F451546

General Info

Members Datasets Scaffolds Average Seq Length
476 262 474 131

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100252932|Ga0307408_1002529322
Length 155
Sequence MQRQNFGSGTPWEPIVGYSRAVRVGNHVWVAGTTATDESGSIVGGDSYYEQAMQTLRNIERALHRAGATMQDVVRTRTFLVDISKWEAVGRAHGEFFREVRPATAMMGVSGFVSPAMLVEIEADAYIATTSRADAQERRADERPHDIEVPPGKGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
163 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 2.1
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_567951 2162886007 Bacteria 1196
2 Ga0065704_10071645 3300005289 Bacteria 10400
3 Ga0065707_10091894 3300005295 Bacteria 3859
4 Ga0065707_10299105 3300005295 Bacteria 1008
5 Ga0070683_100213033 3300005329 Bacteria 1835
6 Ga0070677_10003249 3300005333 Bacteria 5234
7 Ga0068869_100030771 3300005334 Bacteria 3771
8 Ga0070666_10070202 3300005335 Bacteria 2383
9 Ga0070680_100261482 3300005336 Bacteria 1464
10 Ga0070680_100502787 3300005336 Unclassified 1037
11 Ga0070680_100802305 3300005336 Bacteria 811
12 Ga0068868_100002049 3300005338 Bacteria 13855
13 Ga0070691_10277047 3300005341 Bacteria 909
14 Ga0070687_100032957 3300005343 Bacteria 2553
15 Ga0070692_10014762 3300005345 Bacteria 3679
16 Ga0070668_100088467 3300005347 Bacteria 2438
17 Ga0070668_100156600 3300005347 Bacteria 1846
18 Ga0070668_100283662 3300005347 Bacteria 1384
19 Ga0070668_100810859 3300005347 Bacteria 832
20 Ga0070669_100013749 3300005353 Bacteria 5754
21 Ga0070675_100087767 3300005354 Bacteria 2601
22 Ga0070675_101122895 3300005354 Bacteria 723
23 Ga0070671_100041303 3300005355 Bacteria 3833
24 Ga0070671_100545707 3300005355 Unclassified 999
25 Ga0070671_101645775 3300005355 Bacteria 569
26 Ga0070674_100026115 3300005356 Bacteria 3811
27 Ga0070673_100044745 3300005364 Bacteria 3429
28 Ga0070673_100092219 3300005364 Bacteria 2477
29 Ga0070673_100269348 3300005364 Bacteria 1490
30 Ga0070688_100584495 3300005365 Bacteria 853
31 Ga0070667_100041868 3300005367 Bacteria 3841
32 Ga0070667_101198652 3300005367 Unclassified 711
33 Ga0070709_10048287 3300005434 Unclassified 2656
34 Ga0070709_10071052 3300005434 Bacteria 2246
35 Ga0070709_10458392 3300005434 Bacteria 962
36 Ga0070709_10749340 3300005434 Bacteria 763
37 Ga0070714_100220512 3300005435 Bacteria 1743
38 Ga0070714_100280606 3300005435 Bacteria 1547
39 Ga0070714_101044975 3300005435 Unclassified 795
40 Ga0070714_101081722 3300005435 Unclassified 781
41 Ga0070710_10008666 3300005437 Bacteria 4955
42 Ga0070710_10710258 3300005437 Bacteria 710
43 Ga0070701_10005016 3300005438 Bacteria 5427
44 Ga0070711_100008308 3300005439 Bacteria 6354
45 Ga0070711_100021847 3300005439 Bacteria 4142
46 Ga0070705_100912997 3300005440 Bacteria 707
47 Ga0070705_101413532 3300005440 Bacteria 580
48 Ga0070700_100086376 3300005441 Bacteria 2037
49 Ga0070700_100465763 3300005441 Bacteria 965
50 Ga0070700_100865123 3300005441 Bacteria 733
51 Ga0070700_101126726 3300005441 Unclassified 652
52 Ga0070694_100014468 3300005444 Bacteria 4940
53 Ga0070694_100103748 3300005444 Bacteria 2015
54 Ga0070694_100185930 3300005444 Bacteria 1539
55 Ga0070694_100257026 3300005444 Bacteria 1323
56 Ga0070694_100261419 3300005444 Bacteria 1313
57 Ga0070694_101400260 3300005444 Bacteria 590
58 Ga0070708_100001530 3300005445 Bacteria 17667
59 Ga0070708_100076019 3300005445 Bacteria 3032
60 Ga0070663_100486269 3300005455 Bacteria 1023
61 Ga0070678_100010475 3300005456 Bacteria 5668
62 Ga0070662_101196179 3300005457 Unclassified 653
63 Ga0070681_10313881 3300005458 Unclassified 1477
64 Ga0070681_11114743 3300005458 Bacteria 710
65 Ga0068867_100091066 3300005459 Bacteria 2314
66 Ga0068867_100187477 3300005459 Bacteria 1648
67 Ga0068867_100226101 3300005459 Bacteria 1510
68 Ga0070685_10269173 3300005466 Bacteria 1136
69 Ga0070706_100151208 3300005467 Bacteria 2167
70 Ga0070706_100160899 3300005467 Bacteria 2096
71 Ga0070706_101313505 3300005467 Bacteria 663
72 Ga0070707_100049949 3300005468 Bacteria 4010
73 Ga0070707_100137795 3300005468 Unclassified 2374
74 Ga0070707_100423613 3300005468 Bacteria 1291
75 Ga0070707_100566956 3300005468 Bacteria 1097
76 Ga0070707_101113677 3300005468 Bacteria 755
77 Ga0070698_100001382 3300005471 Bacteria 26902
78 Ga0070698_100007510 3300005471 Bacteria 11795
79 Ga0070698_100396532 3300005471 Bacteria 1313
80 Ga0070699_100016628 3300005518 Bacteria 6315
81 Ga0070699_100020457 3300005518 Bacteria 5707
82 Ga0070699_100041670 3300005518 Bacteria 3974
83 Ga0070699_100139231 3300005518 Bacteria 2142
84 Ga0070699_100362318 3300005518 Unclassified 1307
85 Ga0070699_101307530 3300005518 Unclassified 665
86 Ga0070699_101750830 3300005518 Bacteria 569
87 Ga0070679_100026362 3300005530 Bacteria 5709
88 Ga0070679_100567929 3300005530 Bacteria 1078
89 Ga0070684_100261152 3300005535 Unclassified 1584
90 Ga0070697_100002936 3300005536 Bacteria 13122
91 Ga0070697_100092497 3300005536 Bacteria 2502
92 Ga0070697_100103208 3300005536 Bacteria 2370
93 Ga0070697_100148346 3300005536 Bacteria 1976
94 Ga0070697_100594393 3300005536 Bacteria 972
95 Ga0070672_100017094 3300005543 Bacteria 5213
96 Ga0070672_100080009 3300005543 Bacteria 2617
97 Ga0070686_100012990 3300005544 Bacteria 4755
98 Ga0070695_100017455 3300005545 Bacteria 4352
99 Ga0070695_100751601 3300005545 Bacteria 778
100 Ga0070696_100010817 3300005546 Bacteria 6115
101 Ga0070696_100142736 3300005546 Bacteria 1752
102 Ga0070696_100261245 3300005546 Bacteria 1313
103 Ga0070665_100114642 3300005548 Bacteria 2697
104 Ga0070665_100572775 3300005548 Unclassified 1142
105 Ga0070704_100004614 3300005549 Bacteria 7968
106 Ga0070704_100040330 3300005549 Bacteria 3213
107 Ga0068854_100345262 3300005578 Bacteria 1217
108 Ga0070702_100002751 3300005615 Bacteria 7698
109 Ga0068852_100320809 3300005616 Bacteria 1504
110 Ga0068852_100628158 3300005616 Bacteria 1080
111 Ga0068852_102271866 3300005616 Unclassified 564
112 Ga0068859_100148999 3300005617 Bacteria 2415
113 Ga0068859_100777646 3300005617 Bacteria 1046
114 Ga0068864_100098875 3300005618 Bacteria 2584
115 Ga0068866_10940939 3300005718 Bacteria 610
116 Ga0068861_100067812 3300005719 Bacteria 2755
117 Ga0068861_100967198 3300005719 Unclassified 811
118 Ga0068851_10146974 3300005834 Unclassified 1286
119 Ga0068870_10033442 3300005840 Bacteria 2624
120 Ga0068863_100012406 3300005841 Bacteria 8228
121 Ga0068863_100038952 3300005841 Bacteria 4523
122 Ga0068858_100001708 3300005842 Bacteria 22440
123 Ga0068858_100551562 3300005842 Bacteria 1116
124 Ga0068860_100001391 3300005843 Bacteria 26220
125 Ga0068862_100089032 3300005844 Bacteria 2686
126 Ga0068862_100632946 3300005844 Bacteria 1030
127 Ga0068862_101163671 3300005844 Bacteria 769
128 Ga0068862_101401815 3300005844 Unclassified 702
129 Ga0070717_10007885 3300006028 Bacteria 7930
130 Ga0070717_10122298 3300006028 Bacteria 2231
131 Ga0070717_10397681 3300006028 Unclassified 1237
132 Ga0075363_100024360 3300006048 Bacteria 3076
133 Ga0075364_10746668 3300006051 Bacteria 667
134 Ga0070715_10168594 3300006163 Bacteria 1088
135 Ga0070716_100000382 3300006173 Bacteria 18081
136 Ga0070716_100026809 3300006173 Unclassified 3089
137 Ga0070716_100045535 3300006173 Bacteria 2463
138 Ga0070716_100214354 3300006173 Bacteria 1289
139 Ga0070716_100313276 3300006173 Bacteria 1096
140 Ga0070712_100000459 3300006175 Bacteria 23357
141 Ga0070712_100001265 3300006175 Bacteria 15256
142 Ga0070712_100008281 3300006175 Bacteria 6532
143 Ga0070712_100329920 3300006175 Bacteria 1243
144 Ga0070712_101833010 3300006175 Unclassified 531
145 Ga0075369_10076148 3300006186 Bacteria 1482
146 Ga0097621_100013100 3300006237 Bacteria 6167
147 Ga0068871_100033307 3300006358 Bacteria 4079
148 Ga0075431_100082522 3300006847 Bacteria 3318
149 Ga0075433_10379295 3300006852 Unclassified 1248
150 Ga0075433_10643783 3300006852 Bacteria 929
151 Ga0075434_100016099 3300006871 Bacteria 7186
152 Ga0075434_100884449 3300006871 Unclassified 908
153 Ga0075434_101414506 3300006871 Bacteria 705
154 Ga0068865_100111126 3300006881 Bacteria 2022
155 Ga0068865_101605668 3300006881 Bacteria 585
156 Ga0075436_100002153 3300006914 Bacteria 13580
157 Ga0075436_100002382 3300006914 Bacteria 12963
158 Ga0075436_100003740 3300006914 Bacteria 10425
159 Ga0075436_100007210 3300006914 Bacteria 7606
160 Ga0075436_100099795 3300006914 Bacteria 2021
161 Ga0075436_100164719 3300006914 Bacteria 1564
162 Ga0075436_100679895 3300006914 Bacteria 762
163 Ga0097620_100149003 3300006931 Bacteria 2415
164 Ga0097620_100777708 3300006931 Bacteria 1046
165 Ga0075435_100165742 3300007076 Bacteria 1863
166 Ga0075435_100170502 3300007076 Unclassified 1836
167 Ga0105240_10006761 3300009093 Bacteria 16788
168 Ga0105240_10032351 3300009093 Bacteria 6773
169 Ga0111539_10000937 3300009094 Bacteria 38215
170 Ga0111539_12865058 3300009094 Unclassified 558
171 Ga0105245_10036254 3300009098 Bacteria 4380
172 Ga0105245_10868199 3300009098 Bacteria 943
173 Ga0114129_10012808 3300009147 Bacteria 11936
174 Ga0114129_10499237 3300009147 Bacteria 1589
175 Ga0114129_10899043 3300009147 Bacteria 1122
176 Ga0114129_11203864 3300009147 Bacteria 943
177 Ga0105243_10048998 3300009148 Bacteria 3332
178 Ga0105241_10872107 3300009174 Bacteria 834
179 Ga0105242_12756120 3300009176 Bacteria 542
180 Ga0105237_11757777 3300009545 Unclassified 628
181 Ga0105249_10616098 3300009553 Bacteria 1141
182 Ga0105249_10981888 3300009553 Unclassified 913
183 Ga0099796_10006253 3300010159 Bacteria 3034
184 Ga0105246_10552891 3300011119 Bacteria 987
185 Ga0157373_10227938 3300013100 Bacteria 1315
186 Ga0157370_10011055 3300013104 Bacteria 9465
187 Ga0157370_10027199 3300013104 Bacteria 5640
188 Ga0157370_10511522 3300013104 Bacteria 1102
189 Ga0157374_10071241 3300013296 Bacteria 3277
190 Ga0163162_10013825 3300013306 Bacteria 7885
191 Ga0163162_10577631 3300013306 Bacteria 1251
192 Ga0163162_10870571 3300013306 Unclassified 1015
193 Ga0157372_10049929 3300013307 Bacteria 4654
194 Ga0157372_10056098 3300013307 Bacteria 4402
195 Ga0157372_10901796 3300013307 Bacteria 1026
196 Ga0157372_12035406 3300013307 Unclassified 660
197 Ga0157375_10290088 3300013308 Bacteria 1799
198 Ga0157375_10542756 3300013308 Unclassified 1325
199 Ga0157380_13033198 3300014326 Bacteria 535
200 Ga0182008_10109803 3300014497 Bacteria 1367
201 Ga0157379_10240345 3300014968 Bacteria 1643
202 Ga0157376_10026921 3300014969 Bacteria 4551
203 Ga0157376_10220629 3300014969 Bacteria 1756
204 Ga0163161_10186550 3300017792 Bacteria 1592
205 Ga0207697_10006711 3300025315 Bacteria 5184
206 Ga0207656_10096819 3300025321 Bacteria 1347
207 Ga0207656_10147928 3300025321 Bacteria 1111
208 Ga0207653_10212985 3300025885 Unclassified 732
209 Ga0207682_10015599 3300025893 Bacteria 2958
210 Ga0207692_10006075 3300025898 Bacteria 4884
211 Ga0207692_10009684 3300025898 Bacteria 4034
212 Ga0207688_10353255 3300025901 Bacteria 906
213 Ga0207680_10033126 3300025903 Bacteria 2944
214 Ga0207699_10022135 3300025906 Unclassified 3440
215 Ga0207699_10370133 3300025906 Bacteria 1015
216 Ga0207699_10675523 3300025906 Bacteria 755
217 Ga0207699_11036388 3300025906 Bacteria 607
218 Ga0207645_10018029 3300025907 Bacteria 4653
219 Ga0207645_10408321 3300025907 Unclassified 914
220 Ga0207643_10040181 3300025908 Bacteria 2633
221 Ga0207684_10065964 3300025910 Bacteria 3074
222 Ga0207684_10115540 3300025910 Bacteria 2299
223 Ga0207684_11065529 3300025910 Bacteria 674
224 Ga0207707_10708436 3300025912 Unclassified 845
225 Ga0207707_10847154 3300025912 Bacteria 759
226 Ga0207695_10126933 3300025913 Bacteria 2512
227 Ga0207695_10134752 3300025913 Bacteria 2424
228 Ga0207693_10002358 3300025915 Bacteria 16401
229 Ga0207693_10003272 3300025915 Bacteria 13869
230 Ga0207663_10000257 3300025916 Bacteria 23123
231 Ga0207663_10011681 3300025916 Unclassified 4724
232 Ga0207663_10171572 3300025916 Bacteria 1541
233 Ga0207663_10587941 3300025916 Bacteria 874
234 Ga0207663_11036283 3300025916 Unclassified 659
235 Ga0207660_10002949 3300025917 Bacteria 11123
236 Ga0207660_10067956 3300025917 Bacteria 2583
237 Ga0207660_10976522 3300025917 Unclassified 691
238 Ga0207662_10043236 3300025918 Bacteria 2657
239 Ga0207652_10027490 3300025921 Bacteria 4740
240 Ga0207646_10045807 3300025922 Bacteria 3925
241 Ga0207646_10073907 3300025922 Bacteria 3045
242 Ga0207646_10115509 3300025922 Unclassified 2411
243 Ga0207646_10273917 3300025922 Bacteria 1525
244 Ga0207681_10019665 3300025923 Bacteria 4270
245 Ga0207650_10158899 3300025925 Bacteria 1789
246 Ga0207659_10081772 3300025926 Bacteria 2389
247 Ga0207659_10185019 3300025926 Bacteria 1653
248 Ga0207687_10047456 3300025927 Bacteria 2977
249 Ga0207687_10521938 3300025927 Bacteria 993
250 Ga0207664_10107895 3300025929 Bacteria 2311
251 Ga0207664_10518062 3300025929 Bacteria 1069
252 Ga0207664_10543013 3300025929 Bacteria 1042
253 Ga0207644_10090376 3300025931 Bacteria 2281
254 Ga0207706_10237945 3300025933 Bacteria 1592
255 Ga0207706_10547890 3300025933 Bacteria 996
256 Ga0207706_10558406 3300025933 Unclassified 985
257 Ga0207709_10028112 3300025935 Bacteria 3248
258 Ga0207704_10013083 3300025938 Bacteria 4141
259 Ga0207665_10000218 3300025939 Bacteria 38759
260 Ga0207665_10033597 3300025939 Bacteria 3401
261 Ga0207665_10117608 3300025939 Bacteria 1875
262 Ga0207665_10288437 3300025939 Unclassified 1223
263 Ga0207691_10000804 3300025940 Bacteria 31184
264 Ga0207691_10005913 3300025940 Bacteria 11816
265 Ga0207691_11048069 3300025940 Bacteria 680
266 Ga0207711_10082776 3300025941 Bacteria 2806
267 Ga0207689_10025502 3300025942 Bacteria 4954
268 Ga0207661_10004197 3300025944 Bacteria 10080
269 Ga0207667_11165321 3300025949 Bacteria 751
270 Ga0207651_10513396 3300025960 Bacteria 1037
271 Ga0207651_11022290 3300025960 Bacteria 739
272 Ga0207712_10222282 3300025961 Bacteria 1510
273 Ga0207712_10337692 3300025961 Bacteria 1248
274 Ga0207668_10054173 3300025972 Bacteria 2784
275 Ga0207668_10430661 3300025972 Bacteria 1121
276 Ga0207668_10533658 3300025972 Bacteria 1014
277 Ga0207640_10891971 3300025981 Bacteria 776
278 Ga0207658_10011109 3300025986 Bacteria 6133
279 Ga0207677_10019926 3300026023 Bacteria 4061
280 Ga0207703_10010974 3300026035 Bacteria 7059
281 Ga0207678_10119890 3300026067 Bacteria 2245
282 Ga0207708_10188657 3300026075 Bacteria 1640
283 Ga0207708_10278431 3300026075 Bacteria 1355
284 Ga0207708_10303423 3300026075 Bacteria 1299
285 Ga0207708_10763636 3300026075 Bacteria 830
286 Ga0207708_10789027 3300026075 Unclassified 817
287 Ga0207641_10044175 3300026088 Bacteria 3746
288 Ga0207641_10389627 3300026088 Bacteria 1336
289 Ga0207648_10002229 3300026089 Bacteria 20989
290 Ga0207648_10113870 3300026089 Bacteria 2376
291 Ga0207648_10172782 3300026089 Bacteria 1911
292 Ga0207648_10344368 3300026089 Bacteria 1343
293 Ga0207676_10120144 3300026095 Bacteria 2214
294 Ga0207676_12158594 3300026095 Unclassified 555
295 Ga0207675_100047165 3300026118 Bacteria 4023
296 Ga0207675_100161707 3300026118 Unclassified 2136
297 Ga0207675_101166597 3300026118 Bacteria 790
298 Ga0207683_10001219 3300026121 Bacteria 23337
299 Ga0207698_10171986 3300026142 Bacteria 1909
300 Ga0209983_1077215 3300027665 Bacteria 745
301 Ga0209971_1038447 3300027682 Unclassified 1152
302 Ga0209974_10122245 3300027876 Unclassified 923
303 Ga0209974_10198654 3300027876 Unclassified 740
304 Ga0207428_10001370 3300027907 Bacteria 25833
305 Ga0207428_10306225 3300027907 Bacteria 1175
306 Ga0268266_10275684 3300028379 Bacteria 1562
307 Ga0268265_10090118 3300028380 Bacteria 2449
308 Ga0268265_10500587 3300028380 Bacteria 1145
309 Ga0268265_10731339 3300028380 Bacteria 959
310 Ga0268265_11436526 3300028380 Bacteria 692
311 Ga0268264_10046317 3300028381 Bacteria 3612
312 Ga0268264_10884991 3300028381 Bacteria 896
313 Ga0268264_11168421 3300028381 Unclassified 779
314 Ga0265337_1012476 3300028556 Bacteria 2887
315 Ga0265326_10000286 3300028558 Bacteria 22881
316 Ga0265319_1000166 3300028563 Bacteria 50092
317 Ga0265318_10005609 3300028577 Bacteria 5878
318 Ga0265318_10052358 3300028577 Bacteria 1532
319 Ga0265323_10000366 3300028653 Bacteria 26000
320 Ga0265322_10000146 3300028654 Bacteria 32989
321 Ga0265336_10051241 3300028666 Bacteria 1247
322 Ga0265338_10015652 3300028800 Bacteria 8310
323 Ga0265324_10004556 3300029957 Bacteria 6206
324 Ga0265330_10001212 3300031235 Bacteria 15219
325 Ga0265332_10001061 3300031238 Bacteria 16090
326 Ga0265328_10006665 3300031239 Bacteria 4862
327 Ga0265320_10001443 3300031240 Bacteria 17316
328 Ga0265325_10041729 3300031241 Bacteria 2403
329 Ga0265325_10055262 3300031241 Bacteria 2030
330 Ga0265329_10000080 3300031242 Bacteria 44303
331 Ga0265339_10014351 3300031249 Bacteria 4775
332 Ga0265339_10057957 3300031249 Bacteria 2093
333 Ga0265331_10004186 3300031250 Bacteria 9042
334 Ga0265316_10006366 3300031344 Bacteria 11291
335 Ga0307408_100252932 3300031548 Bacteria 1454
336 Ga0265314_10003319 3300031711 Bacteria 15688
337 Ga0265342_10001330 3300031712 Bacteria 23197
338 Ga0307405_10150897 3300031731 Bacteria 1634
339 Ga0307413_10000789 3300031824 Bacteria 10991
340 Ga0307413_10561718 3300031824 Bacteria 927
341 Ga0307410_10000184 3300031852 Bacteria 23025
342 Ga0307407_10039859 3300031903 Bacteria 2615
343 Ga0307412_10377928 3300031911 Bacteria 1146
344 Ga0307409_100113185 3300031995 Bacteria 2280
345 Ga0307409_100157676 3300031995 Bacteria 1980
346 Ga0307411_10000596 3300032005 Bacteria 12973
347 Ga0307411_10033003 3300032005 Bacteria 3206
348 Ga0307411_10774316 3300032005 Bacteria 843
349 Ga0307411_10788488 3300032005 Unclassified 836
350 Ga0373934_0001183 3300035086 Bacteria 9477
351 Ga0373956_0596838 3300035119 Bacteria 527
352 Ga0373961_0099523 3300035241 Bacteria 940
353 Ga0373927_0133005 3300035695 Bacteria 1625
354 Ga0436361_0719028 3300039447 Unclassified 803
355 Ga0436363_0468146 3300039450 Bacteria 780
356 Ga0436363_0610965 3300039450 Bacteria 2443
357 Ga0439464_0058294 3300042439 Bacteria 1127
358 Ga0451577_0095301 3300042876 Bacteria 2657
359 Ga0451577_0172362 3300042876 Bacteria 1950
360 Ga0451577_0201391 3300042876 Bacteria 1797
361 Ga0451577_1638670 3300042876 Bacteria 567
362 Ga0466969_0005311 3300044656 Bacteria 6854
363 Ga0453683_0178450 3300044673 Bacteria 1346
364 Ga0453683_0740429 3300044673 Unclassified 645
365 Ga0466966_0083195 3300044684 Bacteria 1992
366 Ga0466961_0013568 3300044693 Bacteria 5218
367 Ga0466961_0258484 3300044693 Bacteria 1068
368 Ga0453684_0149169 3300044712 Bacteria 2781
369 Ga0453684_0244402 3300044712 Bacteria 2064
370 Ga0453684_1437727 3300044712 Bacteria 714
371 Ga0466960_0145400 3300044901 Bacteria 1262
372 Ga0451576_0028782 3300045051 Bacteria 5950
373 Ga0451576_0153748 3300045051 Bacteria 2399
374 Ga0451576_0220149 3300045051 Bacteria 1982
375 Ga0451576_0753730 3300045051 Bacteria 1023
376 Ga0466967_0754226 3300045976 Bacteria 965
377 Ga0495664_0049276 3300046477 Bacteria 2500
378 Ga0495666_0127000 3300046526 Bacteria 1192
379 Ga0495642_0075636 3300046528 Bacteria 1413
380 Ga0495652_0284641 3300046529 Bacteria 1209
381 Ga0495623_0244111 3300046679 Bacteria 1013
382 Ga0495669_0357717 3300046684 Bacteria 706
383 Ga0495604_0341780 3300047317 Bacteria 996
384 Ga0495677_0123323 3300047445 Bacteria 989
385 Ga0496101_0905927 3300048904 Bacteria 694
386 Ga0496102_0067740 3300048905 Bacteria 3275
387 Ga0496102_0511901 3300048905 Bacteria 1123
388 Ga0496103_0318517 3300048906 Bacteria 1000
389 Ga0496106_0371749 3300048909 Unclassified 1149
390 Ga0496107_0017845 3300048910 Bacteria 4995
391 Ga0496109_0053407 3300048912 Bacteria 3685
392 Ga0496109_0240997 3300048912 Bacteria 1702
393 Ga0496110_0936080 3300048913 Bacteria 773
394 Ga0496112_1126667 3300048915 Bacteria 702
395 Ga0501031_0573612 3300049568 Bacteria 726
396 Ga0501031_0753523 3300049568 Unclassified 625
397 Ga0501032_0002078 3300049569 Bacteria 15813
398 Ga0501033_0458066 3300049570 Bacteria 885
399 Ga0501033_0599581 3300049570 Bacteria 755
400 Ga0501034_0005133 3300049571 Bacteria 14366
401 Ga0501036_0053656 3300049572 Bacteria 3414
402 Ga0501037_0000204 3300049573 Bacteria 53465
403 Ga0501038_0002909 3300049574 Bacteria 15962
404 Ga0501038_0226999 3300049574 Bacteria 1488
405 Ga0501039_0040072 3300049575 Bacteria 3616
406 Ga0501040_0006581 3300049576 Bacteria 7539
407 Ga0501041_0104570 3300049577 Unclassified 1754
408 Ga0501042_0183520 3300049578 Bacteria 1509
409 Ga0501043_0001111 3300049579 Bacteria 23667
410 Ga0501043_0359669 3300049579 Bacteria 1105
411 Ga0501046_0169398 3300049580 Bacteria 1640
412 Ga0501047_0364322 3300049581 Bacteria 1281
413 Ga0501048_0011277 3300049582 Bacteria 6665
414 Ga0501067_0243203 3300049583 Bacteria 1001
415 Ga0501067_0358330 3300049583 Bacteria 813
416 Ga0501068_0418888 3300049584 Bacteria 865
417 Ga0501069_1027813 3300049585 Bacteria 504
418 Ga0501070_0000679 3300049586 Bacteria 31214
419 Ga0501070_0578894 3300049586 Unclassified 897
420 Ga0501071_0132987 3300049587 Bacteria 1849
421 Ga0501071_0426190 3300049587 Bacteria 1014
422 Ga0501072_0071473 3300049588 Unclassified 2742
423 Ga0501072_0457804 3300049588 Bacteria 1010
424 Ga0501073_0335066 3300049589 Bacteria 1044
425 Ga0501074_0255342 3300049590 Bacteria 1247
426 Ga0501074_0258985 3300049590 Bacteria 1237
427 Ga0501074_0891875 3300049590 Bacteria 626
428 Ga0501075_0030764 3300049591 Bacteria 3978
429 Ga0501075_1330356 3300049591 Bacteria 544
430 Ga0501076_0155102 3300049592 Bacteria 1864
431 Ga0501076_0775015 3300049592 Bacteria 791
432 Ga0501077_0193582 3300049593 Bacteria 1292
433 Ga0501077_0262467 3300049593 Bacteria 1098
434 Ga0501077_0657803 3300049593 Bacteria 673
435 Ga0501235_117399 3300049669 Bacteria 663
436 Ga0501079_0154892 3300049741 Bacteria 1786
437 Ga0501079_0425734 3300049741 Bacteria 1042
438 Ga0501080_0278776 3300049742 Bacteria 1520
439 Ga0501080_0941306 3300049742 Bacteria 751
440 Ga0501081_0152250 3300049743 Bacteria 1662
441 Ga0501081_0940172 3300049743 Bacteria 652
442 Ga0501081_0981899 3300049743 Unclassified 638
443 Ga0501035_0415594 3300049822 Bacteria 1117
444 Ga0501045_0025209 3300049824 Bacteria 4273
445 Ga0501045_0204758 3300049824 Bacteria 1470
446 nmdc:mga03n38_14090_c1 3300050490 Bacteria 3057
447 nmdc:mga05p37_141838_c1 3300050507 Bacteria 2943
448 nmdc:mga05p37_153647_c1 3300050507 Bacteria 2814
449 nmdc:mga05p37_165347_c1 3300050507 Bacteria 2700
450 nmdc:mga05p37_657952_c1 3300050507 Bacteria 1172
451 nmdc:mga06r32_604324_c1 3300050510 Bacteria 1067
452 nmdc:mga08y16_1105531_c1 3300050511 Bacteria 767
453 nmdc:mga08y16_743_c1 3300050511 Bacteria 31040
454 nmdc:mga0n895_1662610_c1 3300050512 Unclassified 602
455 nmdc:mga0n895_179252_c1 3300050512 Unclassified 2150
456 nmdc:mga0n895_593287_c1 3300050512 Bacteria 1111
457 nmdc:mga08x19_10009_c1 3300050514 Bacteria 5684
458 nmdc:mga08x19_122137_c1 3300050514 Bacteria 1747
459 nmdc:mga08x19_192969_c1 3300050514 Bacteria 1394
460 nmdc:mga08x19_274665_c1 3300050514 Bacteria 1167
461 nmdc:mga08x19_280776_c1 3300050514 Bacteria 1154
462 nmdc:mga08x19_49539_c1 3300050514 Bacteria 2694
463 nmdc:mga0a205_1038901_c1 3300050515 Bacteria 666
464 nmdc:mga0a205_1062910_c1 3300050515 Unclassified 657
465 nmdc:mga0a205_393945_c1 3300050515 Unclassified 1249
466 Ga0495601_0216797 3300053077 Bacteria 1250
467 Ga0495619_0012485 3300053085 Bacteria 5350
468 Ga0500652_000368 3300053131 Bacteria 16224
469 Ga0501084_0094740 3300054114 Bacteria 2507
470 Ga0501084_0375678 3300054114 Bacteria 1201
471 Ga0501084_1545903 3300054114 Unclassified 555
472 Ga0501082_1359078 3300060353 Bacteria 620
473 Ga0530510_0522529 3300061734 Bacteria 900
474 Ga0530510_1103074 3300061734 Unclassified 608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100810859 Ga0070668_1008108591 117
2 3300005578 Ga0068854_100345262 Ga0068854_1003452624 117
3 3300006881 Ga0068865_101605668 Ga0068865_1016056682 117
4 3300009098 Ga0105245_10036254 Ga0105245_100362546 117
5 3300025901 Ga0207688_10353255 Ga0207688_103532552 117
6 3300025927 Ga0207687_10047456 Ga0207687_100474562 117
7 3300025933 Ga0207706_10547890 Ga0207706_105478902 117
8 3300025949 Ga0207667_11165321 Ga0207667_111653212 117
9 3300025972 Ga0207668_10533658 Ga0207668_105336582 117
10 3300028380 Ga0268265_10731339 Ga0268265_107313391 117
11 iso_pu_bacteria 2738543034 2739363646 117
12 3300006048 Ga0075363_100024360 Ga0075363_1000243604 120
13 3300006051 Ga0075364_10746668 Ga0075364_107466682 120
14 3300006186 Ga0075369_10076148 Ga0075369_100761482 120
15 3300050490 nmdc:mga03n38_14090_c1 nmdc:mga03n38_14090_c1_2257_2619 120
16 3300005459 Ga0068867_100187477 Ga0068867_1001874773 121
17 3300005546 Ga0070696_100142736 Ga0070696_1001427364 121
18 3300009148 Ga0105243_10048998 Ga0105243_100489984 121
19 3300025935 Ga0207709_10028112 Ga0207709_100281122 121
20 3300026089 Ga0207648_10113870 Ga0207648_101138704 121
21 3300032005 Ga0307411_10774316 Ga0307411_107743162 121
22 3300053131 Ga0500652_000368 Ga0500652_000368_14565_14933 121
23 3300049569 Ga0501032_0002078 Ga0501032_0002078_6505_6909 122
24 3300049570 Ga0501033_0599581 Ga0501033_0599581_18_422 122
25 3300049571 Ga0501034_0005133 Ga0501034_0005133_5986_6390 122
26 3300049572 Ga0501036_0053656 Ga0501036_0053656_1219_1623 122
27 3300049573 Ga0501037_0000204 Ga0501037_0000204_15349_15753 122
28 3300049574 Ga0501038_0002909 Ga0501038_0002909_4377_4781 122
29 3300049575 Ga0501039_0040072 Ga0501039_0040072_432_836 122
30 3300049579 Ga0501043_0001111 Ga0501043_0001111_10214_10618 122
31 3300049581 Ga0501047_0364322 Ga0501047_0364322_325_729 122
32 3300049586 Ga0501070_0000679 Ga0501070_0000679_29261_29665 122
33 3300049588 Ga0501072_0457804 Ga0501072_0457804_376_780 122
34 3300049589 Ga0501073_0335066 Ga0501073_0335066_546_950 122
35 3300049593 Ga0501077_0262467 Ga0501077_0262467_435_839 122
36 3300005444 Ga0070694_100261419 Ga0070694_1002614192 124
37 3300005546 Ga0070696_100261245 Ga0070696_1002612452 124
38 3300009174 Ga0105241_10872107 Ga0105241_108721072 126
39 3300013104 Ga0157370_10027199 Ga0157370_100271995 126
40 3300013307 Ga0157372_10056098 Ga0157372_100560982 126
41 3300049743 Ga0501081_0981899 Ga0501081_0981899_216_605 126
42 iso_pu_bacteria 2551306166 2552105012 126
43 3300005295 Ga0065707_10299105 Ga0065707_102991051 127
44 3300005329 Ga0070683_100213033 Ga0070683_1002130333 127
45 3300005441 Ga0070700_101126726 Ga0070700_1011267261 127
46 3300014497 Ga0182008_10109803 Ga0182008_101098032 127
47 3300026075 Ga0207708_10789027 Ga0207708_107890272 127
48 3300044656 Ga0466969_0005311 Ga0466969_0005311_5030_5413 127
49 3300044693 Ga0466961_0013568 Ga0466961_0013568_4805_5188 127
50 3300048913 Ga0496110_0936080 Ga0496110_0936080_372_761 127
51 3300049587 Ga0501071_0132987 Ga0501071_0132987_974_1357 127
52 3300049590 Ga0501074_0258985 Ga0501074_0258985_619_1002 127
53 3300049591 Ga0501075_0030764 Ga0501075_0030764_990_1373 127
54 3300049591 Ga0501075_1330356 Ga0501075_1330356_133_516 127
55 3300049741 Ga0501079_0154892 Ga0501079_0154892_442_825 127
56 3300049742 Ga0501080_0278776 Ga0501080_0278776_349_732 127
57 3300054114 Ga0501084_1545903 Ga0501084_1545903_133_516 127
58 3300005336 Ga0070680_100502787 Ga0070680_1005027872 128
59 3300005336 Ga0070680_100802305 Ga0070680_1008023051 128
60 3300005355 Ga0070671_100545707 Ga0070671_1005457071 128
61 3300005355 Ga0070671_101645775 Ga0070671_1016457751 128
62 3300005435 Ga0070714_100220512 Ga0070714_1002205121 128
63 3300005435 Ga0070714_101044975 Ga0070714_1010449751 128
64 3300005440 Ga0070705_101413532 Ga0070705_1014135321 128
65 3300005458 Ga0070681_10313881 Ga0070681_103138812 128
66 3300005468 Ga0070707_100423613 Ga0070707_1004236132 128
67 3300005518 Ga0070699_100362318 Ga0070699_1003623183 128
68 3300005518 Ga0070699_101750830 Ga0070699_1017508301 128
69 3300005535 Ga0070684_100261152 Ga0070684_1002611522 128
70 3300006028 Ga0070717_10397681 Ga0070717_103976812 128
71 3300006175 Ga0070712_101833010 Ga0070712_1018330101 128
72 3300006852 Ga0075433_10379295 Ga0075433_103792952 128
73 3300006871 Ga0075434_100884449 Ga0075434_1008844492 128
74 3300006871 Ga0075434_101414506 Ga0075434_1014145062 128
75 3300006914 Ga0075436_100002382 Ga0075436_1000023822 128
76 3300006914 Ga0075436_100003740 Ga0075436_1000037402 128
77 3300006914 Ga0075436_100007210 Ga0075436_1000072103 128
78 3300006914 Ga0075436_100679895 Ga0075436_1006798951 128
79 3300007076 Ga0075435_100165742 Ga0075435_1001657422 128
80 3300009093 Ga0105240_10032351 Ga0105240_100323512 128
81 3300009094 Ga0111539_10000937 Ga0111539_1000093736 128
82 3300009553 Ga0105249_10981888 Ga0105249_109818882 128
83 3300013100 Ga0157373_10227938 Ga0157373_102279381 128
84 3300013104 Ga0157370_10511522 Ga0157370_105115221 128
85 3300013307 Ga0157372_12035406 Ga0157372_120354061 128
86 3300025913 Ga0207695_10134752 Ga0207695_101347522 128
87 3300025929 Ga0207664_10107895 Ga0207664_101078952 128
88 3300027907 Ga0207428_10001370 Ga0207428_1000137016 128
89 3300031249 Ga0265339_10057957 Ga0265339_100579572 128
90 3300035119 Ga0373956_0596838 Ga0373956_0596838_60_446 128
91 3300042439 Ga0439464_0058294 Ga0439464_0058294_589_984 128
92 3300044684 Ga0466966_0083195 Ga0466966_0083195_306_746 128
93 3300046477 Ga0495664_0049276 Ga0495664_0049276_1855_2241 128
94 3300046526 Ga0495666_0127000 Ga0495666_0127000_14_400 128
95 3300046529 Ga0495652_0284641 Ga0495652_0284641_539_925 128
96 3300046679 Ga0495623_0244111 Ga0495623_0244111_135_521 128
97 3300047317 Ga0495604_0341780 Ga0495604_0341780_128_514 128
98 3300049568 Ga0501031_0573612 Ga0501031_0573612_271_657 128
99 3300049570 Ga0501033_0458066 Ga0501033_0458066_451_846 128
100 3300049574 Ga0501038_0226999 Ga0501038_0226999_457_852 128
101 3300049576 Ga0501040_0006581 Ga0501040_0006581_4763_5158 128
102 3300049577 Ga0501041_0104570 Ga0501041_0104570_79_474 128
103 3300049578 Ga0501042_0183520 Ga0501042_0183520_321_716 128
104 3300049579 Ga0501043_0359669 Ga0501043_0359669_373_768 128
105 3300049580 Ga0501046_0169398 Ga0501046_0169398_89_484 128
106 3300049582 Ga0501048_0011277 Ga0501048_0011277_251_646 128
107 3300049583 Ga0501067_0243203 Ga0501067_0243203_344_730 128
108 3300049583 Ga0501067_0358330 Ga0501067_0358330_142_531 128
109 3300049584 Ga0501068_0418888 Ga0501068_0418888_343_729 128
110 3300049585 Ga0501069_1027813 Ga0501069_1027813_74_460 128
111 3300049587 Ga0501071_0426190 Ga0501071_0426190_367_762 128
112 3300049588 Ga0501072_0071473 Ga0501072_0071473_1094_1489 128
113 3300049590 Ga0501074_0255342 Ga0501074_0255342_521_916 128
114 3300049592 Ga0501076_0775015 Ga0501076_0775015_375_761 128
115 3300049593 Ga0501077_0193582 Ga0501077_0193582_262_648 128
116 3300049742 Ga0501080_0941306 Ga0501080_0941306_47_442 128
117 3300049743 Ga0501081_0940172 Ga0501081_0940172_133_528 128
118 3300049822 Ga0501035_0415594 Ga0501035_0415594_82_477 128
119 3300049824 Ga0501045_0025209 Ga0501045_0025209_2083_2478 128
120 3300050507 nmdc:mga05p37_657952_c1 nmdc:mga05p37_657952_c1_151_540 128
121 3300050511 nmdc:mga08y16_1105531_c1 nmdc:mga08y16_1105531_c1_89_475 128
122 3300050511 nmdc:mga08y16_743_c1 nmdc:mga08y16_743_c1_28817_29203 128
123 3300050512 nmdc:mga0n895_1662610_c1 nmdc:mga0n895_1662610_c1_15_401 128
124 3300050514 nmdc:mga08x19_10009_c1 nmdc:mga08x19_10009_c1_1050_1436 128
125 3300050514 nmdc:mga08x19_192969_c1 nmdc:mga08x19_192969_c1_612_998 128
126 3300050514 nmdc:mga08x19_274665_c1 nmdc:mga08x19_274665_c1_691_1077 128
127 3300050514 nmdc:mga08x19_280776_c1 nmdc:mga08x19_280776_c1_456_842 128
128 3300050515 nmdc:mga0a205_393945_c1 nmdc:mga0a205_393945_c1_690_1076 128
129 3300053077 Ga0495601_0216797 Ga0495601_0216797_754_1161 128
130 3300053085 Ga0495619_0012485 Ga0495619_0012485_132_518 128
131 3300054114 Ga0501084_0094740 Ga0501084_0094740_1618_2013 128
132 3300060353 Ga0501082_1359078 Ga0501082_1359078_126_521 128
133 3300061734 Ga0530510_0522529 Ga0530510_0522529_73_459 128
134 3300005295 Ga0065707_10091894 Ga0065707_100918944 129
135 3300005333 Ga0070677_10003249 Ga0070677_100032493 129
136 3300005334 Ga0068869_100030771 Ga0068869_1000307714 129
137 3300005335 Ga0070666_10070202 Ga0070666_100702023 129
138 3300005338 Ga0068868_100002049 Ga0068868_10000204917 129
139 3300005347 Ga0070668_100156600 Ga0070668_1001566002 129
140 3300005347 Ga0070668_100283662 Ga0070668_1002836623 129
141 3300005353 Ga0070669_100013749 Ga0070669_1000137493 129
142 3300005354 Ga0070675_100087767 Ga0070675_1000877673 129
143 3300005355 Ga0070671_100041303 Ga0070671_1000413036 129
144 3300005356 Ga0070674_100026115 Ga0070674_1000261155 129
145 3300005364 Ga0070673_100044745 Ga0070673_1000447453 129
146 3300005364 Ga0070673_100269348 Ga0070673_1002693483 129
147 3300005367 Ga0070667_100041868 Ga0070667_1000418683 129
148 3300005434 Ga0070709_10071052 Ga0070709_100710521 129
149 3300005434 Ga0070709_10458392 Ga0070709_104583922 129
150 3300005434 Ga0070709_10749340 Ga0070709_107493402 129
151 3300005435 Ga0070714_100280606 Ga0070714_1002806063 129
152 3300005435 Ga0070714_101081722 Ga0070714_1010817222 129
153 3300005437 Ga0070710_10710258 Ga0070710_107102582 129
154 3300005440 Ga0070705_100912997 Ga0070705_1009129972 129
155 3300005441 Ga0070700_100865123 Ga0070700_1008651232 129
156 3300005444 Ga0070694_100014468 Ga0070694_1000144683 129
157 3300005444 Ga0070694_100185930 Ga0070694_1001859302 129
158 3300005444 Ga0070694_101400260 Ga0070694_1014002601 129
159 3300005445 Ga0070708_100076019 Ga0070708_1000760192 129
160 3300005456 Ga0070678_100010475 Ga0070678_1000104753 129
161 3300005459 Ga0068867_100091066 Ga0068867_1000910664 129
162 3300005466 Ga0070685_10269173 Ga0070685_102691732 129
163 3300005467 Ga0070706_100160899 Ga0070706_1001608992 129
164 3300005467 Ga0070706_101313505 Ga0070706_1013135051 129
165 3300005468 Ga0070707_100137795 Ga0070707_1001377953 129
166 3300005468 Ga0070707_100566956 Ga0070707_1005669562 129
167 3300005468 Ga0070707_101113677 Ga0070707_1011136772 129
168 3300005471 Ga0070698_100001382 Ga0070698_1000013828 129
169 3300005471 Ga0070698_100007510 Ga0070698_1000075109 129
170 3300005471 Ga0070698_100396532 Ga0070698_1003965323 129
171 3300005518 Ga0070699_100016628 Ga0070699_1000166287 129
172 3300005518 Ga0070699_100020457 Ga0070699_1000204576 129
173 3300005518 Ga0070699_100139231 Ga0070699_1001392314 129
174 3300005518 Ga0070699_101307530 Ga0070699_1013075302 129
175 3300005530 Ga0070679_100026362 Ga0070679_1000263622 129
176 3300005536 Ga0070697_100092497 Ga0070697_1000924971 129
177 3300005536 Ga0070697_100103208 Ga0070697_1001032084 129
178 3300005536 Ga0070697_100148346 Ga0070697_1001483462 129
179 3300005536 Ga0070697_100594393 Ga0070697_1005943931 129
180 3300005543 Ga0070672_100017094 Ga0070672_1000170946 129
181 3300005545 Ga0070695_100751601 Ga0070695_1007516011 129
182 3300005546 Ga0070696_100010817 Ga0070696_1000108175 129
183 3300005548 Ga0070665_100114642 Ga0070665_1001146422 129
184 3300005549 Ga0070704_100040330 Ga0070704_1000403302 129
185 3300005617 Ga0068859_100148999 Ga0068859_1001489993 129
186 3300005618 Ga0068864_100098875 Ga0068864_1000988754 129
187 3300005718 Ga0068866_10940939 Ga0068866_109409392 129
188 3300005719 Ga0068861_100067812 Ga0068861_1000678125 129
189 3300005840 Ga0068870_10033442 Ga0068870_100334422 129
190 3300005841 Ga0068863_100012406 Ga0068863_1000124069 129
191 3300005841 Ga0068863_100038952 Ga0068863_1000389523 129
192 3300005842 Ga0068858_100001708 Ga0068858_1000017083 129
193 3300005842 Ga0068858_100551562 Ga0068858_1005515622 129
194 3300005843 Ga0068860_100001391 Ga0068860_10000139125 129
195 3300005844 Ga0068862_100089032 Ga0068862_1000890323 129
196 3300005844 Ga0068862_100632946 Ga0068862_1006329462 129
197 3300005844 Ga0068862_101163671 Ga0068862_1011636712 129
198 3300005844 Ga0068862_101401815 Ga0068862_1014018151 129
199 3300006028 Ga0070717_10007885 Ga0070717_100078857 129
200 3300006028 Ga0070717_10122298 Ga0070717_101222982 129
201 3300006163 Ga0070715_10168594 Ga0070715_101685942 129
202 3300006173 Ga0070716_100026809 Ga0070716_1000268093 129
203 3300006173 Ga0070716_100045535 Ga0070716_1000455352 129
204 3300006173 Ga0070716_100214354 Ga0070716_1002143542 129
205 3300006173 Ga0070716_100313276 Ga0070716_1003132762 129
206 3300006175 Ga0070712_100000459 Ga0070712_10000045914 129
207 3300006237 Ga0097621_100013100 Ga0097621_1000131003 129
208 3300006358 Ga0068871_100033307 Ga0068871_1000333072 129
209 3300006847 Ga0075431_100082522 Ga0075431_1000825222 129
210 3300006871 Ga0075434_100016099 Ga0075434_1000160992 129
211 3300006881 Ga0068865_100111126 Ga0068865_1001111263 129
212 3300006914 Ga0075436_100002153 Ga0075436_1000021533 129
213 3300006914 Ga0075436_100164719 Ga0075436_1001647193 129
214 3300006931 Ga0097620_100149003 Ga0097620_1001490033 129
215 3300007076 Ga0075435_100170502 Ga0075435_1001705022 129
216 3300009093 Ga0105240_10006761 Ga0105240_100067614 129
217 3300009098 Ga0105245_10868199 Ga0105245_108681992 129
218 3300009147 Ga0114129_10012808 Ga0114129_100128086 129
219 3300009147 Ga0114129_10499237 Ga0114129_104992372 129
220 3300009147 Ga0114129_10899043 Ga0114129_108990432 129
221 3300009147 Ga0114129_11203864 Ga0114129_112038642 129
222 3300009176 Ga0105242_12756120 Ga0105242_127561201 129
223 3300009545 Ga0105237_11757777 Ga0105237_117577772 129
224 3300009553 Ga0105249_10616098 Ga0105249_106160981 129
225 3300010159 Ga0099796_10006253 Ga0099796_100062533 129
226 3300011119 Ga0105246_10552891 Ga0105246_105528911 129
227 3300013104 Ga0157370_10011055 Ga0157370_100110553 129
228 3300013296 Ga0157374_10071241 Ga0157374_100712414 129
229 3300013306 Ga0163162_10013825 Ga0163162_100138256 129
230 3300013306 Ga0163162_10577631 Ga0163162_105776312 129
231 3300013307 Ga0157372_10049929 Ga0157372_100499294 129
232 3300013307 Ga0157372_10901796 Ga0157372_109017961 129
233 3300013308 Ga0157375_10290088 Ga0157375_102900883 129
234 3300014326 Ga0157380_13033198 Ga0157380_130331981 129
235 3300014968 Ga0157379_10240345 Ga0157379_102403454 129
236 3300014969 Ga0157376_10026921 Ga0157376_100269216 129
237 3300014969 Ga0157376_10220629 Ga0157376_102206293 129
238 3300017792 Ga0163161_10186550 Ga0163161_101865502 129
239 3300025315 Ga0207697_10006711 Ga0207697_100067114 129
240 3300025321 Ga0207656_10096819 Ga0207656_100968193 129
241 3300025321 Ga0207656_10147928 Ga0207656_101479281 129
242 3300025885 Ga0207653_10212985 Ga0207653_102129851 129
243 3300025893 Ga0207682_10015599 Ga0207682_100155993 129
244 3300025898 Ga0207692_10009684 Ga0207692_100096845 129
245 3300025903 Ga0207680_10033126 Ga0207680_100331265 129
246 3300025906 Ga0207699_10370133 Ga0207699_103701332 129
247 3300025906 Ga0207699_10675523 Ga0207699_106755232 129
248 3300025906 Ga0207699_11036388 Ga0207699_110363882 129
249 3300025907 Ga0207645_10018029 Ga0207645_100180296 129
250 3300025908 Ga0207643_10040181 Ga0207643_100401812 129
251 3300025910 Ga0207684_10065964 Ga0207684_100659643 129
252 3300025910 Ga0207684_11065529 Ga0207684_110655291 129
253 3300025912 Ga0207707_10708436 Ga0207707_107084362 129
254 3300025913 Ga0207695_10126933 Ga0207695_101269332 129
255 3300025916 Ga0207663_10000257 Ga0207663_1000025716 129
256 3300025916 Ga0207663_10587941 Ga0207663_105879412 129
257 3300025917 Ga0207660_10067956 Ga0207660_100679562 129
258 3300025917 Ga0207660_10976522 Ga0207660_109765222 129
259 3300025921 Ga0207652_10027490 Ga0207652_100274904 129
260 3300025922 Ga0207646_10073907 Ga0207646_100739072 129
261 3300025922 Ga0207646_10115509 Ga0207646_101155093 129
262 3300025922 Ga0207646_10273917 Ga0207646_102739172 129
263 3300025923 Ga0207681_10019665 Ga0207681_100196653 129
264 3300025925 Ga0207650_10158899 Ga0207650_101588992 129
265 3300025926 Ga0207659_10081772 Ga0207659_100817723 129
266 3300025927 Ga0207687_10521938 Ga0207687_105219382 129
267 3300025929 Ga0207664_10518062 Ga0207664_105180622 129
268 3300025929 Ga0207664_10543013 Ga0207664_105430132 129
269 3300025931 Ga0207644_10090376 Ga0207644_100903763 129
270 3300025938 Ga0207704_10013083 Ga0207704_100130833 129
271 3300025939 Ga0207665_10033597 Ga0207665_100335975 129
272 3300025939 Ga0207665_10117608 Ga0207665_101176083 129
273 3300025939 Ga0207665_10288437 Ga0207665_102884372 129
274 3300025940 Ga0207691_10000804 Ga0207691_1000080425 129
275 3300025940 Ga0207691_11048069 Ga0207691_110480692 129
276 3300025941 Ga0207711_10082776 Ga0207711_100827764 129
277 3300025942 Ga0207689_10025502 Ga0207689_100255023 129
278 3300025944 Ga0207661_10004197 Ga0207661_100041978 129
279 3300025960 Ga0207651_10513396 Ga0207651_105133962 129
280 3300025961 Ga0207712_10222282 Ga0207712_102222823 129
281 3300025961 Ga0207712_10337692 Ga0207712_103376922 129
282 3300025972 Ga0207668_10054173 Ga0207668_100541733 129
283 3300025972 Ga0207668_10430661 Ga0207668_104306613 129
284 3300025981 Ga0207640_10891971 Ga0207640_108919712 129
285 3300025986 Ga0207658_10011109 Ga0207658_100111098 129
286 3300026023 Ga0207677_10019926 Ga0207677_100199263 129
287 3300026035 Ga0207703_10010974 Ga0207703_100109744 129
288 3300026075 Ga0207708_10303423 Ga0207708_103034232 129
289 3300026075 Ga0207708_10763636 Ga0207708_107636362 129
290 3300026088 Ga0207641_10044175 Ga0207641_100441753 129
291 3300026088 Ga0207641_10389627 Ga0207641_103896272 129
292 3300026089 Ga0207648_10002229 Ga0207648_1000222920 129
293 3300026095 Ga0207676_10120144 Ga0207676_101201442 129
294 3300026095 Ga0207676_12158594 Ga0207676_121585942 129
295 3300026118 Ga0207675_100047165 Ga0207675_1000471655 129
296 3300026118 Ga0207675_101166597 Ga0207675_1011665972 129
297 3300026121 Ga0207683_10001219 Ga0207683_1000121926 129
298 3300027665 Ga0209983_1077215 Ga0209983_10772152 129
299 3300027682 Ga0209971_1038447 Ga0209971_10384472 129
300 3300027876 Ga0209974_10122245 Ga0209974_101222451 129
301 3300027876 Ga0209974_10198654 Ga0209974_101986542 129
302 3300027907 Ga0207428_10306225 Ga0207428_103062253 129
303 3300028379 Ga0268266_10275684 Ga0268266_102756843 129
304 3300028380 Ga0268265_10090118 Ga0268265_100901184 129
305 3300028380 Ga0268265_10500587 Ga0268265_105005872 129
306 3300028380 Ga0268265_11436526 Ga0268265_114365262 129
307 3300028381 Ga0268264_10046317 Ga0268264_100463174 129
308 3300028381 Ga0268264_10884991 Ga0268264_108849912 129
309 3300028556 Ga0265337_1012476 Ga0265337_10124762 129
310 3300028558 Ga0265326_10000286 Ga0265326_100002866 129
311 3300028563 Ga0265319_1000166 Ga0265319_100016638 129
312 3300028577 Ga0265318_10005609 Ga0265318_100056096 129
313 3300028577 Ga0265318_10052358 Ga0265318_100523582 129
314 3300028653 Ga0265323_10000366 Ga0265323_100003668 129
315 3300028654 Ga0265322_10000146 Ga0265322_1000014613 129
316 3300028666 Ga0265336_10051241 Ga0265336_100512412 129
317 3300028800 Ga0265338_10015652 Ga0265338_100156525 129
318 3300029957 Ga0265324_10004556 Ga0265324_100045562 129
319 3300031235 Ga0265330_10001212 Ga0265330_100012122 129
320 3300031238 Ga0265332_10001061 Ga0265332_100010613 129
321 3300031239 Ga0265328_10006665 Ga0265328_100066656 129
322 3300031240 Ga0265320_10001443 Ga0265320_100014436 129
323 3300031241 Ga0265325_10041729 Ga0265325_100417292 129
324 3300031241 Ga0265325_10055262 Ga0265325_100552622 129
325 3300031242 Ga0265329_10000080 Ga0265329_1000008034 129
326 3300031249 Ga0265339_10014351 Ga0265339_100143515 129
327 3300031250 Ga0265331_10004186 Ga0265331_100041866 129
328 3300031344 Ga0265316_10006366 Ga0265316_1000636612 129
329 3300031548 Ga0307408_100252932 Ga0307408_1002529322 129
330 3300031711 Ga0265314_10003319 Ga0265314_1000331911 129
331 3300031712 Ga0265342_10001330 Ga0265342_100013305 129
332 3300031824 Ga0307413_10000789 Ga0307413_1000078910 129
333 3300031824 Ga0307413_10561718 Ga0307413_105617182 129
334 3300031852 Ga0307410_10000184 Ga0307410_1000018412 129
335 3300031903 Ga0307407_10039859 Ga0307407_100398592 129
336 3300031911 Ga0307412_10377928 Ga0307412_103779282 129
337 3300031995 Ga0307409_100113185 Ga0307409_1001131852 129
338 3300031995 Ga0307409_100157676 Ga0307409_1001576762 129
339 3300032005 Ga0307411_10000596 Ga0307411_1000059613 129
340 3300032005 Ga0307411_10033003 Ga0307411_100330032 129
341 3300032005 Ga0307411_10788488 Ga0307411_107884882 129
342 3300035086 Ga0373934_0001183 Ga0373934_0001183_2944_3333 129
343 3300035241 Ga0373961_0099523 Ga0373961_0099523_177_569 129
344 3300039447 Ga0436361_0719028 Ga0436361_0719028_358_747 129
345 3300039450 Ga0436363_0468146 Ga0436363_0468146_140_535 129
346 3300042876 Ga0451577_0172362 Ga0451577_0172362_989_1378 129
347 3300044673 Ga0453683_0178450 Ga0453683_0178450_216_605 129
348 3300044673 Ga0453683_0740429 Ga0453683_0740429_190_579 129
349 3300044712 Ga0453684_0149169 Ga0453684_0149169_2059_2448 129
350 3300044901 Ga0466960_0145400 Ga0466960_0145400_807_1199 129
351 3300045051 Ga0451576_0220149 Ga0451576_0220149_1021_1413 129
352 3300045976 Ga0466967_0754226 Ga0466967_0754226_171_560 129
353 3300046528 Ga0495642_0075636 Ga0495642_0075636_214_603 129
354 3300046684 Ga0495669_0357717 Ga0495669_0357717_221_610 129
355 3300048904 Ga0496101_0905927 Ga0496101_0905927_176_574 129
356 3300048905 Ga0496102_0067740 Ga0496102_0067740_1657_2058 129
357 3300048905 Ga0496102_0511901 Ga0496102_0511901_366_758 129
358 3300048906 Ga0496103_0318517 Ga0496103_0318517_243_635 129
359 3300048909 Ga0496106_0371749 Ga0496106_0371749_648_1040 129
360 3300048912 Ga0496109_0240997 Ga0496109_0240997_817_1215 129
361 3300049568 Ga0501031_0753523 Ga0501031_0753523_63_455 129
362 3300049586 Ga0501070_0578894 Ga0501070_0578894_401_805 129
363 3300049590 Ga0501074_0891875 Ga0501074_0891875_55_447 129
364 3300049592 Ga0501076_0155102 Ga0501076_0155102_1140_1532 129
365 3300049593 Ga0501077_0657803 Ga0501077_0657803_110_502 129
366 3300049669 Ga0501235_117399 Ga0501235_117399_80_520 129
367 3300049741 Ga0501079_0425734 Ga0501079_0425734_369_761 129
368 3300049743 Ga0501081_0152250 Ga0501081_0152250_809_1201 129
369 3300049824 Ga0501045_0204758 Ga0501045_0204758_221_613 129
370 3300050507 nmdc:mga05p37_141838_c1 nmdc:mga05p37_141838_c1_2424_2813 129
371 3300050507 nmdc:mga05p37_153647_c1 nmdc:mga05p37_153647_c1_913_1305 129
372 3300050510 nmdc:mga06r32_604324_c1 nmdc:mga06r32_604324_c1_505_894 129
373 3300050512 nmdc:mga0n895_179252_c1 nmdc:mga0n895_179252_c1_957_1346 129
374 3300050514 nmdc:mga08x19_49539_c1 nmdc:mga08x19_49539_c1_875_1267 129
375 3300050515 nmdc:mga0a205_1038901_c1 nmdc:mga0a205_1038901_c1_235_624 129
376 3300054114 Ga0501084_0375678 Ga0501084_0375678_462_854 129
377 3300061734 Ga0530510_1103074 Ga0530510_1103074_54_449 129
378 2162886007 SwRhRL2b_contig_567951 SwRhRL2b_0767.00008300 130
379 3300005289 Ga0065704_10071645 Ga0065704_100716452 130
380 3300005336 Ga0070680_100261482 Ga0070680_1002614822 130
381 3300005341 Ga0070691_10277047 Ga0070691_102770472 130
382 3300005343 Ga0070687_100032957 Ga0070687_1000329572 130
383 3300005345 Ga0070692_10014762 Ga0070692_100147624 130
384 3300005347 Ga0070668_100088467 Ga0070668_1000884675 130
385 3300005354 Ga0070675_101122895 Ga0070675_1011228952 130
386 3300005364 Ga0070673_100092219 Ga0070673_1000922192 130
387 3300005365 Ga0070688_100584495 Ga0070688_1005844952 130
388 3300005367 Ga0070667_101198652 Ga0070667_1011986522 130
389 3300005434 Ga0070709_10048287 Ga0070709_100482872 130
390 3300005437 Ga0070710_10008666 Ga0070710_100086665 130
391 3300005438 Ga0070701_10005016 Ga0070701_100050164 130
392 3300005439 Ga0070711_100008308 Ga0070711_1000083085 130
393 3300005439 Ga0070711_100021847 Ga0070711_1000218474 130
394 3300005441 Ga0070700_100086376 Ga0070700_1000863763 130
395 3300005441 Ga0070700_100465763 Ga0070700_1004657632 130
396 3300005444 Ga0070694_100103748 Ga0070694_1001037483 130
397 3300005444 Ga0070694_100257026 Ga0070694_1002570262 130
398 3300005445 Ga0070708_100001530 Ga0070708_10000153011 130
399 3300005455 Ga0070663_100486269 Ga0070663_1004862692 130
400 3300005457 Ga0070662_101196179 Ga0070662_1011961792 130
401 3300005458 Ga0070681_11114743 Ga0070681_111147432 130
402 3300005459 Ga0068867_100226101 Ga0068867_1002261013 130
403 3300005467 Ga0070706_100151208 Ga0070706_1001512082 130
404 3300005468 Ga0070707_100049949 Ga0070707_1000499494 130
405 3300005518 Ga0070699_100041670 Ga0070699_1000416704 130
406 3300005530 Ga0070679_100567929 Ga0070679_1005679292 130
407 3300005536 Ga0070697_100002936 Ga0070697_10000293610 130
408 3300005543 Ga0070672_100080009 Ga0070672_1000800094 130
409 3300005544 Ga0070686_100012990 Ga0070686_1000129903 130
410 3300005545 Ga0070695_100017455 Ga0070695_1000174556 130
411 3300005548 Ga0070665_100572775 Ga0070665_1005727752 130
412 3300005549 Ga0070704_100004614 Ga0070704_1000046144 130
413 3300005615 Ga0070702_100002751 Ga0070702_1000027513 130
414 3300005616 Ga0068852_100320809 Ga0068852_1003208093 130
415 3300005616 Ga0068852_100628158 Ga0068852_1006281583 130
416 3300005616 Ga0068852_102271866 Ga0068852_1022718662 130
417 3300005617 Ga0068859_100777646 Ga0068859_1007776462 130
418 3300005719 Ga0068861_100967198 Ga0068861_1009671982 130
419 3300005834 Ga0068851_10146974 Ga0068851_101469742 130
420 3300006173 Ga0070716_100000382 Ga0070716_1000003826 130
421 3300006175 Ga0070712_100001265 Ga0070712_1000012658 130
422 3300006175 Ga0070712_100008281 Ga0070712_1000082813 130
423 3300006175 Ga0070712_100329920 Ga0070712_1003299202 130
424 3300006852 Ga0075433_10643783 Ga0075433_106437832 130
425 3300006914 Ga0075436_100099795 Ga0075436_1000997952 130
426 3300006931 Ga0097620_100777708 Ga0097620_1007777082 130
427 3300009094 Ga0111539_12865058 Ga0111539_128650581 130
428 3300013306 Ga0163162_10870571 Ga0163162_108705712 130
429 3300013308 Ga0157375_10542756 Ga0157375_105427563 130
430 3300025898 Ga0207692_10006075 Ga0207692_100060755 130
431 3300025906 Ga0207699_10022135 Ga0207699_100221353 130
432 3300025907 Ga0207645_10408321 Ga0207645_104083212 130
433 3300025910 Ga0207684_10115540 Ga0207684_101155402 130
434 3300025912 Ga0207707_10847154 Ga0207707_108471542 130
435 3300025915 Ga0207693_10002358 Ga0207693_100023589 130
436 3300025915 Ga0207693_10003272 Ga0207693_1000327210 130
437 3300025916 Ga0207663_10011681 Ga0207663_100116812 130
438 3300025916 Ga0207663_10171572 Ga0207663_101715722 130
439 3300025916 Ga0207663_11036283 Ga0207663_110362831 130
440 3300025917 Ga0207660_10002949 Ga0207660_100029493 130
441 3300025918 Ga0207662_10043236 Ga0207662_100432362 130
442 3300025922 Ga0207646_10045807 Ga0207646_100458074 130
443 3300025926 Ga0207659_10185019 Ga0207659_101850192 130
444 3300025933 Ga0207706_10237945 Ga0207706_102379452 130
445 3300025933 Ga0207706_10558406 Ga0207706_105584062 130
446 3300025939 Ga0207665_10000218 Ga0207665_1000021827 130
447 3300025940 Ga0207691_10005913 Ga0207691_100059133 130
448 3300025960 Ga0207651_11022290 Ga0207651_110222902 130
449 3300026067 Ga0207678_10119890 Ga0207678_101198902 130
450 3300026075 Ga0207708_10188657 Ga0207708_101886572 130
451 3300026075 Ga0207708_10278431 Ga0207708_102784312 130
452 3300026089 Ga0207648_10172782 Ga0207648_101727824 130
453 3300026089 Ga0207648_10344368 Ga0207648_103443683 130
454 3300026118 Ga0207675_100161707 Ga0207675_1001617074 130
455 3300026142 Ga0207698_10171986 Ga0207698_101719864 130
456 3300028381 Ga0268264_11168421 Ga0268264_111684212 130
457 3300031731 Ga0307405_10150897 Ga0307405_101508972 130
458 3300035695 Ga0373927_0133005 Ga0373927_0133005_804_1214 130
459 3300039450 Ga0436363_0610965 Ga0436363_0610965_381_806 130
460 3300042876 Ga0451577_0095301 Ga0451577_0095301_1697_2101 130
461 3300042876 Ga0451577_0201391 Ga0451577_0201391_473_880 130
462 3300042876 Ga0451577_1638670 Ga0451577_1638670_49_450 130
463 3300044693 Ga0466961_0258484 Ga0466961_0258484_593_1003 130
464 3300044712 Ga0453684_0244402 Ga0453684_0244402_309_713 130
465 3300044712 Ga0453684_1437727 Ga0453684_1437727_241_648 130
466 3300045051 Ga0451576_0028782 Ga0451576_0028782_662_1066 130
467 3300045051 Ga0451576_0153748 Ga0451576_0153748_668_1063 130
468 3300045051 Ga0451576_0753730 Ga0451576_0753730_197_604 130
469 3300047445 Ga0495677_0123323 Ga0495677_0123323_244_639 130
470 3300048910 Ga0496107_0017845 Ga0496107_0017845_4275_4679 130
471 3300048912 Ga0496109_0053407 Ga0496109_0053407_2710_3114 130
472 3300048915 Ga0496112_1126667 Ga0496112_1126667_258_662 130
473 3300050507 nmdc:mga05p37_165347_c1 nmdc:mga05p37_165347_c1_1068_1463 130
474 3300050512 nmdc:mga0n895_593287_c1 nmdc:mga0n895_593287_c1_131_526 130
475 3300050514 nmdc:mga08x19_122137_c1 nmdc:mga08x19_122137_c1_569_964 130
476 3300050515 nmdc:mga0a205_1062910_c1 nmdc:mga0a205_1062910_c1_107_502 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

10

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9759 3 128
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9677 3 128
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.9673 19 128
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9451 20 128
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9368 20 128
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9759 3 128 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9677 3 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9431 20 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9347 20 128 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.932 19 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7V8NQL7-F1-model_v4 RidA family protein 1.001 3 128
AF-A0A7V9FIM0-F1-model_v4 RidA family protein 1.001 3 128
AF-A0A2V2R7Q0-F1-model_v4 deleted 1.001 3 130
AF-A0A845U4Z4-F1-model_v4 RidA family protein 1 3 128
AF-T0ZC75-F1-model_v4 Endoribonuclease L-PSP 0.9992 30 130

Feature Viewer

pLDDT pTM Quality
95.96 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map