F451534

General Info

Members Datasets Scaffolds Average Seq Length
476 302 457 159

Family's Representative Sequence

Representative Sequence 3300025228|Ga0209672_103883|Ga0209672_1038832
Length 192
Sequence VLATAKRLGHRLRLLSGYMKILGIDPGLRTTGFGIIDKQGNKLSYIASGTIKTPDADLPQRLKVILASVSEVIRTYAPDCSAIEKVFVNVNPQSTLLLGQARGAAICSLVSADLPVAEYTALQIKQAVAGHGKAQKQQVQDMVQRLLLLPGADALAVAICHAHSGDALAHLSALAPGLAKKGLRVRGGRLVG

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
7 2818991436 Collimonas arenae 515 Isolate Unclassified
8 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
9 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
10 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
11 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
12 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
13 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
14 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
15 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
16 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
17 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
18 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
19 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
132 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
298 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
301 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 0.21
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.4
Nodule 0.42
Rhizoplane 1.68
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 5.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1022838 3300002076 Bacteria 887
2 JGI25156J39149_1002052 3300002705 Bacteria 7659
3 JGI25162J39368_1000063 3300002737 Bacteria 134747
4 JGI25154J39366_1001609 3300002738 Bacteria 7667
5 JGI25163J39215_1003222 3300002771 Bacteria 1376
6 JGI25165J46597_1000069 3300003214 Bacteria 195460
7 Ga0007409J51694_1044211 3300003575 Bacteria 2430
8 Ga0055538_1000010 3300003751 Bacteria 376599
9 Ga0055538_1000034 3300003751 Bacteria 195460
10 Ga0055539_1000015 3300003752 Bacteria 376599
11 Ga0055539_1000044 3300003752 Bacteria 195460
12 Ga0055533_1000018 3300003756 Bacteria 376599
13 Ga0055533_1000055 3300003756 Bacteria 195460
14 Ga0055525_1000020 3300003759 Bacteria 376599
15 Ga0055525_1000066 3300003759 Bacteria 195460
16 Ga0055541_1000011 3300003841 Bacteria 376599
17 Ga0055541_1000032 3300003841 Bacteria 195460
18 Ga0065712_10155952 3300005290 Bacteria 1335
19 Ga0065707_10017104 3300005295 Bacteria 1374
20 Ga0070658_10007906 3300005327 Bacteria 8565
21 Ga0070658_10195431 3300005327 Bacteria 1706
22 Ga0070683_100703409 3300005329 Bacteria 968
23 Ga0070690_100003552 3300005330 Bacteria 8550
24 Ga0068869_100004021 3300005334 Bacteria 9097
25 Ga0070666_10159553 3300005335 Bacteria 1576
26 Ga0070680_100013530 3300005336 Bacteria 6357
27 Ga0070682_100006656 3300005337 Bacteria 6479
28 Ga0070682_100285845 3300005337 Bacteria 1204
29 Ga0068868_100020871 3300005338 Bacteria 4930
30 Ga0068868_100051820 3300005338 Bacteria 3230
31 Ga0070689_100003236 3300005340 Bacteria 10797
32 Ga0070689_100006203 3300005340 Bacteria 8250
33 Ga0070689_100313243 3300005340 Bacteria 1309
34 Ga0070691_10000625 3300005341 Bacteria 13618
35 Ga0070687_100000952 3300005343 Bacteria 9835
36 Ga0070661_100089514 3300005344 Bacteria 2279
37 Ga0070661_100109043 3300005344 Bacteria 2066
38 Ga0070661_100510161 3300005344 Bacteria 963
39 Ga0070661_100591813 3300005344 Bacteria 896
40 Ga0070661_100825043 3300005344 Bacteria 762
41 Ga0070692_10000171 3300005345 Bacteria 16686
42 Ga0070671_100203287 3300005355 Bacteria 1680
43 Ga0070671_100411745 3300005355 Bacteria 1157
44 Ga0070673_100296826 3300005364 Bacteria 1422
45 Ga0070673_100449867 3300005364 Bacteria 1159
46 Ga0070659_100174394 3300005366 Bacteria 1763
47 Ga0070703_10023868 3300005406 Bacteria 1803
48 Ga0070714_100186786 3300005435 Bacteria 1889
49 Ga0070714_100194398 3300005435 Bacteria 1853
50 Ga0070714_101188096 3300005435 Bacteria 744
51 Ga0070713_100082458 3300005436 Bacteria 2746
52 Ga0070713_100334828 3300005436 Bacteria 1401
53 Ga0070710_10335899 3300005437 Bacteria 996
54 Ga0070701_10002853 3300005438 Bacteria 6736
55 Ga0070705_100001385 3300005440 Bacteria 12885
56 Ga0070700_100004484 3300005441 Bacteria 7297
57 Ga0070694_100003309 3300005444 Bacteria 9641
58 Ga0070694_100142407 3300005444 Bacteria 1743
59 Ga0070678_100023449 3300005456 Bacteria 4113
60 Ga0070681_10008227 3300005458 Bacteria 10206
61 Ga0070681_10028799 3300005458 Bacteria 5582
62 Ga0068867_100003994 3300005459 Bacteria 10375
63 Ga0070685_11147005 3300005466 Bacteria 589
64 Ga0070698_100577553 3300005471 Bacteria 1064
65 Ga0070699_100165208 3300005518 Bacteria 1960
66 Ga0070679_100125794 3300005530 Bacteria 2546
67 Ga0070679_100365502 3300005530 Bacteria 1390
68 Ga0070684_100201679 3300005535 Bacteria 1812
69 Ga0070684_100653056 3300005535 Bacteria 979
70 Ga0070697_100055465 3300005536 Bacteria 3222
71 Ga0068853_100052010 3300005539 Bacteria 3528
72 Ga0068853_100119849 3300005539 Bacteria 2346
73 Ga0070686_100003129 3300005544 Bacteria 9062
74 Ga0070695_100000140 3300005545 Bacteria 33449
75 Ga0070696_100000008 3300005546 Bacteria 101365
76 Ga0070693_100000154 3300005547 Bacteria 31511
77 Ga0070665_100573526 3300005548 Bacteria 1141
78 Ga0070704_100000956 3300005549 Bacteria 14644
79 Ga0070704_100083298 3300005549 Bacteria 2361
80 Ga0068855_100007751 3300005563 Bacteria 12965
81 Ga0068855_100015523 3300005563 Bacteria 9170
82 Ga0068855_100135240 3300005563 Bacteria 2813
83 Ga0068854_100007964 3300005578 Bacteria 6785
84 Ga0068856_100015177 3300005614 Bacteria 7441
85 Ga0068856_100238019 3300005614 Bacteria 1836
86 Ga0070702_100000421 3300005615 Bacteria 15080
87 Ga0068852_100001543 3300005616 Bacteria 15632
88 Ga0068852_100015162 3300005616 Bacteria 5965
89 Ga0068852_100129271 3300005616 Bacteria 2324
90 Ga0068852_100146616 3300005616 Bacteria 2190
91 Ga0068852_100872632 3300005616 Bacteria 916
92 Ga0068859_100002186 3300005617 Bacteria 19854
93 Ga0068859_100225830 3300005617 Bacteria 1961
94 Ga0068866_10002041 3300005718 Bacteria 8407
95 Ga0068861_100006714 3300005719 Bacteria 7860
96 Ga0068851_10000691 3300005834 Bacteria 14376
97 Ga0068851_10015826 3300005834 Bacteria 3600
98 Ga0068863_100371933 3300005841 Bacteria 1395
99 Ga0068858_100012318 3300005842 Bacteria 8063
100 Ga0068858_100079493 3300005842 Bacteria 3047
101 Ga0068858_100216243 3300005842 Bacteria 1814
102 Ga0068860_100009594 3300005843 Bacteria 9618
103 Ga0068862_100006076 3300005844 Bacteria 10053
104 Ga0075364_10123974 3300006051 Bacteria 1731
105 Ga0075364_10202451 3300006051 Bacteria 1346
106 Ga0070715_10169967 3300006163 Bacteria 1085
107 Ga0070716_100095334 3300006173 Bacteria 1811
108 Ga0070712_100083247 3300006175 Bacteria 2323
109 Ga0075366_10006792 3300006195 Bacteria 6288
110 Ga0097621_100003516 3300006237 Bacteria 10822
111 Ga0097621_100076805 3300006237 Bacteria 2771
112 Ga0097621_100103703 3300006237 Bacteria 2396
113 Ga0097621_100494730 3300006237 Bacteria 1107
114 Ga0068871_100000152 3300006358 Bacteria 45602
115 Ga0068871_100002447 3300006358 Bacteria 12683
116 Ga0068871_100008429 3300006358 Bacteria 7413
117 Ga0068871_100172383 3300006358 Bacteria 1856
118 Ga0075428_100000202 3300006844 Bacteria 56911
119 Ga0075430_100081967 3300006846 Bacteria 2703
120 Ga0075429_100000184 3300006880 Bacteria 40869
121 Ga0075429_100782475 3300006880 Bacteria 836
122 Ga0068865_100005212 3300006881 Bacteria 7860
123 Ga0075436_100007984 3300006914 Bacteria 7245
124 Ga0075436_100116980 3300006914 Bacteria 1863
125 Ga0075436_100167090 3300006914 Bacteria 1552
126 Ga0097620_100002187 3300006931 Bacteria 19854
127 Ga0097620_100225830 3300006931 Bacteria 1961
128 Ga0099794_10453773 3300007265 Bacteria 672
129 Ga0099795_10037581 3300007788 Bacteria 1705
130 Ga0105250_10052364 3300009092 Bacteria 1638
131 Ga0105240_10002138 3300009093 Bacteria 32275
132 Ga0105240_10028163 3300009093 Bacteria 7344
133 Ga0105240_10194606 3300009093 Bacteria 2382
134 Ga0105240_10194608 3300009093 Bacteria 2382
135 Ga0105240_10320056 3300009093 Bacteria 1768
136 Ga0105240_10405035 3300009093 Bacteria 1536
137 Ga0111539_10120597 3300009094 Bacteria 3073
138 Ga0111539_10148225 3300009094 Bacteria 2747
139 Ga0105245_10007290 3300009098 Bacteria 9683
140 Ga0105245_10247358 3300009098 Bacteria 1731
141 Ga0114129_10000677 3300009147 Bacteria 42898
142 Ga0105243_10007189 3300009148 Bacteria 8557
143 Ga0105243_10456085 3300009148 Bacteria 1201
144 Ga0105241_10108838 3300009174 Bacteria 2216
145 Ga0105241_10476101 3300009174 Bacteria 1109
146 Ga0105242_10004711 3300009176 Bacteria 10560
147 Ga0105242_10024588 3300009176 Bacteria 4758
148 Ga0105248_10032690 3300009177 Bacteria 5811
149 Ga0105248_10052244 3300009177 Bacteria 4586
150 Ga0105248_10243715 3300009177 Bacteria 2023
151 Ga0105248_10491098 3300009177 Bacteria 1384
152 Ga0105238_10000004 3300009551 Bacteria 390514
153 Ga0105238_10034039 3300009551 Bacteria 5185
154 Ga0105238_10043910 3300009551 Bacteria 4521
155 Ga0105238_11707038 3300009551 Bacteria 661
156 Ga0105249_10005527 3300009553 Bacteria 10917
157 Ga0105249_10447587 3300009553 Bacteria 1330
158 Ga0105239_10001658 3300010375 Bacteria 29346
159 Ga0105239_10015553 3300010375 Bacteria 8427
160 Ga0105246_10115080 3300011119 Bacteria 1983
161 Ga0157371_10049286 3300013102 Bacteria 2992
162 Ga0157371_10442989 3300013102 Bacteria 954
163 Ga0157369_10003243 3300013105 Bacteria 19372
164 Ga0157374_10104112 3300013296 Bacteria 2724
165 Ga0157374_10161061 3300013296 Bacteria 2186
166 Ga0157378_10007547 3300013297 Bacteria 9496
167 Ga0157378_10212921 3300013297 Bacteria 1833
168 Ga0163162_10244771 3300013306 Bacteria 1925
169 Ga0163162_11298607 3300013306 Bacteria 827
170 Ga0163162_12229871 3300013306 Bacteria 629
171 Ga0157372_10005338 3300013307 Bacteria 13651
172 Ga0157372_10191278 3300013307 Bacteria 2370
173 Ga0157372_11447966 3300013307 Bacteria 792
174 Ga0157375_10054474 3300013308 Bacteria 3939
175 Ga0157375_10247899 3300013308 Bacteria 1941
176 Ga0157380_10036126 3300014326 Bacteria 3821
177 Ga0157377_10912833 3300014745 Bacteria 658
178 Ga0157379_10151248 3300014968 Bacteria 2093
179 Ga0157376_10055681 3300014969 Bacteria 3301
180 Ga0157376_10068833 3300014969 Bacteria 2999
181 Ga0157376_10071670 3300014969 Bacteria 2946
182 Ga0157376_10171802 3300014969 Bacteria 1974
183 Ga0182006_1003475 3300015261 Bacteria 8041
184 Ga0182006_1044347 3300015261 Bacteria 1735
185 Ga0182007_10000969 3300015262 Bacteria 15748
186 Ga0182007_10016832 3300015262 Bacteria 2686
187 Ga0182007_10228343 3300015262 Bacteria 660
188 Ga0182005_1000283 3300015265 Bacteria 31970
189 Ga0163161_10303089 3300017792 Bacteria 1259
190 Ga0213872_10000450 3300021361 Bacteria 33492
191 Ga0213872_10008677 3300021361 Bacteria 4908
192 Ga0213872_10044734 3300021361 Bacteria 2014
193 Ga0209435_100151 3300025206 Bacteria 22562
194 Ga0209760_101489 3300025207 Bacteria 2449
195 Ga0209784_100025 3300025224 Bacteria 376681
196 Ga0209784_100049 3300025224 Bacteria 195512
197 Ga0209566_100025 3300025225 Bacteria 376681
198 Ga0209566_100061 3300025225 Bacteria 195512
199 Ga0209674_100042 3300025226 Bacteria 376681
200 Ga0209674_100069 3300025226 Bacteria 243948
201 Ga0209672_103883 3300025228 Bacteria 2936
202 Ga0209563_100046 3300025230 Bacteria 376681
203 Ga0209563_100083 3300025230 Bacteria 195512
204 Ga0207427_100345 3300025231 Bacteria 30030
205 Ga0209437_100091 3300025233 Bacteria 243344
206 Ga0209646_1000282 3300025246 Bacteria 44376
207 Ga0209026_1005158 3300025250 Bacteria 3594
208 Ga0209677_100027 3300025253 Bacteria 376681
209 Ga0209677_100039 3300025253 Bacteria 243974
210 Ga0209759_1000388 3300025256 Bacteria 54852
211 Ga0209233_1000115 3300025261 Bacteria 243344
212 Ga0207656_10000877 3300025321 Bacteria 9806
213 Ga0207692_10118665 3300025898 Bacteria 1478
214 Ga0207642_10002187 3300025899 Bacteria 6062
215 Ga0207688_10038449 3300025901 Bacteria 2656
216 Ga0207680_10280737 3300025903 Bacteria 1157
217 Ga0207705_10046325 3300025909 Bacteria 3125
218 Ga0207705_10067349 3300025909 Bacteria 2591
219 Ga0207654_10048980 3300025911 Bacteria 2421
220 Ga0207707_10380307 3300025912 Bacteria 1214
221 Ga0207707_10496557 3300025912 Bacteria 1041
222 Ga0207695_10001007 3300025913 Bacteria 49769
223 Ga0207695_10005275 3300025913 Bacteria 17229
224 Ga0207695_10159958 3300025913 Bacteria 2184
225 Ga0207695_10209453 3300025913 Bacteria 1861
226 Ga0207671_10011230 3300025914 Bacteria 7307
227 Ga0207693_10055459 3300025915 Bacteria 3109
228 Ga0207660_10010473 3300025917 Bacteria 6020
229 Ga0207660_10453256 3300025917 Bacteria 1037
230 Ga0207662_10001772 3300025918 Bacteria 10599
231 Ga0207649_10436509 3300025920 Bacteria 986
232 Ga0207649_10498772 3300025920 Bacteria 926
233 Ga0207649_10507613 3300025920 Bacteria 918
234 Ga0207652_10003546 3300025921 Bacteria 12882
235 Ga0207652_10022452 3300025921 Bacteria 5220
236 Ga0207652_10258157 3300025921 Bacteria 1572
237 Ga0207694_10000021 3300025924 Bacteria 300246
238 Ga0207694_10048847 3300025924 Bacteria 3275
239 Ga0207694_10365760 3300025924 Bacteria 1196
240 Ga0207687_10001190 3300025927 Bacteria 17765
241 Ga0207664_10541497 3300025929 Bacteria 1044
242 Ga0207644_10160437 3300025931 Bacteria 1747
243 Ga0207644_10213772 3300025931 Bacteria 1526
244 Ga0207686_10000246 3300025934 Bacteria 41384
245 Ga0207686_10021595 3300025934 Bacteria 3697
246 Ga0207709_10003128 3300025935 Bacteria 9955
247 Ga0207670_10000747 3300025936 Bacteria 17073
248 Ga0207670_10134171 3300025936 Bacteria 1818
249 Ga0207704_10001629 3300025938 Bacteria 10062
250 Ga0207665_10010614 3300025939 Bacteria 6050
251 Ga0207665_10151578 3300025939 Bacteria 1661
252 Ga0207665_10614793 3300025939 Bacteria 849
253 Ga0207711_10100962 3300025941 Bacteria 2553
254 Ga0207711_10124141 3300025941 Bacteria 2308
255 Ga0207689_10007929 3300025942 Bacteria 9275
256 Ga0207689_10032102 3300025942 Bacteria 4368
257 Ga0207661_10994294 3300025944 Bacteria 773
258 Ga0207667_10000235 3300025949 Bacteria 77134
259 Ga0207667_10010577 3300025949 Bacteria 10777
260 Ga0207667_10018886 3300025949 Bacteria 7713
261 Ga0207667_10032626 3300025949 Bacteria 5608
262 Ga0207667_10361811 3300025949 Bacteria 1479
263 Ga0207667_11010530 3300025949 Bacteria 818
264 Ga0207651_10028605 3300025960 Bacteria 3519
265 Ga0207712_10001322 3300025961 Bacteria 16967
266 Ga0207668_10144261 3300025972 Bacteria 1835
267 Ga0207640_10089059 3300025981 Bacteria 2132
268 Ga0207640_10169618 3300025981 Bacteria 1625
269 Ga0207677_10008880 3300026023 Bacteria 5634
270 Ga0207677_10279269 3300026023 Bacteria 1370
271 Ga0207703_10008914 3300026035 Bacteria 7901
272 Ga0207703_10125364 3300026035 Bacteria 2210
273 Ga0207703_10178639 3300026035 Bacteria 1872
274 Ga0207708_10000601 3300026075 Bacteria 27771
275 Ga0207708_10429682 3300026075 Bacteria 1097
276 Ga0207708_10504281 3300026075 Bacteria 1015
277 Ga0207702_10018247 3300026078 Bacteria 5804
278 Ga0207702_10074513 3300026078 Bacteria 2930
279 Ga0207702_10132464 3300026078 Bacteria 2245
280 Ga0207702_10199062 3300026078 Bacteria 1856
281 Ga0207702_10324450 3300026078 Bacteria 1467
282 Ga0207641_10325611 3300026088 Bacteria 1458
283 Ga0207648_10002542 3300026089 Bacteria 19564
284 Ga0207648_10045211 3300026089 Bacteria 3863
285 Ga0207676_10287302 3300026095 Bacteria 1496
286 Ga0207675_100009511 3300026118 Bacteria 9094
287 Ga0207683_10075461 3300026121 Bacteria 2984
288 Ga0207698_10004043 3300026142 Bacteria 8903
289 Ga0207698_10009618 3300026142 Bacteria 6173
290 Ga0207698_10134858 3300026142 Bacteria 2117
291 Ga0207698_10688190 3300026142 Bacteria 1016
292 Ga0207698_11017042 3300026142 Bacteria 840
293 Ga0209981_1003994 3300027378 Bacteria 1922
294 Ga0210000_1002145 3300027462 Bacteria 2799
295 Ga0210000_1017130 3300027462 Bacteria 1097
296 Ga0209995_1004686 3300027471 Bacteria 2194
297 Ga0209995_1019189 3300027471 Bacteria 1129
298 Ga0209999_1002565 3300027543 Bacteria 3212
299 Ga0209983_1009598 3300027665 Bacteria 1978
300 Ga0207428_10000453 3300027907 Bacteria 49756
301 Ga0268266_10493783 3300028379 Bacteria 1168
302 Ga0268265_10005081 3300028380 Bacteria 9021
303 Ga0268264_10009530 3300028381 Bacteria 8044
304 Ga0268264_10564522 3300028381 Bacteria 1118
305 Ga0265324_10081870 3300029957 Bacteria 1098
306 Ga0265330_10002138 3300031235 Bacteria 10894
307 Ga0265328_10029043 3300031239 Bacteria 2067
308 Ga0265325_10071131 3300031241 Bacteria 1747
309 Ga0265314_10049358 3300031711 Bacteria 2947
310 Ga0307516_10093997 3300031730 Bacteria 2823
311 Ga0307407_10183990 3300031903 Bacteria 1387
312 Ga0307412_10470713 3300031911 Bacteria 1040
313 Ga0307416_100140634 3300032002 Bacteria 2193
314 Ga0307416_100183455 3300032002 Bacteria 1964
315 Ga0307416_100630096 3300032002 Bacteria 1155
316 Ga0373959_0039574 3300034820 Bacteria 984
317 Ga0373926_0003541 3300035083 Bacteria 5053
318 Ga0373934_0000098 3300035086 Bacteria 30518
319 Ga0373934_0047525 3300035086 Bacteria 1698
320 Ga0373952_0015480 3300035092 Bacteria 1540
321 Ga0373936_0047270 3300035113 Bacteria 1735
322 Ga0373936_0174577 3300035113 Bacteria 941
323 Ga0373945_0011568 3300035116 Bacteria 2920
324 Ga0373954_0000709 3300035118 Bacteria 12806
325 Ga0373956_0005111 3300035119 Bacteria 5250
326 Ga0373956_0067439 3300035119 Bacteria 1629
327 Ga0373956_0224835 3300035119 Bacteria 891
328 Ga0373960_0093586 3300035121 Bacteria 964
329 Ga0373960_0169498 3300035121 Bacteria 756
330 Ga0373943_0140030 3300035170 Bacteria 1302
331 Ga0373955_0019125 3300035172 Bacteria 3418
332 Ga0373955_0072781 3300035172 Bacteria 1926
333 Ga0373955_0087106 3300035172 Bacteria 1774
334 Ga0373961_0088547 3300035241 Bacteria 985
335 Ga0373935_0030000 3300035692 Bacteria 3367
336 Ga0373935_0307678 3300035692 Bacteria 1121
337 Ga0373927_0017581 3300035695 Bacteria 4705
338 Ga0373927_0061869 3300035695 Bacteria 2421
339 Ga0373933_0003854 3300035724 Bacteria 8273
340 Ga0373947_0006166 3300035725 Bacteria 6973
341 Ga0373947_0075236 3300035725 Bacteria 2079
342 Ga0373947_0376162 3300035725 Bacteria 955
343 Ga0373937_0001120 3300036401 Bacteria 22587
344 Ga0373937_0157724 3300036401 Bacteria 2127
345 Ga0373937_1813262 3300036401 Bacteria 556
346 Ga0373925_0010477 3300037068 Bacteria 6723
347 Ga0373925_0127049 3300037068 Bacteria 1984
348 Ga0395900_0088752 3300037418 Bacteria 3179
349 Ga0395900_0899126 3300037418 Bacteria 809
350 Ga0395905_0009395 3300037471 Bacteria 9561
351 Ga0395905_0236208 3300037471 Bacteria 1708
352 Ga0436365_0154096 3300039437 Bacteria 1641
353 Ga0436361_0039082 3300039447 Bacteria 5271
354 Ga0436361_0491286 3300039447 Bacteria 822
355 Ga0436361_0719937 3300039447 Bacteria 34414
356 Ga0451798_0352418 3300041458 Bacteria 1607
357 Ga0439446_0014027 3300042156 Bacteria 2206
358 Ga0439434_0013853 3300042435 Bacteria 2396
359 Ga0439435_0001341 3300042436 Bacteria 4498
360 Ga0451577_0013667 3300042876 Bacteria 7591
361 Ga0466966_0044714 3300044684 Bacteria 2834
362 Ga0453684_0798705 3300044712 Bacteria 1018
363 Ga0466957_0009472 3300044842 Bacteria 5561
364 Ga0451576_0004947 3300045051 Bacteria 16955
365 Ga0451576_0051750 3300045051 Bacteria 4305
366 Ga0451576_0281404 3300045051 Bacteria 1739
367 Ga0466958_0018967 3300045836 Bacteria 3999
368 Ga0466967_0040046 3300045976 Bacteria 4032
369 Ga0495603_0004972 3300046455 Bacteria 7955
370 Ga0495651_0000147 3300046462 Bacteria 51361
371 Ga0495651_0006734 3300046462 Bacteria 8786
372 Ga0495651_0338023 3300046462 Bacteria 998
373 Ga0495653_0031932 3300046463 Bacteria 4184
374 Ga0495580_0001671 3300046472 Bacteria 19481
375 Ga0495639_0054958 3300046475 Bacteria 1815
376 Ga0495594_0139548 3300046499 Bacteria 1374
377 Ga0495608_0097228 3300046511 Bacteria 1901
378 Ga0495608_0412624 3300046511 Bacteria 825
379 Ga0495628_0001687 3300046516 Bacteria 20156
380 Ga0495628_0200546 3300046516 Bacteria 1503
381 Ga0495630_1006285 3300046517 Bacteria 633
382 Ga0495652_0018067 3300046529 Bacteria 6291
383 Ga0495652_0039978 3300046529 Bacteria 4054
384 Ga0495652_0224871 3300046529 Bacteria 1408
385 Ga0495665_0066158 3300046531 Bacteria 1908
386 Ga0495586_0006582 3300046535 Bacteria 6208
387 Ga0495586_0014427 3300046535 Bacteria 4197
388 Ga0495621_0145852 3300046539 Bacteria 928
389 Ga0495645_0007709 3300046543 Bacteria 7489
390 Ga0495645_0026656 3300046543 Bacteria 4196
391 Ga0495645_0651256 3300046543 Bacteria 643
392 Ga0495622_0033238 3300046557 Bacteria 2408
393 Ga0495635_0458584 3300046663 Bacteria 842
394 Ga0495657_0433723 3300046675 Bacteria 771
395 Ga0495657_0581960 3300046675 Bacteria 648
396 Ga0495657_0599917 3300046675 Bacteria 637
397 Ga0495599_0012448 3300046678 Bacteria 5244
398 Ga0495599_0068772 3300046678 Bacteria 2211
399 Ga0495599_0096428 3300046678 Bacteria 1844
400 Ga0495623_0065845 3300046679 Bacteria 2265
401 Ga0495623_0210417 3300046679 Bacteria 1113
402 Ga0495646_0095956 3300046680 Bacteria 1705
403 Ga0495647_0000269 3300046681 Bacteria 14415
404 Ga0495658_0023465 3300046683 Bacteria 3274
405 Ga0495658_0118524 3300046683 Bacteria 1599
406 Ga0495624_0213894 3300046690 Bacteria 1169
407 Ga0495581_0045762 3300047315 Bacteria 2529
408 Ga0495604_0216687 3300047317 Bacteria 1320
409 Ga0495676_0088640 3300047321 Bacteria 2320
410 Ga0495676_0116104 3300047321 Bacteria 1955
411 Ga0495680_0332614 3300047322 Bacteria 1061
412 Ga0495684_0079010 3300047471 Bacteria 2497
413 Ga0495602_0219445 3300048088 Bacteria 1436
414 Ga0495614_0317370 3300048089 Bacteria 722
415 Ga0496100_0029823 3300048903 Bacteria 3378
416 Ga0496104_0013558 3300048907 Bacteria 7347
417 Ga0496106_0337948 3300048909 Bacteria 1209
418 Ga0496110_0035126 3300048913 Bacteria 4347
419 Ga0496111_0384096 3300048914 Bacteria 1038
420 Ga0496114_0635712 3300048917 Bacteria 940
421 Ga0496115_0645845 3300048918 Bacteria 837
422 Ga0496116_0073521 3300048919 Bacteria 2154
423 Ga0496118_0228432 3300048921 Bacteria 1076
424 Ga0496118_0300580 3300048921 Bacteria 881
425 Ga0496121_0011040 3300048924 Bacteria 10082
426 Ga0496121_0024269 3300048924 Bacteria 5808
427 Ga0496121_0106708 3300048924 Bacteria 2147
428 Ga0496125_0003359 3300048928 Bacteria 19489
429 Ga0496126_0110018 3300048929 Bacteria 2401
430 Ga0501032_0061675 3300049569 Bacteria 2513
431 Ga0501032_0061982 3300049569 Bacteria 2506
432 Ga0501036_0179286 3300049572 Bacteria 1784
433 Ga0501043_0098682 3300049579 Bacteria 2296
434 Ga0501047_0007881 3300049581 Bacteria 10041
435 Ga0501047_0549235 3300049581 Bacteria 980
436 Ga0501080_0358244 3300049742 Bacteria 1316
437 nmdc:mga00v17_549509_c1 3300050491 Bacteria 747
438 nmdc:mga0k408_6421_c1 3300050493 Bacteria 6272
439 nmdc:mga06z11_295937_c1 3300050494 Bacteria 961
440 nmdc:mga05p37_244_c1 3300050507 Bacteria 55725
441 nmdc:mga09592_110_c1 3300050508 Bacteria 51342
442 nmdc:mga0qj67_28305_c1 3300050509 Bacteria 4350
443 nmdc:mga0qj67_786651_c1 3300050509 Bacteria 754
444 nmdc:mga08y16_2203_c1 3300050511 Bacteria 19987
445 nmdc:mga0n895_35856_c1 3300050512 Bacteria 4786
446 nmdc:mga08x19_274054_c1 3300050514 Bacteria 1168
447 nmdc:mga08x19_508_c1 3300050514 Bacteria 25857
448 Ga0495601_0004322 3300053077 Bacteria 8208
449 Ga0495601_0062607 3300053077 Bacteria 2363
450 Ga0500595_002056 3300053119 Bacteria 10282
451 Ga0500618_004652 3300053125 Bacteria 4322
452 Ga0500574_000689 3300053141 Bacteria 4451
453 Ga0500619_005765 3300053154 Bacteria 2793
454 Ga0500622_0151116 3300053156 Bacteria 1097
455 Ga0500624_007448 3300053157 Bacteria 1505
456 Ga0590071_023845 3300059421 Bacteria 1448
457 Ga0590077_052002 3300059426 Bacteria 920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10183990 Ga0307407_101839902 120
2 3300049569 Ga0501032_0061675 Ga0501032_0061675_2122_2499 124
3 3300026078 Ga0207702_10074513 Ga0207702_100745131 127
4 3300002705 JGI25156J39149_1002052 JGI25156J39149_10020529 129
5 3300002738 JGI25154J39366_1001609 JGI25154J39366_10016092 129
6 3300009093 Ga0105240_10002138 Ga0105240_100021384 129
7 3300025206 Ga0209435_100151 Ga0209435_1001512 129
8 3300025246 Ga0209646_1000282 Ga0209646_100028213 129
9 3300025250 Ga0209026_1005158 Ga0209026_10051583 129
10 3300025256 Ga0209759_1000388 Ga0209759_100038813 129
11 3300039437 Ga0436365_0154096 Ga0436365_0154096_383_940 129
12 3300048921 Ga0496118_0228432 Ga0496118_0228432_355_897 129
13 3300048924 Ga0496121_0011040 Ga0496121_0011040_1140_1682 129
14 3300002737 JGI25162J39368_1000063 JGI25162J39368_100006352 130
15 3300002771 JGI25163J39215_1003222 JGI25163J39215_10032221 130
16 3300003214 JGI25165J46597_1000069 JGI25165J46597_100006952 130
17 3300003751 Ga0055538_1000034 Ga0055538_100003451 130
18 3300003752 Ga0055539_1000044 Ga0055539_100004451 130
19 3300003756 Ga0055533_1000055 Ga0055533_100005551 130
20 3300003759 Ga0055525_1000066 Ga0055525_1000066131 130
21 3300003841 Ga0055541_1000032 Ga0055541_1000032132 130
22 3300005344 Ga0070661_100510161 Ga0070661_1005101612 130
23 3300006175 Ga0070712_100083247 Ga0070712_1000832472 130
24 3300015261 Ga0182006_1044347 Ga0182006_10443472 130
25 3300015262 Ga0182007_10000969 Ga0182007_1000096913 130
26 3300015262 Ga0182007_10016832 Ga0182007_100168322 130
27 3300015265 Ga0182005_1000283 Ga0182005_100028323 130
28 3300025207 Ga0209760_101489 Ga0209760_1014892 130
29 3300025224 Ga0209784_100049 Ga0209784_100049131 130
30 3300025225 Ga0209566_100061 Ga0209566_100061131 130
31 3300025226 Ga0209674_100069 Ga0209674_100069180 130
32 3300025230 Ga0209563_100083 Ga0209563_100083131 130
33 3300025231 Ga0207427_100345 Ga0207427_10034516 130
34 3300025233 Ga0209437_100091 Ga0209437_100091179 130
35 3300025253 Ga0209677_100039 Ga0209677_100039180 130
36 3300025261 Ga0209233_1000115 Ga0209233_1000115179 130
37 3300025915 Ga0207693_10055459 Ga0207693_100554592 130
38 3300025920 Ga0207649_10436509 Ga0207649_104365091 130
39 3300046462 Ga0495651_0006734 Ga0495651_0006734_6696_7238 130
40 3300046462 Ga0495651_0338023 Ga0495651_0338023_344_886 130
41 3300046463 Ga0495653_0031932 Ga0495653_0031932_152_694 130
42 3300046511 Ga0495608_0097228 Ga0495608_0097228_463_1005 130
43 3300046516 Ga0495628_0001687 Ga0495628_0001687_17311_17853 130
44 3300046516 Ga0495628_0200546 Ga0495628_0200546_915_1457 130
45 3300046529 Ga0495652_0018067 Ga0495652_0018067_5737_6279 130
46 3300046543 Ga0495645_0651256 Ga0495645_0651256_27_569 130
47 3300046557 Ga0495622_0033238 Ga0495622_0033238_913_1455 130
48 3300046663 Ga0495635_0458584 Ga0495635_0458584_179_721 130
49 3300046675 Ga0495657_0581960 Ga0495657_0581960_73_615 130
50 3300046678 Ga0495599_0096428 Ga0495599_0096428_392_934 130
51 3300046679 Ga0495623_0065845 Ga0495623_0065845_1542_2084 130
52 3300046679 Ga0495623_0210417 Ga0495623_0210417_252_794 130
53 3300046680 Ga0495646_0095956 Ga0495646_0095956_1032_1574 130
54 3300046683 Ga0495658_0118524 Ga0495658_0118524_706_1248 130
55 3300047317 Ga0495604_0216687 Ga0495604_0216687_125_667 130
56 3300047321 Ga0495676_0088640 Ga0495676_0088640_1060_1602 130
57 3300048088 Ga0495602_0219445 Ga0495602_0219445_806_1348 130
58 3300048919 Ga0496116_0073521 Ga0496116_0073521_1351_1893 130
59 3300048921 Ga0496118_0300580 Ga0496118_0300580_112_654 130
60 3300048924 Ga0496121_0106708 Ga0496121_0106708_536_1078 130
61 3300053077 Ga0495601_0004322 Ga0495601_0004322_1076_1618 130
62 3300053119 Ga0500595_002056 Ga0500595_002056_7524_8066 130
63 3300053125 Ga0500618_004652 Ga0500618_004652_1472_2014 130
64 3300053141 Ga0500574_000689 Ga0500574_000689_934_1476 130
65 3300053154 Ga0500619_005765 Ga0500619_005765_1289_1831 130
66 3300003751 Ga0055538_1000010 Ga0055538_100001055 131
67 3300003752 Ga0055539_1000015 Ga0055539_100001555 131
68 3300003756 Ga0055533_1000018 Ga0055533_100001855 131
69 3300003759 Ga0055525_1000020 Ga0055525_100002055 131
70 3300003841 Ga0055541_1000011 Ga0055541_100001155 131
71 3300005563 Ga0068855_100007751 Ga0068855_1000077516 131
72 3300005578 Ga0068854_100007964 Ga0068854_1000079649 131
73 3300005834 Ga0068851_10015826 Ga0068851_100158262 131
74 3300009093 Ga0105240_10194606 Ga0105240_101946062 131
75 3300009093 Ga0105240_10194608 Ga0105240_101946082 131
76 3300009551 Ga0105238_10000004 Ga0105238_10000004122 131
77 3300010375 Ga0105239_10001658 Ga0105239_1000165814 131
78 3300015261 Ga0182006_1003475 Ga0182006_10034758 131
79 3300015262 Ga0182007_10228343 Ga0182007_102283431 131
80 3300021361 Ga0213872_10008677 Ga0213872_100086774 131
81 3300021361 Ga0213872_10044734 Ga0213872_100447342 131
82 3300025224 Ga0209784_100025 Ga0209784_10002556 131
83 3300025225 Ga0209566_100025 Ga0209566_10002556 131
84 3300025226 Ga0209674_100042 Ga0209674_10004256 131
85 3300025230 Ga0209563_100046 Ga0209563_10004656 131
86 3300025253 Ga0209677_100027 Ga0209677_10002756 131
87 3300025913 Ga0207695_10001007 Ga0207695_1000100746 131
88 3300025913 Ga0207695_10209453 Ga0207695_102094532 131
89 3300025914 Ga0207671_10011230 Ga0207671_100112307 131
90 3300025924 Ga0207694_10000021 Ga0207694_1000002140 131
91 3300025949 Ga0207667_10000235 Ga0207667_1000023565 131
92 3300025949 Ga0207667_10018886 Ga0207667_100188863 131
93 3300025981 Ga0207640_10089059 Ga0207640_100890593 131
94 3300026078 Ga0207702_10199062 Ga0207702_101990622 131
95 3300039447 Ga0436361_0039082 Ga0436361_0039082_504_1046 131
96 3300006358 Ga0068871_100008429 Ga0068871_1000084295 132
97 3300014969 Ga0157376_10171802 Ga0157376_101718022 132
98 3300050514 nmdc:mga08x19_274054_c1 nmdc:mga08x19_274054_c1_12_410 132
99 3300005338 Ga0068868_100051820 Ga0068868_1000518202 134
100 3300005344 Ga0070661_100591813 Ga0070661_1005918132 134
101 3300005355 Ga0070671_100411745 Ga0070671_1004117452 134
102 3300005616 Ga0068852_100001543 Ga0068852_1000015439 134
103 3300005834 Ga0068851_10000691 Ga0068851_100006919 134
104 3300006237 Ga0097621_100103703 Ga0097621_1001037034 134
105 3300006914 Ga0075436_100007984 Ga0075436_1000079848 134
106 3300009093 Ga0105240_10320056 Ga0105240_103200562 134
107 3300009177 Ga0105248_10032690 Ga0105248_100326902 134
108 3300013296 Ga0157374_10104112 Ga0157374_101041122 134
109 3300025321 Ga0207656_10000877 Ga0207656_100008779 134
110 3300025913 Ga0207695_10159958 Ga0207695_101599584 134
111 3300025920 Ga0207649_10498772 Ga0207649_104987722 134
112 3300025931 Ga0207644_10213772 Ga0207644_102137722 134
113 3300025941 Ga0207711_10100962 Ga0207711_101009625 134
114 3300025949 Ga0207667_10032626 Ga0207667_100326266 134
115 3300026023 Ga0207677_10279269 Ga0207677_102792692 134
116 3300026142 Ga0207698_10009618 Ga0207698_100096187 134
117 3300035113 Ga0373936_0174577 Ga0373936_0174577_117_590 134
118 3300035725 Ga0373947_0075236 Ga0373947_0075236_1361_1834 134
119 3300048907 Ga0496104_0013558 Ga0496104_0013558_6815_7288 134
120 3300048913 Ga0496110_0035126 Ga0496110_0035126_2732_3205 134
121 3300048914 Ga0496111_0384096 Ga0496111_0384096_369_842 134
122 3300050512 nmdc:mga0n895_35856_c1 nmdc:mga0n895_35856_c1_3646_4176 134
123 3300050514 nmdc:mga08x19_508_c1 nmdc:mga08x19_508_c1_76_606 134
124 3300006051 Ga0075364_10202451 Ga0075364_102024513 135
125 3300006195 Ga0075366_10006792 Ga0075366_100067926 135
126 3300006914 Ga0075436_100116980 Ga0075436_1001169802 135
127 3300044712 Ga0453684_0798705 Ga0453684_0798705_18_509 135
128 3300050491 nmdc:mga00v17_549509_c1 nmdc:mga00v17_549509_c1_17_565 135
129 3300050493 nmdc:mga0k408_6421_c1 nmdc:mga0k408_6421_c1_2875_3423 135
130 3300050494 nmdc:mga06z11_295937_c1 nmdc:mga06z11_295937_c1_243_791 135
131 3300005471 Ga0070698_100577553 Ga0070698_1005775531 136
132 3300025972 Ga0207668_10144261 Ga0207668_101442612 136
133 3300028381 Ga0268264_10564522 Ga0268264_105645222 136
134 3300049581 Ga0501047_0007881 Ga0501047_0007881_1450_1980 136
135 3300049742 Ga0501080_0358244 Ga0501080_0358244_289_819 136
136 3300005549 Ga0070704_100083298 Ga0070704_1000832982 137
137 3300006173 Ga0070716_100095334 Ga0070716_1000953342 137
138 3300006914 Ga0075436_100167090 Ga0075436_1001670902 137
139 3300007265 Ga0099794_10453773 Ga0099794_104537731 137
140 3300007788 Ga0099795_10037581 Ga0099795_100375812 137
141 3300025939 Ga0207665_10010614 Ga0207665_100106142 137
142 3300005344 Ga0070661_100089514 Ga0070661_1000895142 138
143 3300005435 Ga0070714_100186786 Ga0070714_1001867863 138
144 3300005436 Ga0070713_100082458 Ga0070713_1000824583 138
145 3300005530 Ga0070679_100365502 Ga0070679_1003655021 138
146 3300005539 Ga0068853_100119849 Ga0068853_1001198493 138
147 3300009174 Ga0105241_10108838 Ga0105241_101088384 138
148 3300009551 Ga0105238_10043910 Ga0105238_100439103 138
149 3300013307 Ga0157372_10191278 Ga0157372_101912782 138
150 3300025911 Ga0207654_10048980 Ga0207654_100489801 138
151 3300025912 Ga0207707_10380307 Ga0207707_103803071 138
152 3300025921 Ga0207652_10258157 Ga0207652_102581573 138
153 3300025924 Ga0207694_10048847 Ga0207694_100488475 138
154 3300025929 Ga0207664_10541497 Ga0207664_105414972 138
155 3300026142 Ga0207698_10688190 Ga0207698_106881902 138
156 3300037418 Ga0395900_0899126 Ga0395900_0899126_176_763 138
157 3300037471 Ga0395905_0236208 Ga0395905_0236208_1081_1668 138
158 3300006237 Ga0097621_100494730 Ga0097621_1004947302 139
159 3300006358 Ga0068871_100172383 Ga0068871_1001723833 139
160 3300009177 Ga0105248_10052244 Ga0105248_100522441 139
161 3300014969 Ga0157376_10071670 Ga0157376_100716702 139
162 3300021361 Ga0213872_10000450 Ga0213872_1000045030 139
163 3300025941 Ga0207711_10124141 Ga0207711_101241413 139
164 3300039447 Ga0436361_0491286 Ga0436361_0491286_169_711 139
165 3300039447 Ga0436361_0719937 Ga0436361_0719937_30442_30984 139
166 3300046539 Ga0495621_0145852 Ga0495621_0145852_16_552 139
167 3300005458 Ga0070681_10008227 Ga0070681_1000822711 143
168 3300025912 Ga0207707_10496557 Ga0207707_104965572 143
169 3300025913 Ga0207695_10005275 Ga0207695_1000527516 143
170 3300025917 Ga0207660_10453256 Ga0207660_104532562 143
171 3300005340 Ga0070689_100313243 Ga0070689_1003132432 144
172 3300005364 Ga0070673_100296826 Ga0070673_1002968262 144
173 3300009177 Ga0105248_10491098 Ga0105248_104910981 144
174 3300025936 Ga0207670_10134171 Ga0207670_101341713 144
175 3300025942 Ga0207689_10032102 Ga0207689_100321023 144
176 3300025960 Ga0207651_10028605 Ga0207651_100286056 144
177 3300026095 Ga0207676_10287302 Ga0207676_102873023 144
178 3300035119 Ga0373956_0067439 Ga0373956_0067439_987_1430 144
179 3300035172 Ga0373955_0019125 Ga0373955_0019125_2105_2548 144
180 3300046529 Ga0495652_0224871 Ga0495652_0224871_618_1061 144
181 3300046543 Ga0495645_0007709 Ga0495645_0007709_6744_7187 144
182 3300046678 Ga0495599_0012448 Ga0495599_0012448_896_1339 144
183 3300053077 Ga0495601_0062607 Ga0495601_0062607_1780_2223 144
184 3300029957 Ga0265324_10081870 Ga0265324_100818702 145
185 3300031241 Ga0265325_10071131 Ga0265325_100711312 145
186 3300005842 Ga0068858_100079493 Ga0068858_1000794932 146
187 3300006880 Ga0075429_100782475 Ga0075429_1007824752 146
188 3300026035 Ga0207703_10125364 Ga0207703_101253642 146
189 3300042156 Ga0439446_0014027 Ga0439446_0014027_1744_2184 146
190 3300026075 Ga0207708_10429682 Ga0207708_104296822 147
191 3300045976 Ga0466967_0040046 Ga0466967_0040046_576_1067 147
192 3300005548 Ga0070665_100573526 Ga0070665_1005735262 149
193 3300025228 Ga0209672_103883 Ga0209672_1038832 149
194 3300028379 Ga0268266_10493783 Ga0268266_104937832 149
195 3300046529 Ga0495652_0039978 Ga0495652_0039978_1197_1739 149
196 3300046543 Ga0495645_0026656 Ga0495645_0026656_3301_3843 149
197 3300005344 Ga0070661_100825043 Ga0070661_1008250432 152
198 3300005616 Ga0068852_100146616 Ga0068852_1001466163 152
199 3300009094 Ga0111539_10120597 Ga0111539_101205973 152
200 3300025920 Ga0207649_10507613 Ga0207649_105076132 152
201 3300026075 Ga0207708_10504281 Ga0207708_105042812 152
202 3300026078 Ga0207702_10324450 Ga0207702_103244503 152
203 3300005327 Ga0070658_10007906 Ga0070658_100079065 153
204 3300005327 Ga0070658_10195431 Ga0070658_101954312 153
205 3300005329 Ga0070683_100703409 Ga0070683_1007034091 153
206 3300005344 Ga0070661_100109043 Ga0070661_1001090433 153
207 3300005366 Ga0070659_100174394 Ga0070659_1001743942 153
208 3300005435 Ga0070714_100194398 Ga0070714_1001943982 153
209 3300005435 Ga0070714_101188096 Ga0070714_1011880962 153
210 3300005437 Ga0070710_10335899 Ga0070710_103358992 153
211 3300005530 Ga0070679_100125794 Ga0070679_1001257943 153
212 3300005535 Ga0070684_100653056 Ga0070684_1006530562 153
213 3300005539 Ga0068853_100052010 Ga0068853_1000520103 153
214 3300005563 Ga0068855_100135240 Ga0068855_1001352403 153
215 3300005614 Ga0068856_100238019 Ga0068856_1002380192 153
216 3300005616 Ga0068852_100015162 Ga0068852_1000151623 153
217 3300009093 Ga0105240_10028163 Ga0105240_100281637 153
218 3300009174 Ga0105241_10476101 Ga0105241_104761012 153
219 3300009551 Ga0105238_10034039 Ga0105238_100340397 153
220 3300013102 Ga0157371_10049286 Ga0157371_100492865 153
221 3300013105 Ga0157369_10003243 Ga0157369_1000324315 153
222 3300013307 Ga0157372_10005338 Ga0157372_100053389 153
223 3300013307 Ga0157372_11447966 Ga0157372_114479662 153
224 3300025898 Ga0207692_10118665 Ga0207692_101186653 153
225 3300025909 Ga0207705_10046325 Ga0207705_100463255 153
226 3300025909 Ga0207705_10067349 Ga0207705_100673492 153
227 3300025921 Ga0207652_10022452 Ga0207652_100224525 153
228 3300025924 Ga0207694_10365760 Ga0207694_103657602 153
229 3300025939 Ga0207665_10614793 Ga0207665_106147932 153
230 3300025949 Ga0207667_10361811 Ga0207667_103618112 153
231 3300025949 Ga0207667_11010530 Ga0207667_110105302 153
232 3300026078 Ga0207702_10132464 Ga0207702_101324643 153
233 3300026142 Ga0207698_10004043 Ga0207698_1000404311 153
234 3300027378 Ga0209981_1003994 Ga0209981_10039943 153
235 3300027462 Ga0210000_1017130 Ga0210000_10171302 153
236 3300027471 Ga0209995_1019189 Ga0209995_10191892 153
237 3300031911 Ga0307412_10470713 Ga0307412_104707132 153
238 3300032002 Ga0307416_100140634 Ga0307416_1001406342 153
239 3300032002 Ga0307416_100630096 Ga0307416_1006300962 153
240 3300037418 Ga0395900_0088752 Ga0395900_0088752_2292_2816 153
241 3300037471 Ga0395905_0009395 Ga0395905_0009395_2097_2621 153
242 3300044684 Ga0466966_0044714 Ga0466966_0044714_523_1047 153
243 3300044842 Ga0466957_0009472 Ga0466957_0009472_3267_3791 153
244 3300045051 Ga0451576_0051750 Ga0451576_0051750_2330_2863 153
245 3300045051 Ga0451576_0281404 Ga0451576_0281404_26_559 153
246 3300045836 Ga0466958_0018967 Ga0466958_0018967_3114_3638 153
247 3300006846 Ga0075430_100081967 Ga0075430_1000819672 154
248 3300050509 nmdc:mga0qj67_28305_c1 nmdc:mga0qj67_28305_c1_1689_2153 154
249 3300002076 JGI24749J21850_1022838 JGI24749J21850_10228382 155
250 3300003575 Ga0007409J51694_1044211 Ga0007409J51694_10442112 155
251 3300005290 Ga0065712_10155952 Ga0065712_101559522 155
252 3300005295 Ga0065707_10017104 Ga0065707_100171042 155
253 3300005330 Ga0070690_100003552 Ga0070690_1000035525 155
254 3300005334 Ga0068869_100004021 Ga0068869_1000040215 155
255 3300005335 Ga0070666_10159553 Ga0070666_101595533 155
256 3300005336 Ga0070680_100013530 Ga0070680_1000135302 155
257 3300005337 Ga0070682_100006656 Ga0070682_1000066565 155
258 3300005337 Ga0070682_100285845 Ga0070682_1002858452 155
259 3300005338 Ga0068868_100020871 Ga0068868_1000208715 155
260 3300005340 Ga0070689_100003236 Ga0070689_1000032368 155
261 3300005340 Ga0070689_100006203 Ga0070689_1000062037 155
262 3300005341 Ga0070691_10000625 Ga0070691_1000062511 155
263 3300005343 Ga0070687_100000952 Ga0070687_1000009527 155
264 3300005345 Ga0070692_10000171 Ga0070692_100001717 155
265 3300005355 Ga0070671_100203287 Ga0070671_1002032873 155
266 3300005364 Ga0070673_100449867 Ga0070673_1004498672 155
267 3300005406 Ga0070703_10023868 Ga0070703_100238682 155
268 3300005436 Ga0070713_100334828 Ga0070713_1003348282 155
269 3300005438 Ga0070701_10002853 Ga0070701_100028532 155
270 3300005440 Ga0070705_100001385 Ga0070705_10000138510 155
271 3300005441 Ga0070700_100004484 Ga0070700_1000044847 155
272 3300005444 Ga0070694_100003309 Ga0070694_1000033097 155
273 3300005444 Ga0070694_100142407 Ga0070694_1001424073 155
274 3300005456 Ga0070678_100023449 Ga0070678_1000234495 155
275 3300005458 Ga0070681_10028799 Ga0070681_100287992 155
276 3300005459 Ga0068867_100003994 Ga0068867_1000039945 155
277 3300005466 Ga0070685_11147005 Ga0070685_111470051 155
278 3300005518 Ga0070699_100165208 Ga0070699_1001652081 155
279 3300005535 Ga0070684_100201679 Ga0070684_1002016793 155
280 3300005536 Ga0070697_100055465 Ga0070697_1000554654 155
281 3300005544 Ga0070686_100003129 Ga0070686_1000031297 155
282 3300005545 Ga0070695_100000140 Ga0070695_1000001402 155
283 3300005546 Ga0070696_100000008 Ga0070696_100000008105 155
284 3300005547 Ga0070693_100000154 Ga0070693_10000015410 155
285 3300005549 Ga0070704_100000956 Ga0070704_10000095617 155
286 3300005563 Ga0068855_100015523 Ga0068855_1000155237 155
287 3300005614 Ga0068856_100015177 Ga0068856_1000151776 155
288 3300005615 Ga0070702_100000421 Ga0070702_1000004212 155
289 3300005616 Ga0068852_100129271 Ga0068852_1001292713 155
290 3300005616 Ga0068852_100872632 Ga0068852_1008726322 155
291 3300005617 Ga0068859_100002186 Ga0068859_1000021868 155
292 3300005617 Ga0068859_100225830 Ga0068859_1002258303 155
293 3300005718 Ga0068866_10002041 Ga0068866_100020416 155
294 3300005719 Ga0068861_100006714 Ga0068861_1000067145 155
295 3300005841 Ga0068863_100371933 Ga0068863_1003719332 155
296 3300005842 Ga0068858_100012318 Ga0068858_1000123186 155
297 3300005842 Ga0068858_100216243 Ga0068858_1002162432 155
298 3300005843 Ga0068860_100009594 Ga0068860_1000095948 155
299 3300005844 Ga0068862_100006076 Ga0068862_1000060766 155
300 3300006051 Ga0075364_10123974 Ga0075364_101239743 155
301 3300006163 Ga0070715_10169967 Ga0070715_101699672 155
302 3300006237 Ga0097621_100003516 Ga0097621_1000035166 155
303 3300006237 Ga0097621_100076805 Ga0097621_1000768055 155
304 3300006358 Ga0068871_100000152 Ga0068871_1000001528 155
305 3300006358 Ga0068871_100002447 Ga0068871_10000244712 155
306 3300006844 Ga0075428_100000202 Ga0075428_10000020248 155
307 3300006880 Ga0075429_100000184 Ga0075429_10000018449 155
308 3300006881 Ga0068865_100005212 Ga0068865_1000052125 155
309 3300006931 Ga0097620_100002187 Ga0097620_1000021878 155
310 3300006931 Ga0097620_100225830 Ga0097620_1002258303 155
311 3300009092 Ga0105250_10052364 Ga0105250_100523643 155
312 3300009093 Ga0105240_10405035 Ga0105240_104050352 155
313 3300009094 Ga0111539_10148225 Ga0111539_101482253 155
314 3300009098 Ga0105245_10007290 Ga0105245_100072908 155
315 3300009098 Ga0105245_10247358 Ga0105245_102473582 155
316 3300009147 Ga0114129_10000677 Ga0114129_1000067750 155
317 3300009148 Ga0105243_10007189 Ga0105243_100071895 155
318 3300009148 Ga0105243_10456085 Ga0105243_104560852 155
319 3300009176 Ga0105242_10004711 Ga0105242_100047118 155
320 3300009176 Ga0105242_10024588 Ga0105242_100245885 155
321 3300009177 Ga0105248_10243715 Ga0105248_102437152 155
322 3300009551 Ga0105238_11707038 Ga0105238_117070381 155
323 3300009553 Ga0105249_10005527 Ga0105249_100055279 155
324 3300009553 Ga0105249_10447587 Ga0105249_104475872 155
325 3300010375 Ga0105239_10015553 Ga0105239_100155537 155
326 3300011119 Ga0105246_10115080 Ga0105246_101150802 155
327 3300013102 Ga0157371_10442989 Ga0157371_104429892 155
328 3300013296 Ga0157374_10161061 Ga0157374_101610613 155
329 3300013297 Ga0157378_10007547 Ga0157378_100075478 155
330 3300013297 Ga0157378_10212921 Ga0157378_102129212 155
331 3300013306 Ga0163162_10244771 Ga0163162_102447713 155
332 3300013306 Ga0163162_11298607 Ga0163162_112986071 155
333 3300013306 Ga0163162_12229871 Ga0163162_122298711 155
334 3300013308 Ga0157375_10054474 Ga0157375_100544743 155
335 3300013308 Ga0157375_10247899 Ga0157375_102478993 155
336 3300014326 Ga0157380_10036126 Ga0157380_100361262 155
337 3300014745 Ga0157377_10912833 Ga0157377_109128332 155
338 3300014968 Ga0157379_10151248 Ga0157379_101512483 155
339 3300014969 Ga0157376_10055681 Ga0157376_100556813 155
340 3300014969 Ga0157376_10068833 Ga0157376_100688333 155
341 3300017792 Ga0163161_10303089 Ga0163161_103030892 155
342 3300025899 Ga0207642_10002187 Ga0207642_100021877 155
343 3300025901 Ga0207688_10038449 Ga0207688_100384493 155
344 3300025903 Ga0207680_10280737 Ga0207680_102807371 155
345 3300025917 Ga0207660_10010473 Ga0207660_100104737 155
346 3300025918 Ga0207662_10001772 Ga0207662_100017727 155
347 3300025921 Ga0207652_10003546 Ga0207652_100035468 155
348 3300025927 Ga0207687_10001190 Ga0207687_100011909 155
349 3300025931 Ga0207644_10160437 Ga0207644_101604372 155
350 3300025934 Ga0207686_10000246 Ga0207686_100002465 155
351 3300025934 Ga0207686_10021595 Ga0207686_100215955 155
352 3300025935 Ga0207709_10003128 Ga0207709_100031287 155
353 3300025936 Ga0207670_10000747 Ga0207670_1000074714 155
354 3300025938 Ga0207704_10001629 Ga0207704_100016297 155
355 3300025939 Ga0207665_10151578 Ga0207665_101515782 155
356 3300025942 Ga0207689_10007929 Ga0207689_100079297 155
357 3300025944 Ga0207661_10994294 Ga0207661_109942942 155
358 3300025949 Ga0207667_10010577 Ga0207667_100105777 155
359 3300025961 Ga0207712_10001322 Ga0207712_100013227 155
360 3300025981 Ga0207640_10169618 Ga0207640_101696182 155
361 3300026023 Ga0207677_10008880 Ga0207677_100088803 155
362 3300026035 Ga0207703_10008914 Ga0207703_100089147 155
363 3300026035 Ga0207703_10178639 Ga0207703_101786392 155
364 3300026075 Ga0207708_10000601 Ga0207708_1000060114 155
365 3300026078 Ga0207702_10018247 Ga0207702_100182473 155
366 3300026088 Ga0207641_10325611 Ga0207641_103256112 155
367 3300026089 Ga0207648_10002542 Ga0207648_1000254219 155
368 3300026089 Ga0207648_10045211 Ga0207648_100452112 155
369 3300026118 Ga0207675_100009511 Ga0207675_1000095116 155
370 3300026121 Ga0207683_10075461 Ga0207683_100754613 155
371 3300026142 Ga0207698_10134858 Ga0207698_101348583 155
372 3300026142 Ga0207698_11017042 Ga0207698_110170422 155
373 3300027462 Ga0210000_1002145 Ga0210000_10021453 155
374 3300027471 Ga0209995_1004686 Ga0209995_10046861 155
375 3300027543 Ga0209999_1002565 Ga0209999_10025653 155
376 3300027665 Ga0209983_1009598 Ga0209983_10095982 155
377 3300027907 Ga0207428_10000453 Ga0207428_1000045325 155
378 3300028380 Ga0268265_10005081 Ga0268265_100050817 155
379 3300028381 Ga0268264_10009530 Ga0268264_100095307 155
380 3300031235 Ga0265330_10002138 Ga0265330_100021387 155
381 3300031239 Ga0265328_10029043 Ga0265328_100290433 155
382 3300031711 Ga0265314_10049358 Ga0265314_100493583 155
383 3300031730 Ga0307516_10093997 Ga0307516_100939974 155
384 3300032002 Ga0307416_100183455 Ga0307416_1001834552 155
385 3300034820 Ga0373959_0039574 Ga0373959_0039574_436_903 155
386 3300035083 Ga0373926_0003541 Ga0373926_0003541_1016_1483 155
387 3300035086 Ga0373934_0000098 Ga0373934_0000098_3499_4029 155
388 3300035086 Ga0373934_0047525 Ga0373934_0047525_1057_1572 155
389 3300035092 Ga0373952_0015480 Ga0373952_0015480_956_1423 155
390 3300035113 Ga0373936_0047270 Ga0373936_0047270_1054_1569 155
391 3300035116 Ga0373945_0011568 Ga0373945_0011568_1411_1878 155
392 3300035118 Ga0373954_0000709 Ga0373954_0000709_8102_8632 155
393 3300035119 Ga0373956_0005111 Ga0373956_0005111_4160_4690 155
394 3300035119 Ga0373956_0224835 Ga0373956_0224835_260_838 155
395 3300035121 Ga0373960_0093586 Ga0373960_0093586_147_614 155
396 3300035121 Ga0373960_0169498 Ga0373960_0169498_74_541 155
397 3300035170 Ga0373943_0140030 Ga0373943_0140030_436_903 155
398 3300035172 Ga0373955_0072781 Ga0373955_0072781_724_1191 155
399 3300035172 Ga0373955_0087106 Ga0373955_0087106_1089_1619 155
400 3300035241 Ga0373961_0088547 Ga0373961_0088547_189_656 155
401 3300035692 Ga0373935_0030000 Ga0373935_0030000_2163_2678 155
402 3300035692 Ga0373935_0307678 Ga0373935_0307678_380_847 155
403 3300035695 Ga0373927_0017581 Ga0373927_0017581_1026_1541 155
404 3300035695 Ga0373927_0061869 Ga0373927_0061869_1555_2022 155
405 3300035724 Ga0373933_0003854 Ga0373933_0003854_3712_4242 155
406 3300035725 Ga0373947_0006166 Ga0373947_0006166_1405_1872 155
407 3300035725 Ga0373947_0376162 Ga0373947_0376162_255_722 155
408 3300036401 Ga0373937_0001120 Ga0373937_0001120_4145_4675 155
409 3300036401 Ga0373937_0157724 Ga0373937_0157724_958_1488 155
410 3300036401 Ga0373937_1813262 Ga0373937_1813262_30_512 155
411 3300037068 Ga0373925_0010477 Ga0373925_0010477_2965_3480 155
412 3300037068 Ga0373925_0127049 Ga0373925_0127049_1042_1509 155
413 3300041458 Ga0451798_0352418 Ga0451798_0352418_281_748 155
414 3300042435 Ga0439434_0013853 Ga0439434_0013853_1282_1764 155
415 3300042436 Ga0439435_0001341 Ga0439435_0001341_3264_3746 155
416 3300042876 Ga0451577_0013667 Ga0451577_0013667_4332_4799 155
417 3300045051 Ga0451576_0004947 Ga0451576_0004947_4653_5120 155
418 3300046455 Ga0495603_0004972 Ga0495603_0004972_4941_5408 155
419 3300046462 Ga0495651_0000147 Ga0495651_0000147_4000_4530 155
420 3300046472 Ga0495580_0001671 Ga0495580_0001671_9513_9980 155
421 3300046475 Ga0495639_0054958 Ga0495639_0054958_746_1213 155
422 3300046499 Ga0495594_0139548 Ga0495594_0139548_856_1323 155
423 3300046511 Ga0495608_0412624 Ga0495608_0412624_12_542 155
424 3300046517 Ga0495630_1006285 Ga0495630_1006285_57_524 155
425 3300046531 Ga0495665_0066158 Ga0495665_0066158_616_1083 155
426 3300046535 Ga0495586_0006582 Ga0495586_0006582_1601_2068 155
427 3300046535 Ga0495586_0014427 Ga0495586_0014427_1124_1654 155
428 3300046675 Ga0495657_0433723 Ga0495657_0433723_223_753 155
429 3300046675 Ga0495657_0599917 Ga0495657_0599917_62_595 155
430 3300046678 Ga0495599_0068772 Ga0495599_0068772_1032_1562 155
431 3300046681 Ga0495647_0000269 Ga0495647_0000269_10304_10771 155
432 3300046683 Ga0495658_0023465 Ga0495658_0023465_1104_1571 155
433 3300046690 Ga0495624_0213894 Ga0495624_0213894_351_818 155
434 3300047315 Ga0495581_0045762 Ga0495581_0045762_153_620 155
435 3300047321 Ga0495676_0116104 Ga0495676_0116104_506_973 155
436 3300047322 Ga0495680_0332614 Ga0495680_0332614_12_500 155
437 3300047471 Ga0495684_0079010 Ga0495684_0079010_413_943 155
438 3300048089 Ga0495614_0317370 Ga0495614_0317370_233_700 155
439 3300048903 Ga0496100_0029823 Ga0496100_0029823_1926_2468 155
440 3300048909 Ga0496106_0337948 Ga0496106_0337948_286_753 155
441 3300048917 Ga0496114_0635712 Ga0496114_0635712_53_595 155
442 3300048918 Ga0496115_0645845 Ga0496115_0645845_50_520 155
443 3300048924 Ga0496121_0024269 Ga0496121_0024269_283_825 155
444 3300048928 Ga0496125_0003359 Ga0496125_0003359_9580_10122 155
445 3300048929 Ga0496126_0110018 Ga0496126_0110018_1679_2221 155
446 3300049569 Ga0501032_0061982 Ga0501032_0061982_1930_2490 155
447 3300049572 Ga0501036_0179286 Ga0501036_0179286_502_1047 155
448 3300049579 Ga0501043_0098682 Ga0501043_0098682_114_683 155
449 3300049581 Ga0501047_0549235 Ga0501047_0549235_322_855 155
450 3300050507 nmdc:mga05p37_244_c1 nmdc:mga05p37_244_c1_23261_23728 155
451 3300050508 nmdc:mga09592_110_c1 nmdc:mga09592_110_c1_18609_19076 155
452 3300050509 nmdc:mga0qj67_786651_c1 nmdc:mga0qj67_786651_c1_216_683 155
453 3300050511 nmdc:mga08y16_2203_c1 nmdc:mga08y16_2203_c1_1124_1591 155
454 3300053156 Ga0500622_0151116 Ga0500622_0151116_278_820 155
455 3300053157 Ga0500624_007448 Ga0500624_007448_418_960 155
456 3300059421 Ga0590071_023845 Ga0590071_023845_489_956 155
457 3300059426 Ga0590077_052002 Ga0590077_052002_46_513 155
458 iso_pu_bacteria 2511231003 2511251623 155
459 iso_pu_bacteria 2511231026 2511386588 155
460 iso_pu_bacteria 2521172590 2521561146 155
461 iso_pu_bacteria 2548876994 2550694752 155
462 iso_pu_bacteria 2551306416 2553005975 155
463 iso_pu_bacteria 2765235838 2765567577 155
464 iso_pu_bacteria 2818991436 2819543501 155
465 iso_pu_bacteria 2818991445 2819593855 155
466 iso_pu_bacteria 2818991449 2819617526 155
467 iso_pu_bacteria 2839094727 2839099522 155
468 iso_pu_bacteria 2904439833 2904442220 155
469 iso_pu_bacteria 2904530477 2904533502 155
470 iso_pu_bacteria 2904584206 2904586457 155
471 iso_pu_bacteria 2904589729 2904591730 155
472 iso_pu_bacteria 2904601388 2904602116 155
473 iso_pu_bacteria 2919046199 2919051222 155
474 iso_pu_bacteria 2919079590 2919083544 155
475 iso_pu_bacteria 2923510766 2923514985 155
476 iso_pu_bacteria 2928130867 2928133526 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

21

161

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lw3-assembly1.cif.gz_B crystal structure of ruvc from pseudomonas aeruginosa 0.9427 2 135
1hjr-assembly2.cif.gz_D atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli 0.929 2 138
4neq-assembly1.cif.gz_A-2 the structure of udp-glcnac 2-epimerase from methanocaldococcus jannaschii 0.9064 19 84
7xhj-assembly1.cif.gz_A crystal structure of ruvc from deinococcus radiodurans 0.9037 2 136
8ahf-assembly1.cif.gz_B-2 pac-fragmentdel: photoactivated covalent capture of dna encoded fragments for hit discovery 0.8893 22 84
ID Description Score Start End Superfamily
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9392 2 141 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9365 2 138 3.30.420.10
4ld0B00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8662 4 141 3.30.420.10
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8466 2 141 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8267 2 138 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2V7Y973-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9639 2 140 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A4Q6DE37-F1-model_v4 deleted 0.963 2 139
AF-A0A7V5AKS9-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9622 2 135 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A381PI40-F1-model_v4 Uncharacterized protein 0.962 1 142 GO:0003677
GO:0006281
GO:0006310
GO:0008821
GO:0046872
AF-A0A840BMR7-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9613 2 137 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476

Feature Viewer

pLDDT pTM Quality
87.25 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map