F451541

General Info

Members Datasets Scaffolds Average Seq Length
476 246 952 166

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10094790|Ga0209974_100947901
Length 192
Sequence MDSAIQKDPGNSIRSIRQSTINAKKTKKMTSNLLFDFTVDKAAKTVFITREFDADLSLVWDAFTKAEILDQWVAPKPWTSKTKYMDFKVGGKRFYAMVSPEGQERWAIQEYTSITPKTNFKMHNAFADKDGNPELPGSEWDYTFSEQDGKTKVDITIYNESLARMEKMIEMGFTEGFKMSMNNLENLLSSTR

Samples

Sample ID Description Type Environment
1 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
194 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
200 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
201 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
202 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
203 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
204 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
207 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
208 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
229 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
230 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
237 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
238 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
239 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
240 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
241 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
242 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
243 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
244 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
245 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
246 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0
Rhizoplane 0.63
Rhizosphere 89.08
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209974_10094790 3300027876 Bacteria 1038
2 rootL2_10014031 3300003322 Bacteria 7760
3 JGI26133J50247_103170 3300003397 Bacteria 567
4 Ga0065714_10027122 3300005288 Bacteria 1554
5 Ga0065714_10072858 3300005288 Bacteria 3286
6 Ga0065714_10103753 3300005288 Bacteria 1597
7 Ga0065704_10420955 3300005289 Bacteria 732
8 Ga0065715_10123763 3300005293 Bacteria 2170
9 Ga0065715_10205278 3300005293 Bacteria 1339
10 Ga0065715_10209871 3300005293 Bacteria 1319
11 Ga0070658_10052443 3300005327 Bacteria 3308
12 Ga0070676_10031482 3300005328 Bacteria 3031
13 Ga0070676_10110742 3300005328 Bacteria 1709
14 Ga0070676_11155448 3300005328 Bacteria 587
15 Ga0070683_100039551 3300005329 Bacteria 4330
16 Ga0070683_100050976 3300005329 Bacteria 3834
17 Ga0070683_100291388 3300005329 Bacteria 1552
18 Ga0070683_100732617 3300005329 Bacteria 947
19 Ga0070670_100060749 3300005331 Bacteria 3245
20 Ga0070670_100569546 3300005331 Bacteria 1012
21 Ga0068869_100007014 3300005334 Bacteria 7175
22 Ga0068869_100274576 3300005334 Bacteria 1353
23 Ga0068869_100381119 3300005334 Bacteria 1156
24 Ga0068869_100582260 3300005334 Bacteria 943
25 Ga0068869_101105741 3300005334 Bacteria 693
26 Ga0070666_10001225 3300005335 Bacteria 15485
27 Ga0070680_100002524 3300005336 Bacteria 13557
28 Ga0070680_100675290 3300005336 Unclassified 888
29 Ga0070680_101266863 3300005336 Bacteria 638
30 Ga0070682_100005420 3300005337 Bacteria 7106
31 Ga0068868_100009623 3300005338 Bacteria 6971
32 Ga0068868_100125844 3300005338 Bacteria 2094
33 Ga0068868_100523253 3300005338 Bacteria 1042
34 Ga0068868_101774461 3300005338 Bacteria 583
35 Ga0070689_100070674 3300005340 Bacteria 2726
36 Ga0070691_10003059 3300005341 Bacteria 7490
37 Ga0070687_100526616 3300005343 Bacteria 800
38 Ga0070661_100001575 3300005344 Bacteria 15817
39 Ga0070661_100022639 3300005344 Bacteria 4500
40 Ga0070661_100335647 3300005344 Bacteria 1183
41 Ga0070692_10196970 3300005345 Unclassified 1177
42 Ga0070668_100332636 3300005347 Bacteria 1281
43 Ga0070668_100460722 3300005347 Bacteria 1095
44 Ga0070668_100644991 3300005347 Bacteria 930
45 Ga0070669_100005362 3300005353 Bacteria 9252
46 Ga0070669_100009802 3300005353 Bacteria 6823
47 Ga0070669_101340682 3300005353 Unclassified 620
48 Ga0070675_100025053 3300005354 Bacteria 4781
49 Ga0070675_100070915 3300005354 Bacteria 2889
50 Ga0070671_100406768 3300005355 Bacteria 1165
51 Ga0070671_100441601 3300005355 Bacteria 1116
52 Ga0070671_100813754 3300005355 Bacteria 814
53 Ga0070674_100045165 3300005356 Bacteria 3009
54 Ga0070673_100027277 3300005364 Bacteria 4232
55 Ga0070688_100456235 3300005365 Bacteria 956
56 Ga0070659_100272869 3300005366 Bacteria 1406
57 Ga0070667_100282865 3300005367 Bacteria 1490
58 Ga0070701_10791645 3300005438 Bacteria 646
59 Ga0070700_100061184 3300005441 Bacteria 2375
60 Ga0070663_100064790 3300005455 Unclassified 2642
61 Ga0070678_100064528 3300005456 Bacteria 2714
62 Ga0070678_100864272 3300005456 Bacteria 825
63 Ga0070662_100042802 3300005457 Bacteria 3236
64 Ga0070662_100173052 3300005457 Bacteria 1697
65 Ga0070662_100896254 3300005457 Bacteria 757
66 Ga0070681_10034462 3300005458 Bacteria 5083
67 Ga0070681_10049340 3300005458 Bacteria 4204
68 Ga0068867_100038457 3300005459 Bacteria 3483
69 Ga0068867_100132877 3300005459 Bacteria 1936
70 Ga0070685_10430712 3300005466 Bacteria 920
71 Ga0070685_10562541 3300005466 Bacteria 816
72 Ga0070699_101034910 3300005518 Bacteria 753
73 Ga0070679_100003932 3300005530 Bacteria 13669
74 Ga0070684_100005785 3300005535 Bacteria 9509
75 Ga0070684_100047554 3300005535 Bacteria 3717
76 Ga0070684_100238737 3300005535 Bacteria 1660
77 Ga0068853_100001770 3300005539 Bacteria 15876
78 Ga0068853_100024216 3300005539 Bacteria 5088
79 Ga0068853_100775299 3300005539 Bacteria 917
80 Ga0068853_101663149 3300005539 Bacteria 619
81 Ga0070672_100089176 3300005543 Bacteria 2484
82 Ga0070672_100096252 3300005543 Bacteria 2395
83 Ga0070672_100402379 3300005543 Bacteria 1174
84 Ga0070672_101277541 3300005543 Bacteria 655
85 Ga0070665_100011081 3300005548 Bacteria 9109
86 Ga0070665_100557730 3300005548 Bacteria 1158
87 Ga0068855_100227399 3300005563 Bacteria 2090
88 Ga0068855_100390158 3300005563 Bacteria 1527
89 Ga0068855_100396600 3300005563 Bacteria 1513
90 Ga0068855_100682204 3300005563 Bacteria 1101
91 Ga0070664_100002738 3300005564 Bacteria 14221
92 Ga0070664_100004100 3300005564 Bacteria 11701
93 Ga0070664_100195626 3300005564 Bacteria 1802
94 Ga0070664_100265259 3300005564 Bacteria 1546
95 Ga0070664_100642553 3300005564 Bacteria 986
96 Ga0068857_100012911 3300005577 Bacteria 7277
97 Ga0068857_100022122 3300005577 Bacteria 5593
98 Ga0068857_100051054 3300005577 Bacteria 3667
99 Ga0068857_100063758 3300005577 Bacteria 3276
100 Ga0068857_100482658 3300005577 Bacteria 1161
101 Ga0068857_100702686 3300005577 Bacteria 961
102 Ga0068854_100126761 3300005578 Bacteria 1945
103 Ga0068854_100259451 3300005578 Bacteria 1391
104 Ga0068854_100749516 3300005578 Bacteria 847
105 Ga0068854_101130874 3300005578 Bacteria 699
106 Ga0068856_100508209 3300005614 Bacteria 1226
107 Ga0068856_100842557 3300005614 Bacteria 936
108 Ga0068852_100009580 3300005616 Bacteria 7197
109 Ga0068859_100000003 3300005617 Bacteria 479218
110 Ga0068859_100206741 3300005617 Bacteria 2048
111 Ga0068859_100482170 3300005617 Bacteria 1335
112 Ga0068859_100963604 3300005617 Bacteria 936
113 Ga0068866_10070380 3300005718 Bacteria 1846
114 Ga0068861_100015421 3300005719 Bacteria 5384
115 Ga0068861_100221121 3300005719 Bacteria 1601
116 Ga0068861_100436875 3300005719 Bacteria 1170
117 Ga0068870_10100734 3300005840 Bacteria 1632
118 Ga0068863_100008250 3300005841 Bacteria 10177
119 Ga0068858_100013858 3300005842 Bacteria 7605
120 Ga0068858_100588034 3300005842 Bacteria 1079
121 Ga0068860_100038852 3300005843 Bacteria 4554
122 Ga0068860_100111124 3300005843 Bacteria 2620
123 Ga0068860_100265566 3300005843 Bacteria 1674
124 Ga0068860_101729871 3300005843 Bacteria 647
125 Ga0068862_100009406 3300005844 Bacteria 8085
126 Ga0068862_100223707 3300005844 Bacteria 1705
127 Ga0081540_1044956 3300005983 Bacteria 2248
128 Ga0081540_1274226 3300005983 Bacteria 583
129 Ga0075366_10089613 3300006195 Bacteria 1843
130 Ga0097621_100956913 3300006237 Bacteria 800
131 Ga0068871_100074494 3300006358 Bacteria 2801
132 Ga0075428_100305394 3300006844 Bacteria 1711
133 Ga0075428_100414841 3300006844 Bacteria 1443
134 Ga0075430_100219196 3300006846 Bacteria 1579
135 Ga0075431_100112456 3300006847 Bacteria 2810
136 Ga0075431_100559193 3300006847 Bacteria 1131
137 Ga0068865_100175805 3300006881 Bacteria 1645
138 Ga0068865_100696869 3300006881 Bacteria 867
139 Ga0097620_100000003 3300006931 Bacteria 479218
140 Ga0097620_100206769 3300006931 Bacteria 2048
141 Ga0097620_100482197 3300006931 Bacteria 1335
142 Ga0097620_100963698 3300006931 Bacteria 936
143 Ga0105244_10000022 3300009036 Bacteria 234186
144 Ga0105244_10058371 3300009036 Bacteria 1948
145 Ga0105240_10008697 3300009093 Bacteria 14487
146 Ga0105240_10064343 3300009093 Bacteria 4557
147 Ga0105240_10735345 3300009093 Bacteria 1074
148 Ga0111539_10005331 3300009094 Bacteria 16644
149 Ga0111539_10031957 3300009094 Bacteria 6395
150 Ga0111539_10037867 3300009094 Bacteria 5819
151 Ga0111539_11017273 3300009094 Bacteria 963
152 Ga0105245_10198661 3300009098 Bacteria 1925
153 Ga0105245_10633119 3300009098 Bacteria 1099
154 Ga0114129_10000900 3300009147 Bacteria 38646
155 Ga0114129_10035011 3300009147 Bacteria 7093
156 Ga0105243_10448048 3300009148 Bacteria 1210
157 Ga0105241_10002645 3300009174 Bacteria 13411
158 Ga0105241_10006722 3300009174 Bacteria 8461
159 Ga0105241_10250019 3300009174 Bacteria 1503
160 Ga0105241_10536189 3300009174 Bacteria 1049
161 Ga0105241_11496897 3300009174 Bacteria 649
162 Ga0105242_10382519 3300009176 Bacteria 1309
163 Ga0105242_12709362 3300009176 Bacteria 546
164 Ga0105237_10016378 3300009545 Bacteria 7705
165 Ga0105237_10029463 3300009545 Bacteria 5581
166 Ga0105237_10169610 3300009545 Bacteria 2182
167 Ga0105237_11248731 3300009545 Bacteria 749
168 Ga0105249_10025020 3300009553 Bacteria 5372
169 Ga0105249_10192721 3300009553 Bacteria 1990
170 Ga0105249_10506814 3300009553 Bacteria 1253
171 Ga0105249_10748112 3300009553 Bacteria 1039
172 Ga0105249_11084985 3300009553 Bacteria 870
173 Ga0105239_10014361 3300010375 Bacteria 8787
174 Ga0105239_10018537 3300010375 Bacteria 7687
175 Ga0105239_10093305 3300010375 Bacteria 3323
176 Ga0105239_10768707 3300010375 Bacteria 1103
177 Ga0105239_11314342 3300010375 Bacteria 834
178 Ga0105246_10027235 3300011119 Bacteria 3743
179 Ga0105246_10088634 3300011119 Bacteria 2224
180 Ga0105246_10531264 3300011119 Bacteria 1004
181 Ga0105246_10807886 3300011119 Bacteria 833
182 Ga0157373_10095795 3300013100 Bacteria 2089
183 Ga0157371_10027358 3300013102 Bacteria 4137
184 Ga0157371_10198766 3300013102 Bacteria 1437
185 Ga0157370_10000973 3300013104 Bacteria 36273
186 Ga0157370_10018550 3300013104 Bacteria 6994
187 Ga0157369_10100548 3300013105 Unclassified 3082
188 Ga0157374_10009109 3300013296 Bacteria 8506
189 Ga0157374_10080007 3300013296 Bacteria 3098
190 Ga0157374_10302668 3300013296 Bacteria 1582
191 Ga0157374_10333017 3300013296 Bacteria 1506
192 Ga0157374_10383157 3300013296 Bacteria 1401
193 Ga0157378_11259112 3300013297 Bacteria 780
194 Ga0157378_11429925 3300013297 Bacteria 735
195 Ga0157378_11431527 3300013297 Bacteria 734
196 Ga0163162_10004867 3300013306 Bacteria 12962
197 Ga0163162_10761115 3300013306 Bacteria 1087
198 Ga0163162_12082918 3300013306 Bacteria 651
199 Ga0157372_10620271 3300013307 Bacteria 1260
200 Ga0157372_11171000 3300013307 Bacteria 889
201 Ga0157372_11483193 3300013307 Bacteria 781
202 Ga0157372_11488123 3300013307 Bacteria 780
203 Ga0157375_10009836 3300013308 Bacteria 8410
204 Ga0157375_10027689 3300013308 Bacteria 5302
205 Ga0157375_10068347 3300013308 Bacteria 3555
206 Ga0157375_10174356 3300013308 Bacteria 2299
207 Ga0157375_10273306 3300013308 Bacteria 1852
208 Ga0157375_11520065 3300013308 Bacteria 790
209 Ga0157375_11541004 3300013308 Bacteria 785
210 Ga0163163_10001644 3300014325 Bacteria 18813
211 Ga0163163_10014781 3300014325 Bacteria 7184
212 Ga0157380_10000492 3300014326 Bacteria 24067
213 Ga0157380_10003464 3300014326 Bacteria 10839
214 Ga0157380_10364611 3300014326 Bacteria 1357
215 Ga0157380_10373812 3300014326 Bacteria 1342
216 Ga0157377_10011067 3300014745 Bacteria 4489
217 Ga0157377_10023818 3300014745 Bacteria 3249
218 Ga0157377_10662404 3300014745 Bacteria 753
219 Ga0157379_10267067 3300014968 Bacteria 1555
220 Ga0157376_10075706 3300014969 Bacteria 2873
221 Ga0157376_10728830 3300014969 Bacteria 999
222 Ga0157376_11015351 3300014969 Bacteria 852
223 Ga0163161_10000056 3300017792 Bacteria 114387
224 Ga0163161_10001934 3300017792 Bacteria 15111
225 Ga0163161_10980501 3300017792 Bacteria 720
226 Ga0209050_1012990 3300025298 Bacteria 3757
227 Ga0209050_1044794 3300025298 Bacteria 1180
228 Ga0207697_10033745 3300025315 Bacteria 2094
229 Ga0207655_1000052 3300025728 Bacteria 291090
230 Ga0207713_1100477 3300025735 Bacteria 999
231 Ga0207710_10017144 3300025900 Bacteria 3070
232 Ga0207688_10181655 3300025901 Bacteria 1255
233 Ga0207688_10836818 3300025901 Bacteria 583
234 Ga0207680_10000999 3300025903 Bacteria 13324
235 Ga0207680_10234467 3300025903 Bacteria 1262
236 Ga0207647_10279973 3300025904 Bacteria 952
237 Ga0207647_10415571 3300025904 Bacteria 757
238 Ga0207645_10007707 3300025907 Bacteria 7583
239 Ga0207645_10102947 3300025907 Bacteria 1843
240 Ga0207645_10227661 3300025907 Bacteria 1230
241 Ga0207643_10174145 3300025908 Bacteria 1300
242 Ga0207705_10021188 3300025909 Bacteria 4635
243 Ga0207654_10000733 3300025911 Bacteria 18254
244 Ga0207654_10004406 3300025911 Bacteria 7098
245 Ga0207707_10012293 3300025912 Bacteria 7442
246 Ga0207707_10134322 3300025912 Bacteria 2163
247 Ga0207707_11167807 3300025912 Bacteria 624
248 Ga0207695_10052972 3300025913 Bacteria 4247
249 Ga0207695_10320417 3300025913 Bacteria 1440
250 Ga0207695_10393120 3300025913 Bacteria 1271
251 Ga0207695_10867382 3300025913 Bacteria 782
252 Ga0207671_10015618 3300025914 Bacteria 5938
253 Ga0207671_10048045 3300025914 Bacteria 3158
254 Ga0207671_10097933 3300025914 Bacteria 2218
255 Ga0207671_10334192 3300025914 Bacteria 1200
256 Ga0207660_10001909 3300025917 Bacteria 13886
257 Ga0207649_10005637 3300025920 Bacteria 6775
258 Ga0207649_10172380 3300025920 Bacteria 1508
259 Ga0207649_10579828 3300025920 Bacteria 861
260 Ga0207649_10701453 3300025920 Bacteria 785
261 Ga0207652_10003306 3300025921 Bacteria 13350
262 Ga0207681_10051977 3300025923 Bacteria 2777
263 Ga0207681_10843522 3300025923 Bacteria 766
264 Ga0207650_10091211 3300025925 Bacteria 2328
265 Ga0207650_10167189 3300025925 Bacteria 1746
266 Ga0207650_10488939 3300025925 Bacteria 1027
267 Ga0207650_10776345 3300025925 Bacteria 812
268 Ga0207659_10022623 3300025926 Bacteria 4186
269 Ga0207659_10106653 3300025926 Bacteria 2122
270 Ga0207659_10186491 3300025926 Bacteria 1647
271 Ga0207659_10640129 3300025926 Bacteria 908
272 Ga0207644_10839276 3300025931 Bacteria 769
273 Ga0207644_11194825 3300025931 Bacteria 639
274 Ga0207690_10345611 3300025932 Bacteria 1175
275 Ga0207706_10010970 3300025933 Bacteria 8262
276 Ga0207706_10307805 3300025933 Bacteria 1380
277 Ga0207706_10328201 3300025933 Bacteria 1331
278 Ga0207686_10168785 3300025934 Bacteria 1541
279 Ga0207686_10283549 3300025934 Bacteria 1224
280 Ga0207709_10717002 3300025935 Bacteria 802
281 Ga0207670_10012213 3300025936 Bacteria 5016
282 Ga0207670_10216341 3300025936 Bacteria 1464
283 Ga0207669_10150939 3300025937 Bacteria 1627
284 Ga0207669_10206289 3300025937 Bacteria 1431
285 Ga0207704_10386343 3300025938 Bacteria 1100
286 Ga0207691_10001337 3300025940 Bacteria 24606
287 Ga0207689_10008206 3300025942 Bacteria 9099
288 Ga0207689_10014869 3300025942 Bacteria 6605
289 Ga0207689_10037109 3300025942 Bacteria 4044
290 Ga0207689_10106648 3300025942 Bacteria 2302
291 Ga0207661_10219559 3300025944 Bacteria 1679
292 Ga0207661_10482754 3300025944 Bacteria 1131
293 Ga0207661_10901459 3300025944 Bacteria 814
294 Ga0207679_10008734 3300025945 Bacteria 6463
295 Ga0207679_10058769 3300025945 Bacteria 2851
296 Ga0207679_10539067 3300025945 Bacteria 1046
297 Ga0207667_10000150 3300025949 Bacteria 104244
298 Ga0207667_10266754 3300025949 Bacteria 1750
299 Ga0207667_11368352 3300025949 Bacteria 682
300 Ga0207651_10026810 3300025960 Bacteria 3608
301 Ga0207651_10386161 3300025960 Bacteria 1188
302 Ga0207651_10512671 3300025960 Bacteria 1038
303 Ga0207712_10009762 3300025961 Bacteria 6084
304 Ga0207712_10091993 3300025961 Bacteria 2235
305 Ga0207712_10299760 3300025961 Bacteria 1318
306 Ga0207668_10184507 3300025972 Bacteria 1648
307 Ga0207668_10421095 3300025972 Bacteria 1133
308 Ga0207640_10272137 3300025981 Bacteria 1326
309 Ga0207640_11367138 3300025981 Bacteria 634
310 Ga0207677_10459643 3300026023 Bacteria 1092
311 Ga0207677_10848492 3300026023 Bacteria 821
312 Ga0207677_11280547 3300026023 Bacteria 673
313 Ga0207703_10046782 3300026035 Bacteria 3486
314 Ga0207703_11164667 3300026035 Bacteria 741
315 Ga0207639_10017631 3300026041 Bacteria 5063
316 Ga0207639_10020930 3300026041 Bacteria 4692
317 Ga0207639_10234662 3300026041 Bacteria 1592
318 Ga0207639_10357216 3300026041 Bacteria 1306
319 Ga0207639_10941358 3300026041 Bacteria 808
320 Ga0207678_10030514 3300026067 Bacteria 4705
321 Ga0207708_10335075 3300026075 Bacteria 1238
322 Ga0207702_10115757 3300026078 Bacteria 2391
323 Ga0207702_10867307 3300026078 Bacteria 894
324 Ga0207641_10000026 3300026088 Bacteria 245091
325 Ga0207641_10086522 3300026088 Bacteria 2733
326 Ga0207648_10003226 3300026089 Bacteria 17175
327 Ga0207648_10397986 3300026089 Bacteria 1247
328 Ga0207676_10037666 3300026095 Bacteria 3687
329 Ga0207674_10004912 3300026116 Bacteria 15987
330 Ga0207674_10015318 3300026116 Bacteria 8427
331 Ga0207674_10037768 3300026116 Bacteria 5018
332 Ga0207674_10079724 3300026116 Bacteria 3277
333 Ga0207674_10104567 3300026116 Bacteria 2809
334 Ga0207674_11560896 3300026116 Bacteria 629
335 Ga0207675_100003862 3300026118 Bacteria 14565
336 Ga0207675_100123779 3300026118 Bacteria 2448
337 Ga0207675_100621265 3300026118 Bacteria 1085
338 Ga0207675_100838096 3300026118 Bacteria 934
339 Ga0207683_10015198 3300026121 Bacteria 6551
340 Ga0207683_10097563 3300026121 Bacteria 2621
341 Ga0207683_10894569 3300026121 Bacteria 824
342 Ga0209969_1027520 3300027360 Bacteria 862
343 Ga0209996_1013815 3300027395 Bacteria 1094
344 Ga0209995_1010103 3300027471 Bacteria 1528
345 Ga0209970_1052028 3300027614 Bacteria 742
346 Ga0207428_10058040 3300027907 Bacteria 3072
347 Ga0207428_10128015 3300027907 Bacteria 1944
348 Ga0268266_10208568 3300028379 Bacteria 1791
349 Ga0268266_10302234 3300028379 Bacteria 1493
350 Ga0268266_10467854 3300028379 Bacteria 1200
351 Ga0268265_10265471 3300028380 Bacteria 1528
352 Ga0268264_10000614 3300028381 Bacteria 42551
353 Ga0268264_10011707 3300028381 Bacteria 7234
354 Ga0268264_10085454 3300028381 Bacteria 2708
355 Ga0268264_11316398 3300028381 Bacteria 733
356 Ga0307517_10377667 3300028786 Bacteria 759
357 Ga0307515_10185254 3300028794 Bacteria 2014
358 Ga0307515_10376777 3300028794 Bacteria 1053
359 Ga0265327_10016230 3300031251 Bacteria 4746
360 Ga0307513_10305385 3300031456 Bacteria 1356
361 Ga0307513_10317272 3300031456 Bacteria 1318
362 Ga0307513_10672169 3300031456 Bacteria 742
363 Ga0307509_10035892 3300031507 Bacteria 5435
364 Ga0307509_10322385 3300031507 Bacteria 1281
365 Ga0307408_100672631 3300031548 Bacteria 928
366 Ga0307413_10759098 3300031824 Bacteria 811
367 Ga0307410_10196364 3300031852 Bacteria 1538
368 Ga0307410_10274741 3300031852 Bacteria 1320
369 Ga0307406_10577869 3300031901 Unclassified 923
370 Ga0307414_11506284 3300032004 Bacteria 626
371 Ga0307415_100475232 3300032126 Bacteria 1087
372 Ga0373927_0407090 3300035695 Bacteria 898
373 Ga0395899_0032325 3300037312 Bacteria 3930
374 Ga0395900_0459353 3300037418 Bacteria 1228
375 Ga0395898_0009160 3300037466 Bacteria 10428
376 Ga0439447_000563 3300041407 Bacteria 13807
377 Ga0451802_0027014 3300041460 Bacteria 712
378 Ga0450923_025914 3300042125 Bacteria 1171
379 Ga0450923_089326 3300042125 Bacteria 701
380 Ga0439444_0050310 3300042437 Bacteria 845
381 Ga0439459_0074514 3300042438 Bacteria 791
382 Ga0451577_0019851 3300042876 Bacteria 6175
383 Ga0451577_0202605 3300042876 Bacteria 1791
384 Ga0451577_0264308 3300042876 Bacteria 1558
385 Ga0466972_0000056 3300044658 Bacteria 111206
386 Ga0466972_0036004 3300044658 Bacteria 2423
387 Ga0453683_0735590 3300044673 Bacteria 647
388 Ga0453684_0001324 3300044712 Bacteria 73175
389 Ga0453684_0003811 3300044712 Bacteria 33259
390 Ga0451576_0002248 3300045051 Bacteria 29543
391 Ga0495627_115787 3300046453 Bacteria 759
392 Ga0495638_0000020 3300046460 Bacteria 372434
393 Ga0495580_0242075 3300046472 Bacteria 1237
394 Ga0495580_0446016 3300046472 Bacteria 869
395 Ga0495608_0890542 3300046511 Bacteria 521
396 Ga0495628_0017613 3300046516 Bacteria 5942
397 Ga0495652_0653843 3300046529 Bacteria 712
398 Ga0495640_0357424 3300046533 Bacteria 901
399 Ga0495668_0008040 3300046616 Bacteria 6641
400 Ga0495611_0042857 3300046648 Bacteria 2022
401 Ga0495625_0507269 3300046660 Bacteria 737
402 Ga0495635_0394370 3300046663 Bacteria 920
403 Ga0495624_0683636 3300046690 Bacteria 610
404 Ga0495674_0207082 3300047319 Bacteria 1626
405 Ga0495672_0019012 3300047320 Bacteria 4544
406 Ga0496110_0067166 3300048913 Bacteria 3173
407 Ga0496111_0404674 3300048914 Bacteria 1008
408 Ga0501293_009221 3300049516 Bacteria 839
409 Ga0501299_135715 3300049522 Bacteria 607
410 Ga0501034_0493536 3300049571 Bacteria 1139
411 Ga0501047_0019371 3300049581 Bacteria 6528
412 Ga0501047_0033486 3300049581 Bacteria 4960
413 Ga0501207_004383 3300049654 Bacteria 1916
414 Ga0501223_000963 3300049663 Bacteria 6781
415 Ga0501223_056448 3300049663 Bacteria 764
416 Ga0501242_000041 3300049674 Bacteria 8132
417 Ga0501243_081309 3300049675 Bacteria 631
418 Ga0501249_000030 3300049679 Bacteria 80958
419 Ga0501257_000150 3300049686 Bacteria 14381
420 Ga0501257_005192 3300049686 Bacteria 2864
421 Ga0501259_001528 3300049688 Bacteria 3853
422 Ga0501219_000169 3300049703 Bacteria 12090
423 Ga0501225_0031541 3300049705 Bacteria 1457
424 Ga0501241_000231 3300049758 Bacteria 12483
425 Ga0501241_048040 3300049758 Bacteria 838
426 Ga0501266_005097 3300049763 Bacteria 1635
427 Ga0501282_009169 3300049778 Bacteria 1062
428 Ga0501044_0017937 3300049823 Bacteria 7590
429 Ga0501284_00003 3300050005 Bacteria 212116
430 nmdc:mga05p37_480_c2 3300050507 Bacteria 25652
431 nmdc:mga05p37_67424_c1 3300050507 Bacteria 4402
432 nmdc:mga09592_129337_c1 3300050508 Bacteria 2172
433 nmdc:mga06r32_520855_c1 3300050510 Bacteria 1165
434 nmdc:mga06r32_715183_c1 3300050510 Bacteria 966
435 nmdc:mga08y16_106800_c1 3300050511 Bacteria 2914
436 nmdc:mga08y16_53555_c1 3300050511 Bacteria 4219
437 nmdc:mga0rr50_1609992_c1 3300050513 Bacteria 548
438 nmdc:mga0a205_969111_c1 3300050515 Bacteria 697
439 Ga0500635_0004366 3300053080 Bacteria 3641
440 Ga0500578_0000029 3300053086 Bacteria 140078
441 Ga0500583_0137356 3300053092 Bacteria 1214
442 Ga0500651_0277827 3300053093 Bacteria 967
443 Ga0500641_0000032 3300053096 Bacteria 82232
444 Ga0500641_0077111 3300053096 Bacteria 1410
445 Ga0500650_0128373 3300053098 Bacteria 1179
446 Ga0500650_0155476 3300053098 Bacteria 1056
447 Ga0500569_037449 3300053109 Bacteria 1402
448 Ga0500594_0177006 3300053118 Unclassified 695
449 Ga0500642_0294780 3300053130 Bacteria 734
450 Ga0500658_0000043 3300053134 Bacteria 73664
451 Ga0500658_0123250 3300053134 Bacteria 1151
452 Ga0500568_0049759 3300053139 Bacteria 1653
453 Ga0500568_0143668 3300053139 Bacteria 884
454 Ga0500573_0080068 3300053140 Bacteria 1857
455 Ga0500589_172175 3300053147 Bacteria 859
456 Ga0500604_0007842 3300053151 Bacteria 2831
457 Ga0500604_0037931 3300053151 Bacteria 1443
458 Ga0500616_0000003 3300053153 Bacteria 1220687
459 Ga0500616_0039422 3300053153 Bacteria 2547
460 Ga0500616_0076404 3300053153 Bacteria 1693
461 Ga0500622_0014966 3300053156 Bacteria 4159
462 Ga0500636_0021629 3300053177 Bacteria 3808
463 Ga0500584_103863 3300053726 Bacteria 1164
464 Ga0500645_051416 3300053730 Bacteria 1202
465 Ga0500645_096259 3300053730 Bacteria 837
466 Ga0500661_000844 3300055283 Bacteria 5712
467 2644372907 2643221667 Bacteria 5627472
468 2738736849 2738541279 Bacteria 6149495
469 2738769389 2738541285 Bacteria 6150075
470 2739218502 2738543007 Bacteria 6149845
471 2840677829 2840677318 Bacteria 2664183
472 2857620831 2857618242 Bacteria 5635925
473 2857630100 2857627736 Bacteria 5625397
474 2896085647 2896085136 Bacteria 6129793
475 2911143405 2911138879 Bacteria 5811561
476 2929154089 2929150217 Bacteria 5462483
477 Ga0209974_10094790
478 rootL2_10014031
479 JGI26133J50247_103170
480 Ga0065714_10027122
481 Ga0065714_10072858
482 Ga0065714_10103753
483 Ga0065704_10420955
484 Ga0065715_10123763
485 Ga0065715_10205278
486 Ga0065715_10209871
487 Ga0070658_10052443
488 Ga0070676_10031482
489 Ga0070676_10110742
490 Ga0070676_11155448
491 Ga0070683_100039551
492 Ga0070683_100050976
493 Ga0070683_100291388
494 Ga0070683_100732617
495 Ga0070670_100060749
496 Ga0070670_100569546
497 Ga0068869_100007014
498 Ga0068869_100274576
499 Ga0068869_100381119
500 Ga0068869_100582260
501 Ga0068869_101105741
502 Ga0070666_10001225
503 Ga0070680_100002524
504 Ga0070680_100675290
505 Ga0070680_101266863
506 Ga0070682_100005420
507 Ga0068868_100009623
508 Ga0068868_100125844
509 Ga0068868_100523253
510 Ga0068868_101774461
511 Ga0070689_100070674
512 Ga0070691_10003059
513 Ga0070687_100526616
514 Ga0070661_100001575
515 Ga0070661_100022639
516 Ga0070661_100335647
517 Ga0070692_10196970
518 Ga0070668_100332636
519 Ga0070668_100460722
520 Ga0070668_100644991
521 Ga0070669_100005362
522 Ga0070669_100009802
523 Ga0070669_101340682
524 Ga0070675_100025053
525 Ga0070675_100070915
526 Ga0070671_100406768
527 Ga0070671_100441601
528 Ga0070671_100813754
529 Ga0070674_100045165
530 Ga0070673_100027277
531 Ga0070688_100456235
532 Ga0070659_100272869
533 Ga0070667_100282865
534 Ga0070701_10791645
535 Ga0070700_100061184
536 Ga0070663_100064790
537 Ga0070678_100064528
538 Ga0070678_100864272
539 Ga0070662_100042802
540 Ga0070662_100173052
541 Ga0070662_100896254
542 Ga0070681_10034462
543 Ga0070681_10049340
544 Ga0068867_100038457
545 Ga0068867_100132877
546 Ga0070685_10430712
547 Ga0070685_10562541
548 Ga0070699_101034910
549 Ga0070679_100003932
550 Ga0070684_100005785
551 Ga0070684_100047554
552 Ga0070684_100238737
553 Ga0068853_100001770
554 Ga0068853_100024216
555 Ga0068853_100775299
556 Ga0068853_101663149
557 Ga0070672_100089176
558 Ga0070672_100096252
559 Ga0070672_100402379
560 Ga0070672_101277541
561 Ga0070665_100011081
562 Ga0070665_100557730
563 Ga0068855_100227399
564 Ga0068855_100390158
565 Ga0068855_100396600
566 Ga0068855_100682204
567 Ga0070664_100002738
568 Ga0070664_100004100
569 Ga0070664_100195626
570 Ga0070664_100265259
571 Ga0070664_100642553
572 Ga0068857_100012911
573 Ga0068857_100022122
574 Ga0068857_100051054
575 Ga0068857_100063758
576 Ga0068857_100482658
577 Ga0068857_100702686
578 Ga0068854_100126761
579 Ga0068854_100259451
580 Ga0068854_100749516
581 Ga0068854_101130874
582 Ga0068856_100508209
583 Ga0068856_100842557
584 Ga0068852_100009580
585 Ga0068859_100000003
586 Ga0068859_100206741
587 Ga0068859_100482170
588 Ga0068859_100963604
589 Ga0068866_10070380
590 Ga0068861_100015421
591 Ga0068861_100221121
592 Ga0068861_100436875
593 Ga0068870_10100734
594 Ga0068863_100008250
595 Ga0068858_100013858
596 Ga0068858_100588034
597 Ga0068860_100038852
598 Ga0068860_100111124
599 Ga0068860_100265566
600 Ga0068860_101729871
601 Ga0068862_100009406
602 Ga0068862_100223707
603 Ga0081540_1044956
604 Ga0081540_1274226
605 Ga0075366_10089613
606 Ga0097621_100956913
607 Ga0068871_100074494
608 Ga0075428_100305394
609 Ga0075428_100414841
610 Ga0075430_100219196
611 Ga0075431_100112456
612 Ga0075431_100559193
613 Ga0068865_100175805
614 Ga0068865_100696869
615 Ga0097620_100000003
616 Ga0097620_100206769
617 Ga0097620_100482197
618 Ga0097620_100963698
619 Ga0105244_10000022
620 Ga0105244_10058371
621 Ga0105240_10008697
622 Ga0105240_10064343
623 Ga0105240_10735345
624 Ga0111539_10005331
625 Ga0111539_10031957
626 Ga0111539_10037867
627 Ga0111539_11017273
628 Ga0105245_10198661
629 Ga0105245_10633119
630 Ga0114129_10000900
631 Ga0114129_10035011
632 Ga0105243_10448048
633 Ga0105241_10002645
634 Ga0105241_10006722
635 Ga0105241_10250019
636 Ga0105241_10536189
637 Ga0105241_11496897
638 Ga0105242_10382519
639 Ga0105242_12709362
640 Ga0105237_10016378
641 Ga0105237_10029463
642 Ga0105237_10169610
643 Ga0105237_11248731
644 Ga0105249_10025020
645 Ga0105249_10192721
646 Ga0105249_10506814
647 Ga0105249_10748112
648 Ga0105249_11084985
649 Ga0105239_10014361
650 Ga0105239_10018537
651 Ga0105239_10093305
652 Ga0105239_10768707
653 Ga0105239_11314342
654 Ga0105246_10027235
655 Ga0105246_10088634
656 Ga0105246_10531264
657 Ga0105246_10807886
658 Ga0157373_10095795
659 Ga0157371_10027358
660 Ga0157371_10198766
661 Ga0157370_10000973
662 Ga0157370_10018550
663 Ga0157369_10100548
664 Ga0157374_10009109
665 Ga0157374_10080007
666 Ga0157374_10302668
667 Ga0157374_10333017
668 Ga0157374_10383157
669 Ga0157378_11259112
670 Ga0157378_11429925
671 Ga0157378_11431527
672 Ga0163162_10004867
673 Ga0163162_10761115
674 Ga0163162_12082918
675 Ga0157372_10620271
676 Ga0157372_11171000
677 Ga0157372_11483193
678 Ga0157372_11488123
679 Ga0157375_10009836
680 Ga0157375_10027689
681 Ga0157375_10068347
682 Ga0157375_10174356
683 Ga0157375_10273306
684 Ga0157375_11520065
685 Ga0157375_11541004
686 Ga0163163_10001644
687 Ga0163163_10014781
688 Ga0157380_10000492
689 Ga0157380_10003464
690 Ga0157380_10364611
691 Ga0157380_10373812
692 Ga0157377_10011067
693 Ga0157377_10023818
694 Ga0157377_10662404
695 Ga0157379_10267067
696 Ga0157376_10075706
697 Ga0157376_10728830
698 Ga0157376_11015351
699 Ga0163161_10000056
700 Ga0163161_10001934
701 Ga0163161_10980501
702 Ga0209050_1012990
703 Ga0209050_1044794
704 Ga0207697_10033745
705 Ga0207655_1000052
706 Ga0207713_1100477
707 Ga0207710_10017144
708 Ga0207688_10181655
709 Ga0207688_10836818
710 Ga0207680_10000999
711 Ga0207680_10234467
712 Ga0207647_10279973
713 Ga0207647_10415571
714 Ga0207645_10007707
715 Ga0207645_10102947
716 Ga0207645_10227661
717 Ga0207643_10174145
718 Ga0207705_10021188
719 Ga0207654_10000733
720 Ga0207654_10004406
721 Ga0207707_10012293
722 Ga0207707_10134322
723 Ga0207707_11167807
724 Ga0207695_10052972
725 Ga0207695_10320417
726 Ga0207695_10393120
727 Ga0207695_10867382
728 Ga0207671_10015618
729 Ga0207671_10048045
730 Ga0207671_10097933
731 Ga0207671_10334192
732 Ga0207660_10001909
733 Ga0207649_10005637
734 Ga0207649_10172380
735 Ga0207649_10579828
736 Ga0207649_10701453
737 Ga0207652_10003306
738 Ga0207681_10051977
739 Ga0207681_10843522
740 Ga0207650_10091211
741 Ga0207650_10167189
742 Ga0207650_10488939
743 Ga0207650_10776345
744 Ga0207659_10022623
745 Ga0207659_10106653
746 Ga0207659_10186491
747 Ga0207659_10640129
748 Ga0207644_10839276
749 Ga0207644_11194825
750 Ga0207690_10345611
751 Ga0207706_10010970
752 Ga0207706_10307805
753 Ga0207706_10328201
754 Ga0207686_10168785
755 Ga0207686_10283549
756 Ga0207709_10717002
757 Ga0207670_10012213
758 Ga0207670_10216341
759 Ga0207669_10150939
760 Ga0207669_10206289
761 Ga0207704_10386343
762 Ga0207691_10001337
763 Ga0207689_10008206
764 Ga0207689_10014869
765 Ga0207689_10037109
766 Ga0207689_10106648
767 Ga0207661_10219559
768 Ga0207661_10482754
769 Ga0207661_10901459
770 Ga0207679_10008734
771 Ga0207679_10058769
772 Ga0207679_10539067
773 Ga0207667_10000150
774 Ga0207667_10266754
775 Ga0207667_11368352
776 Ga0207651_10026810
777 Ga0207651_10386161
778 Ga0207651_10512671
779 Ga0207712_10009762
780 Ga0207712_10091993
781 Ga0207712_10299760
782 Ga0207668_10184507
783 Ga0207668_10421095
784 Ga0207640_10272137
785 Ga0207640_11367138
786 Ga0207677_10459643
787 Ga0207677_10848492
788 Ga0207677_11280547
789 Ga0207703_10046782
790 Ga0207703_11164667
791 Ga0207639_10017631
792 Ga0207639_10020930
793 Ga0207639_10234662
794 Ga0207639_10357216
795 Ga0207639_10941358
796 Ga0207678_10030514
797 Ga0207708_10335075
798 Ga0207702_10115757
799 Ga0207702_10867307
800 Ga0207641_10000026
801 Ga0207641_10086522
802 Ga0207648_10003226
803 Ga0207648_10397986
804 Ga0207676_10037666
805 Ga0207674_10004912
806 Ga0207674_10015318
807 Ga0207674_10037768
808 Ga0207674_10079724
809 Ga0207674_10104567
810 Ga0207674_11560896
811 Ga0207675_100003862
812 Ga0207675_100123779
813 Ga0207675_100621265
814 Ga0207675_100838096
815 Ga0207683_10015198
816 Ga0207683_10097563
817 Ga0207683_10894569
818 Ga0209969_1027520
819 Ga0209996_1013815
820 Ga0209995_1010103
821 Ga0209970_1052028
822 Ga0207428_10058040
823 Ga0207428_10128015
824 Ga0268266_10208568
825 Ga0268266_10302234
826 Ga0268266_10467854
827 Ga0268265_10265471
828 Ga0268264_10000614
829 Ga0268264_10011707
830 Ga0268264_10085454
831 Ga0268264_11316398
832 Ga0307517_10377667
833 Ga0307515_10185254
834 Ga0307515_10376777
835 Ga0265327_10016230
836 Ga0307513_10305385
837 Ga0307513_10317272
838 Ga0307513_10672169
839 Ga0307509_10035892
840 Ga0307509_10322385
841 Ga0307408_100672631
842 Ga0307413_10759098
843 Ga0307410_10196364
844 Ga0307410_10274741
845 Ga0307406_10577869
846 Ga0307414_11506284
847 Ga0307415_100475232
848 Ga0373927_0407090
849 Ga0395899_0032325
850 Ga0395900_0459353
851 Ga0395898_0009160
852 Ga0439447_000563
853 Ga0451802_0027014
854 Ga0450923_025914
855 Ga0450923_089326
856 Ga0439444_0050310
857 Ga0439459_0074514
858 Ga0451577_0019851
859 Ga0451577_0202605
860 Ga0451577_0264308
861 Ga0466972_0000056
862 Ga0466972_0036004
863 Ga0453683_0735590
864 Ga0453684_0001324
865 Ga0453684_0003811
866 Ga0451576_0002248
867 Ga0495627_115787
868 Ga0495638_0000020
869 Ga0495580_0242075
870 Ga0495580_0446016
871 Ga0495608_0890542
872 Ga0495628_0017613
873 Ga0495652_0653843
874 Ga0495640_0357424
875 Ga0495668_0008040
876 Ga0495611_0042857
877 Ga0495625_0507269
878 Ga0495635_0394370
879 Ga0495624_0683636
880 Ga0495674_0207082
881 Ga0495672_0019012
882 Ga0496110_0067166
883 Ga0496111_0404674
884 Ga0501293_009221
885 Ga0501299_135715
886 Ga0501034_0493536
887 Ga0501047_0019371
888 Ga0501047_0033486
889 Ga0501207_004383
890 Ga0501223_000963
891 Ga0501223_056448
892 Ga0501242_000041
893 Ga0501243_081309
894 Ga0501249_000030
895 Ga0501257_000150
896 Ga0501257_005192
897 Ga0501259_001528
898 Ga0501219_000169
899 Ga0501225_0031541
900 Ga0501241_000231
901 Ga0501241_048040
902 Ga0501266_005097
903 Ga0501282_009169
904 Ga0501044_0017937
905 Ga0501284_00003
906 nmdc:mga05p37_480_c2
907 nmdc:mga05p37_67424_c1
908 nmdc:mga09592_129337_c1
909 nmdc:mga06r32_520855_c1
910 nmdc:mga06r32_715183_c1
911 nmdc:mga08y16_106800_c1
912 nmdc:mga08y16_53555_c1
913 nmdc:mga0rr50_1609992_c1
914 nmdc:mga0a205_969111_c1
915 Ga0500635_0004366
916 Ga0500578_0000029
917 Ga0500583_0137356
918 Ga0500651_0277827
919 Ga0500641_0000032
920 Ga0500641_0077111
921 Ga0500650_0128373
922 Ga0500650_0155476
923 Ga0500569_037449
924 Ga0500594_0177006
925 Ga0500642_0294780
926 Ga0500658_0000043
927 Ga0500658_0123250
928 Ga0500568_0049759
929 Ga0500568_0143668
930 Ga0500573_0080068
931 Ga0500589_172175
932 Ga0500604_0007842
933 Ga0500604_0037931
934 Ga0500616_0000003
935 Ga0500616_0039422
936 Ga0500616_0076404
937 Ga0500622_0014966
938 Ga0500636_0021629
939 Ga0500584_103863
940 Ga0500645_051416
941 Ga0500645_096259
942 Ga0500661_000844
943 2644372907
944 2738736849
945 2738769389
946 2739218502
947 2840677829
948 2857620831
949 2857630100
950 2896085647
951 2911143405
952 2929154089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

53

189

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9464 8 162
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.93 5 163
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9239 6 165
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.9158 5 160
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9132 5 163
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9464 8 162 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.93 5 163 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9183 6 164 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9132 5 163 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.906 8 160 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A5C7FDR1-F1-model_v4 SRPBCC domain-containing protein 0.9904 1 163
AF-A0A0C1G306-F1-model_v4 deleted 0.9893 1 166
AF-A0A0C1G306-F1-model_v4 deleted 0.9834 1 166
AF-A0A1Z5SK56-F1-model_v4 ATPase 0.9822 1 160
AF-A0A354XXQ7-F1-model_v4 ATPase 0.9812 24 161

Map