0010869
830 Ga0495618_0144700
831 Ga0495618_0683063
832 Ga0495618_0875411
833 Ga0495628_0312034
834 Ga0495628_0403190
835 Ga0495628_0647349
836 Ga0495630_0168979
837 Ga0495630_0615372
838 Ga0495637_0340598
839 Ga0495652_0252849
840 Ga0495652_0399169
841 Ga0495640_0770664
842 Ga0495587_0044714
843 Ga0495598_0037140
844 Ga0495645_0178567
845 Ga0495645_0270891
846 Ga0495633_0021215
847 Ga0495633_0159823
848 Ga0495667_0052162
849 Ga0495667_0860308
850 Ga0495656_0268911
851 Ga0495634_0049238
852 Ga0495634_0433662
853 Ga0495635_0780279
854 Ga0495659_0033203
855 Ga0495659_0034287
856 Ga0495659_0135660
857 Ga0495599_0630131
858 Ga0495623_0451194
859 Ga0495647_0133579
860 Ga0495658_0037578
861 Ga0495658_0955628
862 Ga0495669_0008523
863 Ga0495613_0012828
864 Ga0495670_0328282
865 Ga0495600_0117011
866 Ga0495604_0020185
867 Ga0495636_0625645
868 Ga0495674_0048798
869 Ga0495680_0270602
870 Ga0495680_0321042
871 Ga0495680_0818536
872 Ga0495684_0004863
873 Ga0495602_0363441
874 Ga0496106_0835766
875 Ga0496108_0305135
876 Ga0496109_0234224
877 Ga0496110_0043118
878 Ga0496111_0082598
879 Ga0496112_0626631
880 Ga0501032_0334211
881 Ga0501034_0111968
882 Ga0501037_0600220
883 Ga0501038_0673407
884 Ga0501040_1436824
885 Ga0501043_0074822
886 Ga0501048_0930707
887 Ga0501070_1540239
888 Ga0501071_1076550
889 Ga0501073_0499612
890 Ga0501074_0333953
891 Ga0501080_0441146
892 Ga0501081_0198666
893 Ga0501083_0096274
894 Ga0501044_0020774
895 Ga0501045_0580632
896 Ga0501212_080335
897 nmdc:mga05p37_1466053_c1
898 nmdc:mga05p37_270697_c1
899 nmdc:mga05p37_27973_c1
900 nmdc:mga05p37_331284_c1
901 nmdc:mga05p37_614951_c1
902 nmdc:mga09592_147552_c1
903 nmdc:mga09592_343612_c1
904 nmdc:mga09592_785702_c1
905 nmdc:mga0qj67_745431_c1
906 nmdc:mga06r32_145756_c1
907 nmdc:mga06r32_31373_c1
908 nmdc:mga08y16_2054_c1
909 nmdc:mga08y16_34932_c1
910 nmdc:mga08y16_9568_c1
911 nmdc:mga0n895_1015955_c1
912 nmdc:mga0n895_1437030_c1
913 nmdc:mga0n895_1470009_c1
914 nmdc:mga0n895_1501042_c1
915 nmdc:mga0n895_184962_c1
916 nmdc:mga0n895_190281_c1
917 nmdc:mga0n895_29945_c1
918 nmdc:mga0n895_3855_c1
919 nmdc:mga0n895_43518_c1
920 nmdc:mga0n895_592148_c1
921 nmdc:mga0n895_76929_c1
922 nmdc:mga0n895_882598_c1
923 nmdc:mga0rr50_116997_c1
924 nmdc:mga0rr50_125877_c1
925 nmdc:mga0rr50_176126_c1
926 nmdc:mga0rr50_1891719_c1
927 nmdc:mga0rr50_193179_c1
928 nmdc:mga0rr50_274341_c1
929 nmdc:mga0rr50_388461_c1
930 nmdc:mga0rr50_5_c1
931 nmdc:mga0rr50_93758_c1
932 nmdc:mga08x19_11981_c1
933 nmdc:mga08x19_178530_c1
934 nmdc:mga08x19_406_c1
935 nmdc:mga08x19_407255_c1
936 nmdc:mga0a205_1338302_c1
937 nmdc:mga0a205_1375462_c1
938 nmdc:mga0a205_145778_c1
939 nmdc:mga0a205_488839_c1
940 nmdc:mga0a205_63920_c1
941 nmdc:mga0a205_90323_c1
942 Ga0495601_0005971
943 Ga0495601_0240990
944 Ga0495595_0110941
945 Ga0495595_0144982
946 Ga0495619_0003455
947 Ga0495619_0313098
948 Ga0495619_0525848
949 Ga0590071_000852
950 Ga0590074_000269
951 Ga0590075_007974
952 Ga0530510_0821949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08899

DUF1844

Domain of unknown function (DUF1844)

17

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yzm-assembly1.cif.gz_A structure of rabenosyn (458-503), rab4 binding domain 0.8587 41 81
3v1b-assembly1.cif.gz_B crystal structure of de novo designed mid1-apo2 0.8168 41 79
1yzm-assembly1.cif.gz_A structure of rabenosyn (458-503), rab4 binding domain 0.7626 41 81
5ltw-assembly3.cif.gz_J complex of human 14-3-3 sigma clu1 mutant with phosphorylated heat shock protein b6 0.7625 7 78
5lu1-assembly1.cif.gz_B human 14-3-3 sigma clu3 mutant complexed with short hspb6 phosphopeptide 0.7602 7 78
ID Description Score Start End Superfamily
af_O17559_1_278_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.928 35 81 3.90.550.10
af_Q5AD67_192_420_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9118 33 78 3.40.50.300
af_P22516_200_453_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9053 33 77 3.40.50.300
af_Q6AXC6_197_451_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8415 28 78 3.40.50.300
af_Q9XZS9_180_415_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8224 31 81 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A381S9Z2-F1-model_v4 DUF1844 domain-containing protein 0.9842 2 82
AF-Q2IM20-F1-model_v4 DUF1844 domain-containing protein 0.9822 2 83
AF-A0A7W1TSS2-F1-model_v4 DUF1844 domain-containing protein 0.9803 1 85
AF-A0A7V7WHC1-F1-model_v4 DUF1844 domain-containing protein 0.9786 5 79
AF-A0A2N2ITA2-F1-model_v4 DUF1844 domain-containing protein 0.9772 2 82

Map