F451493

General Info

Members Datasets Scaffolds Average Seq Length
476 270 952 126

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100198922|Ga0070711_1001989221
Length 142
Sequence MGPIEEKGLKRYCEGKMGVVEAKIQTVEDIYGLVWAAVANKQPIRAMYKDLPRLFCPHRLGRNQAGQRRVLCYQYGGESASGLAPIGSPANWRCIVLERLRAVELLEGSWKTAPNHSRPATCVVEADIDAEDQPERDPQKGQ

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
238 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
241 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
242 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
243 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
244 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
245 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
247 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
248 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
253 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
254 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
255 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
256 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
257 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 97.27
Stem 0
Stem Tuber 0
Unclassified 39.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100198922 3300005439 Bacteria 1545
2 Ga0065715_10493773 3300005293 Bacteria 786
3 Ga0070658_10352279 3300005327 Unclassified 1260
4 Ga0070658_11329302 3300005327 Unclassified 624
5 Ga0070676_10063947 3300005328 Bacteria 2193
6 Ga0070670_100244056 3300005331 Bacteria 1564
7 Ga0070677_10042012 3300005333 Bacteria 1808
8 Ga0068869_100060247 3300005334 Unclassified 2781
9 Ga0070680_100551286 3300005336 Bacteria 988
10 Ga0070682_100355416 3300005337 Unclassified 1094
11 Ga0068868_100166205 3300005338 Bacteria 1825
12 Ga0070660_100331320 3300005339 Unclassified 1252
13 Ga0070661_100166531 3300005344 Unclassified 1672
14 Ga0070669_100699071 3300005353 Unclassified 856
15 Ga0070675_100729089 3300005354 Bacteria 904
16 Ga0070671_100118060 3300005355 Bacteria 2231
17 Ga0070674_100132543 3300005356 Bacteria 1860
18 Ga0070674_100548128 3300005356 Unclassified 970
19 Ga0070674_101600494 3300005356 Unclassified 587
20 Ga0070673_100756634 3300005364 Unclassified 895
21 Ga0070659_100105345 3300005366 Bacteria 2272
22 Ga0070667_100118323 3300005367 Bacteria 2303
23 Ga0070709_10077669 3300005434 Bacteria 2159
24 Ga0070709_11013060 3300005434 Unclassified 661
25 Ga0070709_11411910 3300005434 Unclassified 564
26 Ga0070714_100440212 3300005435 Bacteria 1237
27 Ga0070713_100130224 3300005436 Bacteria 2218
28 Ga0070711_100074666 3300005439 Bacteria 2398
29 Ga0070711_100601946 3300005439 Unclassified 917
30 Ga0070711_101172485 3300005439 Bacteria 664
31 Ga0070700_100055005 3300005441 Bacteria 2489
32 Ga0070700_101190201 3300005441 Unclassified 636
33 Ga0070708_100149174 3300005445 Unclassified 2174
34 Ga0070708_100167404 3300005445 Bacteria 2050
35 Ga0070708_101078035 3300005445 Unclassified 753
36 Ga0070663_100192176 3300005455 Unclassified 1589
37 Ga0070678_100856155 3300005456 Unclassified 829
38 Ga0070678_100870076 3300005456 Bacteria 822
39 Ga0070681_10194632 3300005458 Bacteria 1947
40 Ga0068867_100096962 3300005459 Bacteria 2246
41 Ga0068867_101441894 3300005459 Unclassified 639
42 Ga0070707_100167594 3300005468 Bacteria 2141
43 Ga0070707_100356606 3300005468 Bacteria 1420
44 Ga0070707_101313373 3300005468 Unclassified 690
45 Ga0070698_100171255 3300005471 Bacteria 2112
46 Ga0070698_101256818 3300005471 Unclassified 690
47 Ga0070699_100151336 3300005518 Bacteria 2052
48 Ga0070699_101453268 3300005518 Unclassified 629
49 Ga0070684_100146830 3300005535 Bacteria 2135
50 Ga0070697_100289141 3300005536 Bacteria 1407
51 Ga0070697_102033664 3300005536 Bacteria 514
52 Ga0068853_101079019 3300005539 Unclassified 774
53 Ga0070672_100114250 3300005543 Bacteria 2204
54 Ga0070672_100130558 3300005543 Bacteria 2064
55 Ga0070696_101918307 3300005546 Unclassified 513
56 Ga0070693_100254969 3300005547 Bacteria 1164
57 Ga0070693_100897812 3300005547 Unclassified 664
58 Ga0070665_100067089 3300005548 Bacteria 3598
59 Ga0070665_100186413 3300005548 Bacteria 2076
60 Ga0070665_100324770 3300005548 Unclassified 1543
61 Ga0070665_101027039 3300005548 Bacteria 836
62 Ga0070665_101254105 3300005548 Bacteria 752
63 Ga0068854_100654985 3300005578 Bacteria 902
64 Ga0068856_100332131 3300005614 Bacteria 1538
65 Ga0070702_100945993 3300005615 Unclassified 678
66 Ga0068859_100116708 3300005617 Bacteria 2734
67 Ga0068859_100452920 3300005617 Unclassified 1379
68 Ga0068859_101924966 3300005617 Unclassified 653
69 Ga0068864_100181637 3300005618 Bacteria 1924
70 Ga0068864_101126465 3300005618 Bacteria 782
71 Ga0068870_10066123 3300005840 Bacteria 1958
72 Ga0068863_101915381 3300005841 Unclassified 603
73 Ga0068863_101934884 3300005841 Unclassified 600
74 Ga0068863_102512516 3300005841 Unclassified 524
75 Ga0068858_101309843 3300005842 Unclassified 713
76 Ga0068860_101993687 3300005843 Unclassified 602
77 Ga0081455_10115994 3300005937 Bacteria 2119
78 Ga0081455_10364305 3300005937 Unclassified 1015
79 Ga0081540_1042441 3300005983 Bacteria 2346
80 Ga0070717_10146956 3300006028 Bacteria 2037
81 Ga0070717_10156633 3300006028 Bacteria 1974
82 Ga0070717_10182908 3300006028 Bacteria 1828
83 Ga0070717_10580150 3300006028 Unclassified 1017
84 Ga0070717_11976120 3300006028 Unclassified 526
85 Ga0070716_100821520 3300006173 Unclassified 721
86 Ga0070716_101162263 3300006173 Unclassified 618
87 Ga0070712_100106928 3300006175 Bacteria 2080
88 Ga0070712_100216368 3300006175 Bacteria 1514
89 Ga0070712_101401155 3300006175 Unclassified 610
90 Ga0097621_100094242 3300006237 Bacteria 2510
91 Ga0097621_100116855 3300006237 Bacteria 2259
92 Ga0097621_100927656 3300006237 Unclassified 812
93 Ga0097621_101085727 3300006237 Bacteria 751
94 Ga0068871_100322006 3300006358 Bacteria 1362
95 Ga0068871_100412994 3300006358 Unclassified 1204
96 Ga0068871_100503760 3300006358 Bacteria 1092
97 Ga0068871_100562730 3300006358 Unclassified 1034
98 Ga0068871_101039256 3300006358 Unclassified 764
99 Ga0068871_101615669 3300006358 Unclassified 614
100 Ga0075428_100354858 3300006844 Unclassified 1573
101 Ga0075433_11222813 3300006852 Bacteria 652
102 Ga0075434_100207596 3300006871 Bacteria 1980
103 Ga0075434_101089389 3300006871 Unclassified 812
104 Ga0075434_101519927 3300006871 Unclassified 678
105 Ga0068865_101681995 3300006881 Unclassified 572
106 Ga0097620_100116709 3300006931 Bacteria 2734
107 Ga0097620_100452904 3300006931 Unclassified 1379
108 Ga0097620_101925063 3300006931 Unclassified 653
109 Ga0105240_10439159 3300009093 Bacteria 1463
110 Ga0105240_10622301 3300009093 Unclassified 1186
111 Ga0105240_11675650 3300009093 Unclassified 664
112 Ga0111539_10170167 3300009094 Bacteria 2546
113 Ga0111539_10194257 3300009094 Bacteria 2367
114 Ga0111539_10222150 3300009094 Unclassified 2200
115 Ga0111539_10432557 3300009094 Bacteria 1532
116 Ga0111539_12382282 3300009094 Unclassified 614
117 Ga0105245_10219729 3300009098 Bacteria 1833
118 Ga0105245_11664265 3300009098 Bacteria 690
119 Ga0105245_12798144 3300009098 Unclassified 540
120 Ga0105247_10271574 3300009101 Bacteria 1166
121 Ga0114129_12906154 3300009147 Unclassified 566
122 Ga0105243_10137804 3300009148 Bacteria 2078
123 Ga0105243_13109885 3300009148 Unclassified 502
124 Ga0105241_10150521 3300009174 Bacteria 1903
125 Ga0105241_11404651 3300009174 Bacteria 668
126 Ga0105242_10233140 3300009176 Bacteria 1651
127 Ga0105242_10331996 3300009176 Bacteria 1398
128 Ga0105242_12418281 3300009176 Unclassified 573
129 Ga0105248_10054513 3300009177 Bacteria 4484
130 Ga0105248_10231645 3300009177 Bacteria 2079
131 Ga0105248_12687846 3300009177 Unclassified 568
132 Ga0105237_10048870 3300009545 Unclassified 4253
133 Ga0105237_10920041 3300009545 Bacteria 881
134 Ga0105237_11140495 3300009545 Unclassified 786
135 Ga0105237_11638539 3300009545 Unclassified 650
136 Ga0105238_10296773 3300009551 Unclassified 1599
137 Ga0105238_10489897 3300009551 Bacteria 1229
138 Ga0105238_11442256 3300009551 Unclassified 716
139 Ga0105238_12077751 3300009551 Unclassified 602
140 Ga0105249_11085073 3300009553 Bacteria 870
141 Ga0105249_12387135 3300009553 Unclassified 601
142 Ga0105239_10238377 3300010375 Unclassified 2042
143 Ga0105239_10297932 3300010375 Bacteria 1816
144 Ga0105239_10832350 3300010375 Unclassified 1058
145 Ga0105239_10869338 3300010375 Bacteria 1034
146 Ga0105239_12660852 3300010375 Unclassified 584
147 Ga0105239_12782118 3300010375 Unclassified 571
148 Ga0105246_10055486 3300011119 Bacteria 2734
149 Ga0105246_10313147 3300011119 Unclassified 1272
150 Ga0157373_10073972 3300013100 Bacteria 2404
151 Ga0157373_10088143 3300013100 Unclassified 2186
152 Ga0157373_10915887 3300013100 Unclassified 651
153 Ga0157371_10120865 3300013102 Bacteria 1862
154 Ga0157370_12004024 3300013104 Unclassified 519
155 Ga0157374_10180250 3300013296 Bacteria 2063
156 Ga0157378_10109831 3300013297 Bacteria 2527
157 Ga0157378_10357721 3300013297 Bacteria 1428
158 Ga0157378_11194322 3300013297 Unclassified 800
159 Ga0163162_10348322 3300013306 Bacteria 1614
160 Ga0163162_10415218 3300013306 Unclassified 1478
161 Ga0163162_10705971 3300013306 Bacteria 1130
162 Ga0163162_11217456 3300013306 Unclassified 855
163 Ga0163162_11869562 3300013306 Unclassified 687
164 Ga0157372_10181671 3300013307 Bacteria 2435
165 Ga0157372_10263441 3300013307 Bacteria 2002
166 Ga0157372_12751723 3300013307 Bacteria 564
167 Ga0157375_10114158 3300013308 Bacteria 2803
168 Ga0157375_10164727 3300013308 Bacteria 2361
169 Ga0163163_11117985 3300014325 Unclassified 851
170 Ga0163163_13067274 3300014325 Unclassified 521
171 Ga0163163_13337996 3300014325 Unclassified 500
172 Ga0157380_11377842 3300014326 Bacteria 755
173 Ga0157377_10093327 3300014745 Bacteria 1781
174 Ga0157379_10873053 3300014968 Bacteria 852
175 Ga0157379_11836635 3300014968 Unclassified 596
176 Ga0157376_10120491 3300014969 Bacteria 2324
177 Ga0157376_10127927 3300014969 Bacteria 2262
178 Ga0157376_10849182 3300014969 Unclassified 928
179 Ga0182005_1121268 3300015265 Unclassified 744
180 Ga0163161_10110482 3300017792 Bacteria 2055
181 Ga0213873_10086780 3300021358 Bacteria 883
182 Ga0213875_10050500 3300021388 Bacteria 1948
183 Ga0213875_10095594 3300021388 Bacteria 1385
184 Ga0213871_10049661 3300021441 Bacteria 1146
185 Ga0207682_10037334 3300025893 Bacteria 1968
186 Ga0207692_10206552 3300025898 Bacteria 1157
187 Ga0207680_10027198 3300025903 Bacteria 3181
188 Ga0207699_10076976 3300025906 Bacteria 2057
189 Ga0207699_10080795 3300025906 Bacteria 2015
190 Ga0207699_10909004 3300025906 Bacteria 649
191 Ga0207645_10056381 3300025907 Bacteria 2508
192 Ga0207645_10099530 3300025907 Bacteria 1875
193 Ga0207705_10344682 3300025909 Unclassified 1147
194 Ga0207705_11098397 3300025909 Unclassified 613
195 Ga0207654_10276021 3300025911 Unclassified 1135
196 Ga0207654_10958259 3300025911 Unclassified 621
197 Ga0207707_10196834 3300025912 Bacteria 1758
198 Ga0207695_10058030 3300025913 Unclassified 4019
199 Ga0207695_10077403 3300025913 Plasmid 3378
200 Ga0207695_11756669 3300025913 Unclassified 501
201 Ga0207671_11271135 3300025914 Unclassified 574
202 Ga0207693_10024052 3300025915 Bacteria 4836
203 Ga0207663_10090895 3300025916 Bacteria 2025
204 Ga0207663_10179486 3300025916 Bacteria 1511
205 Ga0207663_10802162 3300025916 Unclassified 750
206 Ga0207657_10120876 3300025919 Bacteria 2155
207 Ga0207649_10060360 3300025920 Unclassified 2383
208 Ga0207652_10491854 3300025921 Bacteria 1105
209 Ga0207646_10583898 3300025922 Unclassified 1004
210 Ga0207646_10874497 3300025922 Bacteria 798
211 Ga0207681_10577602 3300025923 Unclassified 927
212 Ga0207694_10601032 3300025924 Unclassified 925
213 Ga0207650_10232192 3300025925 Bacteria 1488
214 Ga0207659_10571246 3300025926 Bacteria 962
215 Ga0207659_10593277 3300025926 Unclassified 944
216 Ga0207687_10214706 3300025927 Bacteria 1511
217 Ga0207687_10513305 3300025927 Bacteria 1002
218 Ga0207700_10150742 3300025928 Bacteria 1921
219 Ga0207664_10422254 3300025929 Bacteria 1188
220 Ga0207706_10514584 3300025933 Unclassified 1032
221 Ga0207686_10846905 3300025934 Unclassified 735
222 Ga0207670_10094425 3300025936 Bacteria 2122
223 Ga0207691_10051046 3300025940 Bacteria 3783
224 Ga0207691_10087506 3300025940 Bacteria 2795
225 Ga0207711_10154139 3300025941 Bacteria 2075
226 Ga0207711_10169141 3300025941 Bacteria 1982
227 Ga0207711_10180497 3300025941 Unclassified 1919
228 Ga0207711_11515625 3300025941 Unclassified 614
229 Ga0207689_10087616 3300025942 Unclassified 2557
230 Ga0207689_10130000 3300025942 Bacteria 2072
231 Ga0207689_10595706 3300025942 Bacteria 930
232 Ga0207661_11312662 3300025944 Unclassified 665
233 Ga0207661_11652316 3300025944 Unclassified 586
234 Ga0207679_10706574 3300025945 Unclassified 915
235 Ga0207712_10775909 3300025961 Bacteria 841
236 Ga0207712_11406754 3300025961 Unclassified 624
237 Ga0207677_10172541 3300026023 Bacteria 1692
238 Ga0207677_11812127 3300026023 Unclassified 567
239 Ga0207708_10031937 3300026075 Bacteria 3998
240 Ga0207702_11346381 3300026078 Unclassified 708
241 Ga0207641_11430210 3300026088 Unclassified 693
242 Ga0207648_10863355 3300026089 Unclassified 844
243 Ga0207648_10955907 3300026089 Unclassified 801
244 Ga0207676_10164121 3300026095 Bacteria 1928
245 Ga0207675_100168601 3300026118 Bacteria 2092
246 Ga0207683_10060975 3300026121 Bacteria 3318
247 Ga0207683_10695111 3300026121 Bacteria 943
248 Ga0207698_11810368 3300026142 Bacteria 626
249 Ga0207428_10045494 3300027907 Bacteria 3535
250 Ga0207428_10117707 3300027907 Unclassified 2039
251 Ga0207428_10127544 3300027907 Bacteria 1948
252 Ga0268266_10524745 3300028379 Unclassified 1132
253 Ga0268264_12359407 3300028381 Unclassified 538
254 Ga0265338_10086077 3300028800 Bacteria 2617
255 Ga0265760_10016324 3300031090 Bacteria 2130
256 Ga0265760_10027426 3300031090 Bacteria 1669
257 Ga0265332_10032158 3300031238 Bacteria 2286
258 Ga0265332_10060452 3300031238 Bacteria 1621
259 Ga0265331_10008944 3300031250 Bacteria 5660
260 Ga0265316_10035414 3300031344 Bacteria 4046
261 Ga0265342_10567576 3300031712 Unclassified 574
262 Ga0307405_11060438 3300031731 Unclassified 694
263 Ga0307410_11525409 3300031852 Unclassified 589
264 Ga0307406_10498803 3300031901 Bacteria 987
265 Ga0307412_10119737 3300031911 Bacteria 1893
266 Ga0307416_100204870 3300032002 Bacteria 1875
267 Ga0307414_10128238 3300032004 Bacteria 1964
268 Ga0307411_10048471 3300032005 Bacteria 2753
269 Ga0373926_0029469 3300035083 Bacteria 1929
270 Ga0373926_0035291 3300035083 Bacteria 1773
271 Ga0373934_0026719 3300035086 Unclassified 2239
272 Ga0373934_0033973 3300035086 Bacteria 2003
273 Ga0373923_0031243 3300035111 Unclassified 2145
274 Ga0373936_0050060 3300035113 Bacteria 1689
275 Ga0373936_0065138 3300035113 Bacteria 1494
276 Ga0373953_0030624 3300035117 Bacteria 2087
277 Ga0373954_0036336 3300035118 Bacteria 2286
278 Ga0373954_0193014 3300035118 Bacteria 1000
279 Ga0373956_0043673 3300035119 Bacteria 1996
280 Ga0373956_0240923 3300035119 Unclassified 859
281 Ga0373957_0022750 3300035120 Bacteria 2235
282 Ga0373957_0027200 3300035120 Bacteria 2076
283 Ga0373955_0068510 3300035172 Bacteria 1977
284 Ga0373955_0103369 3300035172 Bacteria 1638
285 Ga0373942_0372936 3300035207 Bacteria 508
286 Ga0373961_0272277 3300035241 Bacteria 619
287 Ga0373924_0030934 3300035410 Bacteria 2148
288 Ga0373924_0145530 3300035410 Bacteria 1035
289 Ga0373931_0149812 3300035691 Unclassified 1359
290 Ga0373931_0199258 3300035691 Bacteria 1195
291 Ga0373931_0324779 3300035691 Unclassified 957
292 Ga0373935_0091591 3300035692 Bacteria 1991
293 Ga0373927_0083949 3300035695 Bacteria 2065
294 Ga0373927_0264384 3300035695 Bacteria 1131
295 Ga0373933_0088162 3300035724 Bacteria 1911
296 Ga0373933_0107298 3300035724 Bacteria 1738
297 Ga0373947_0129199 3300035725 Bacteria 1611
298 Ga0373947_0148522 3300035725 Bacteria 1508
299 Ga0373937_0177539 3300036401 Bacteria 1999
300 Ga0373937_0312004 3300036401 Bacteria 1488
301 Ga0373937_0330570 3300036401 Bacteria 1442
302 Ga0373937_0586621 3300036401 Bacteria 1058
303 Ga0373937_0652694 3300036401 Bacteria 998
304 Ga0373925_0069811 3300037068 Bacteria 2654
305 Ga0373925_1152789 3300037068 Unclassified 637
306 Ga0395899_0084237 3300037312 Unclassified 2311
307 Ga0395900_0071225 3300037418 Bacteria 3573
308 Ga0395898_0062703 3300037466 Bacteria 3610
309 Ga0436364_0031556 3300037853 Bacteria 2630
310 Ga0436364_0395952 3300037853 Bacteria 1445
311 Ga0436364_0989768 3300037853 Unclassified 1090
312 Ga0436364_1121355 3300037853 Bacteria 2525
313 Ga0395901_0087728 3300038443 Plasmid 3253
314 Ga0436360_0437231 3300039438 Bacteria 2083
315 Ga0436361_0101507 3300039447 Bacteria 1225
316 Ga0436362_0098068 3300039453 Bacteria 2889
317 Ga0439439_0126009 3300041406 Unclassified 717
318 Ga0451839_1253083 3300041496 Unclassified 780
319 Ga0451853_0236040 3300041512 Unclassified 817
320 Ga0439433_0185493 3300041999 Unclassified 546
321 Ga0439450_007377 3300042008 Bacteria 2012
322 Ga0439435_0025354 3300042436 Bacteria 1572
323 Ga0439444_0013453 3300042437 Unclassified 1355
324 Ga0439464_0097385 3300042439 Unclassified 891
325 Ga0439460_0125532 3300042461 Unclassified 842
326 Ga0453684_1468075 3300044712 Unclassified 705
327 Ga0451576_0100857 3300045051 Bacteria 3002
328 Ga0495592_0098196 3300046454 Bacteria 2090
329 Ga0495603_0059473 3300046455 Bacteria 2259
330 Ga0495629_0114826 3300046459 Bacteria 1876
331 Ga0495629_0115363 3300046459 Bacteria 1872
332 Ga0495651_0035355 3300046462 Plasmid 3890
333 Ga0495651_0082628 3300046462 Unclassified 2423
334 Ga0495651_0158335 3300046462 Unclassified 1625
335 Ga0495651_0251561 3300046462 Bacteria 1206
336 Ga0495653_0050004 3300046463 Bacteria 3216
337 Ga0495653_0109441 3300046463 Bacteria 1988
338 Ga0495580_0092933 3300046472 Bacteria 2099
339 Ga0495580_0926650 3300046472 Bacteria 559
340 Ga0495582_0054260 3300046473 Bacteria 2210
341 Ga0495582_0189675 3300046473 Bacteria 1172
342 Ga0495639_0014440 3300046475 Bacteria 3419
343 Ga0495639_0153010 3300046475 Bacteria 1113
344 Ga0495662_0040816 3300046476 Bacteria 2241
345 Ga0495664_0022555 3300046477 Unclassified 3650
346 Ga0495664_0066215 3300046477 Bacteria 2154
347 Ga0495594_0031732 3300046499 Bacteria 2865
348 Ga0495608_0011316 3300046511 Bacteria 6212
349 Ga0495608_0117047 3300046511 Unclassified 1710
350 Ga0495608_0461042 3300046511 Bacteria 772
351 Ga0495618_0111107 3300046514 Bacteria 1755
352 Ga0495618_0112074 3300046514 Bacteria 1747
353 Ga0495628_0046495 3300046516 Unclassified 3446
354 Ga0495628_0099594 3300046516 Bacteria 2244
355 Ga0495628_0984392 3300046516 Unclassified 581
356 Ga0495630_0039501 3300046517 Unclassified 3528
357 Ga0495630_0115159 3300046517 Bacteria 2037
358 Ga0495630_0382343 3300046517 Bacteria 1078
359 Ga0495630_0826709 3300046517 Unclassified 707
360 Ga0495666_0046091 3300046526 Bacteria 2102
361 Ga0495666_0476717 3300046526 Bacteria 558
362 Ga0495642_0321743 3300046528 Unclassified 679
363 Ga0495652_0046896 3300046529 Unclassified 3708
364 Ga0495652_0060763 3300046529 Unclassified 3192
365 Ga0495652_0066328 3300046529 Unclassified 3030
366 Ga0495665_0065526 3300046531 Bacteria 1917
367 Ga0495665_0067306 3300046531 Bacteria 1889
368 Ga0495640_0042422 3300046533 Bacteria 3175
369 Ga0495640_0221448 3300046533 Bacteria 1193
370 Ga0495640_0486329 3300046533 Unclassified 752
371 Ga0495586_0058598 3300046535 Unclassified 2091
372 Ga0495586_0063825 3300046535 Bacteria 2006
373 Ga0495587_0047278 3300046536 Bacteria 2552
374 Ga0495587_0048560 3300046536 Bacteria 2513
375 Ga0495587_0074015 3300046536 Bacteria 1978
376 Ga0495621_0263476 3300046539 Unclassified 707
377 Ga0495645_0005826 3300046543 Bacteria 8502
378 Ga0495645_0083621 3300046543 Bacteria 2287
379 Ga0495645_0170747 3300046543 Bacteria 1497
380 Ga0495622_0044516 3300046557 Bacteria 2062
381 Ga0495667_0028528 3300046559 Bacteria 3758
382 Ga0495667_0060980 3300046559 Bacteria 2473
383 Ga0495667_0133758 3300046559 Bacteria 1599
384 Ga0495667_0245787 3300046559 Unclassified 1139
385 Ga0495667_0777725 3300046559 Unclassified 591
386 Ga0495634_0072733 3300046642 Bacteria 2261
387 Ga0495634_0075106 3300046642 Bacteria 2220
388 Ga0495634_0089805 3300046642 Bacteria 1997
389 Ga0495635_0072485 3300046663 Bacteria 2359
390 Ga0495635_0288638 3300046663 Unclassified 1101
391 Ga0495659_0298864 3300046664 Unclassified 680
392 Ga0495657_0073409 3300046675 Bacteria 2228
393 Ga0495657_0182310 3300046675 Unclassified 1288
394 Ga0495599_0022640 3300046678 Plasmid 3923
395 Ga0495599_0059488 3300046678 Unclassified 2390
396 Ga0495623_0010072 3300046679 Bacteria 6120
397 Ga0495623_0027263 3300046679 Unclassified 3674
398 Ga0495623_0068326 3300046679 Bacteria 2216
399 Ga0495647_0485354 3300046681 Unclassified 574
400 Ga0495658_0074144 3300046683 Bacteria 1982
401 Ga0495669_0099241 3300046684 Bacteria 1351
402 Ga0495613_0057904 3300046689 Bacteria 2845
403 Ga0495613_0114037 3300046689 Bacteria 1945
404 Ga0495613_0383067 3300046689 Unclassified 961
405 Ga0495600_0071375 3300046809 Bacteria 2268
406 Ga0495581_0066370 3300047315 Bacteria 2086
407 Ga0495604_0064007 3300047317 Unclassified 2804
408 Ga0495604_0084057 3300047317 Bacteria 2377
409 Ga0495604_0487496 3300047317 Unclassified 801
410 Ga0495674_0127853 3300047319 Bacteria 2142
411 Ga0495674_0323715 3300047319 Bacteria 1255
412 Ga0495674_0593004 3300047319 Unclassified 878
413 Ga0495680_0076203 3300047322 Bacteria 2543
414 Ga0495680_0266887 3300047322 Unclassified 1209
415 Ga0495680_0291387 3300047322 Bacteria 1148
416 Ga0495675_0008781 3300047444 Bacteria 6274
417 Ga0495675_0060462 3300047444 Bacteria 2401
418 Ga0495675_0134214 3300047444 Bacteria 1537
419 Ga0495677_0230388 3300047445 Unclassified 723
420 Ga0495684_0043950 3300047471 Bacteria 3420
421 Ga0495684_0097820 3300047471 Bacteria 2219
422 Ga0495684_0130078 3300047471 Bacteria 1891
423 Ga0495684_0813162 3300047471 Unclassified 609
424 Ga0495602_0124305 3300048088 Bacteria 2070
425 Ga0495602_0132699 3300048088 Bacteria 1983
426 Ga0495602_0877272 3300048088 Unclassified 598
427 Ga0496101_0126237 3300048904 Unclassified 1939
428 Ga0496104_0768523 3300048907 Unclassified 870
429 Ga0496106_0288783 3300048909 Bacteria 1315
430 Ga0496112_0125979 3300048915 Bacteria 2532
431 Ga0496115_0407341 3300048918 Unclassified 1103
432 Ga0501292_076806 3300049515 Unclassified 629
433 Ga0501299_025971 3300049522 Unclassified 1103
434 Ga0501068_0109719 3300049584 Bacteria 1715
435 Ga0501208_145142 3300049655 Unclassified 536
436 Ga0501209_074575 3300049656 Unclassified 970
437 Ga0501217_090643 3300049661 Unclassified 858
438 Ga0501238_037114 3300049671 Unclassified 712
439 Ga0501239_002310 3300049672 Bacteria 1719
440 Ga0501239_044720 3300049672 Unclassified 623
441 Ga0501248_002893 3300049678 Bacteria 1201
442 Ga0501248_024040 3300049678 Unclassified 652
443 Ga0501249_076099 3300049679 Unclassified 786
444 Ga0501251_058307 3300049681 Unclassified 630
445 Ga0501257_271206 3300049686 Unclassified 508
446 Ga0501225_0317166 3300049705 Unclassified 531
447 Ga0501079_0573684 3300049741 Bacteria 887
448 Ga0501080_0717639 3300049742 Unclassified 881
449 Ga0501080_1547734 3300049742 Unclassified 563
450 Ga0501264_020771 3300049761 Unclassified 696
451 Ga0501268_002796 3300049765 Bacteria 2331
452 Ga0501270_172827 3300049767 Unclassified 506
453 Ga0501273_002832 3300049770 Bacteria 1796
454 Ga0501273_003181 3300049770 Bacteria 1723
455 Ga0501204_058919 3300049850 Unclassified 606
456 Ga0501226_014330 3300049853 Unclassified 875
457 nmdc:mga09592_283754_c1 3300050508 Bacteria 1436
458 nmdc:mga08y16_178901_c1 3300050511 Bacteria 2203
459 nmdc:mga08y16_183676_c1 3300050511 Unclassified 2171
460 nmdc:mga08y16_202741_c1 3300050511 Bacteria 2056
461 nmdc:mga08y16_208860_c1 3300050511 Bacteria 2022
462 nmdc:mga0n895_172028_c1 3300050512 Bacteria 2198
463 nmdc:mga0n895_1938510_c1 3300050512 Bacteria 548
464 nmdc:mga0n895_706668_c1 3300050512 Bacteria 1004
465 nmdc:mga0a205_176068_c1 3300050515 Bacteria 2035
466 nmdc:mga0a205_194070_c1 3300050515 Bacteria 1922
467 Ga0495612_0075949 3300053078 Bacteria 1407
468 Ga0495595_0053503 3300053084 Bacteria 1875
469 Ga0495595_0408082 3300053084 Unclassified 689
470 Ga0495619_0045388 3300053085 Bacteria 2887
471 Ga0501084_0237841 3300054114 Bacteria 1537
472 Ga0590071_014176 3300059421 Bacteria 1869
473 Ga0590074_003042 3300059423 Bacteria 2768
474 Ga0590075_011261 3300059424 Bacteria 2160
475 Ga0590077_009572 3300059426 Bacteria 1989
476 Ga0530510_0042684 3300061734 Bacteria 3276
477 Ga0070711_100198922
478 Ga0065715_10493773
479 Ga0070658_10352279
480 Ga0070658_11329302
481 Ga0070676_10063947
482 Ga0070670_100244056
483 Ga0070677_10042012
484 Ga0068869_100060247
485 Ga0070680_100551286
486 Ga0070682_100355416
487 Ga0068868_100166205
488 Ga0070660_100331320
489 Ga0070661_100166531
490 Ga0070669_100699071
491 Ga0070675_100729089
492 Ga0070671_100118060
493 Ga0070674_100132543
494 Ga0070674_100548128
495 Ga0070674_101600494
496 Ga0070673_100756634
497 Ga0070659_100105345
498 Ga0070667_100118323
499 Ga0070709_10077669
500 Ga0070709_11013060
501 Ga0070709_11411910
502 Ga0070714_100440212
503 Ga0070713_100130224
504 Ga0070711_100074666
505 Ga0070711_100601946
506 Ga0070711_101172485
507 Ga0070700_100055005
508 Ga0070700_101190201
509 Ga0070708_100149174
510 Ga0070708_100167404
511 Ga0070708_101078035
512 Ga0070663_100192176
513 Ga0070678_100856155
514 Ga0070678_100870076
515 Ga0070681_10194632
516 Ga0068867_100096962
517 Ga0068867_101441894
518 Ga0070707_100167594
519 Ga0070707_100356606
520 Ga0070707_101313373
521 Ga0070698_100171255
522 Ga0070698_101256818
523 Ga0070699_100151336
524 Ga0070699_101453268
525 Ga0070684_100146830
526 Ga0070697_100289141
527 Ga0070697_102033664
528 Ga0068853_101079019
529 Ga0070672_100114250
530 Ga0070672_100130558
531 Ga0070696_101918307
532 Ga0070693_100254969
533 Ga0070693_100897812
534 Ga0070665_100067089
535 Ga0070665_100186413
536 Ga0070665_100324770
537 Ga0070665_101027039
538 Ga0070665_101254105
539 Ga0068854_100654985
540 Ga0068856_100332131
541 Ga0070702_100945993
542 Ga0068859_100116708
543 Ga0068859_100452920
544 Ga0068859_101924966
545 Ga0068864_100181637
546 Ga0068864_101126465
547 Ga0068870_10066123
548 Ga0068863_101915381
549 Ga0068863_101934884
550 Ga0068863_102512516
551 Ga0068858_101309843
552 Ga0068860_101993687
553 Ga0081455_10115994
554 Ga0081455_10364305
555 Ga0081540_1042441
556 Ga0070717_10146956
557 Ga0070717_10156633
558 Ga0070717_10182908
559 Ga0070717_10580150
560 Ga0070717_11976120
561 Ga0070716_100821520
562 Ga0070716_101162263
563 Ga0070712_100106928
564 Ga0070712_100216368
565 Ga0070712_101401155
566 Ga0097621_100094242
567 Ga0097621_100116855
568 Ga0097621_100927656
569 Ga0097621_101085727
570 Ga0068871_100322006
571 Ga0068871_100412994
572 Ga0068871_100503760
573 Ga0068871_100562730
574 Ga0068871_101039256
575 Ga0068871_101615669
576 Ga0075428_100354858
577 Ga0075433_11222813
578 Ga0075434_100207596
579 Ga0075434_101089389
580 Ga0075434_101519927
581 Ga0068865_101681995
582 Ga0097620_100116709
583 Ga0097620_100452904
584 Ga0097620_101925063
585 Ga0105240_10439159
586 Ga0105240_10622301
587 Ga0105240_11675650
588 Ga0111539_10170167
589 Ga0111539_10194257
590 Ga0111539_10222150
591 Ga0111539_10432557
592 Ga0111539_12382282
593 Ga0105245_10219729
594 Ga0105245_11664265
595 Ga0105245_12798144
596 Ga0105247_10271574
597 Ga0114129_12906154
598 Ga0105243_10137804
599 Ga0105243_13109885
600 Ga0105241_10150521
601 Ga0105241_11404651
602 Ga0105242_10233140
603 Ga0105242_10331996
604 Ga0105242_12418281
605 Ga0105248_10054513
606 Ga0105248_10231645
607 Ga0105248_12687846
608 Ga0105237_10048870
609 Ga0105237_10920041
610 Ga0105237_11140495
611 Ga0105237_11638539
612 Ga0105238_10296773
613 Ga0105238_10489897
614 Ga0105238_11442256
615 Ga0105238_12077751
616 Ga0105249_11085073
617 Ga0105249_12387135
618 Ga0105239_10238377
619 Ga0105239_10297932
620 Ga0105239_10832350
621 Ga0105239_10869338
622 Ga0105239_12660852
623 Ga0105239_12782118
624 Ga0105246_10055486
625 Ga0105246_10313147
626 Ga0157373_10073972
627 Ga0157373_10088143
628 Ga0157373_10915887
629 Ga0157371_10120865
630 Ga0157370_12004024
631 Ga0157374_10180250
632 Ga0157378_10109831
633 Ga0157378_10357721
634 Ga0157378_11194322
635 Ga0163162_10348322
636 Ga0163162_10415218
637 Ga0163162_10705971
638 Ga0163162_11217456
639 Ga0163162_11869562
640 Ga0157372_10181671
641 Ga0157372_10263441
642 Ga0157372_12751723
643 Ga0157375_10114158
644 Ga0157375_10164727
645 Ga0163163_11117985
646 Ga0163163_13067274
647 Ga0163163_13337996
648 Ga0157380_11377842
649 Ga0157377_10093327
650 Ga0157379_10873053
651 Ga0157379_11836635
652 Ga0157376_10120491
653 Ga0157376_10127927
654 Ga0157376_10849182
655 Ga0182005_1121268
656 Ga0163161_10110482
657 Ga0213873_10086780
658 Ga0213875_10050500
659 Ga0213875_10095594
660 Ga0213871_10049661
661 Ga0207682_10037334
662 Ga0207692_10206552
663 Ga0207680_10027198
664 Ga0207699_10076976
665 Ga0207699_10080795
666 Ga0207699_10909004
667 Ga0207645_10056381
668 Ga0207645_10099530
669 Ga0207705_10344682
670 Ga0207705_11098397
671 Ga0207654_10276021
672 Ga0207654_10958259
673 Ga0207707_10196834
674 Ga0207695_10058030
675 Ga0207695_10077403
676 Ga0207695_11756669
677 Ga0207671_11271135
678 Ga0207693_10024052
679 Ga0207663_10090895
680 Ga0207663_10179486
681 Ga0207663_10802162
682 Ga0207657_10120876
683 Ga0207649_10060360
684 Ga0207652_10491854
685 Ga0207646_10583898
686 Ga0207646_10874497
687 Ga0207681_10577602
688 Ga0207694_10601032
689 Ga0207650_10232192
690 Ga0207659_10571246
691 Ga0207659_10593277
692 Ga0207687_10214706
693 Ga0207687_10513305
694 Ga0207700_10150742
695 Ga0207664_10422254
696 Ga0207706_10514584
697 Ga0207686_10846905
698 Ga0207670_10094425
699 Ga0207691_10051046
700 Ga0207691_10087506
701 Ga0207711_10154139
702 Ga0207711_10169141
703 Ga0207711_10180497
704 Ga0207711_11515625
705 Ga0207689_10087616
706 Ga0207689_10130000
707 Ga0207689_10595706
708 Ga0207661_11312662
709 Ga0207661_11652316
710 Ga0207679_10706574
711 Ga0207712_10775909
712 Ga0207712_11406754
713 Ga0207677_10172541
714 Ga0207677_11812127
715 Ga0207708_10031937
716 Ga0207702_11346381
717 Ga0207641_11430210
718 Ga0207648_10863355
719 Ga0207648_10955907
720 Ga0207676_10164121
721 Ga0207675_100168601
722 Ga0207683_10060975
723 Ga0207683_10695111
724 Ga0207698_11810368
725 Ga0207428_10045494
726 Ga0207428_10117707
727 Ga0207428_10127544
728 Ga0268266_10524745
729 Ga0268264_12359407
730 Ga0265338_10086077
731 Ga0265760_10016324
732 Ga0265760_10027426
733 Ga0265332_10032158
734 Ga0265332_10060452
735 Ga0265331_10008944
736 Ga0265316_10035414
737 Ga0265342_10567576
738 Ga0307405_11060438
739 Ga0307410_11525409
740 Ga0307406_10498803
741 Ga0307412_10119737
742 Ga0307416_100204870
743 Ga0307414_10128238
744 Ga0307411_10048471
745 Ga0373926_0029469
746 Ga0373926_0035291
747 Ga0373934_0026719
748 Ga0373934_0033973
749 Ga0373923_0031243
750 Ga0373936_0050060
751 Ga0373936_0065138
752 Ga0373953_0030624
753 Ga0373954_0036336
754 Ga0373954_0193014
755 Ga0373956_0043673
756 Ga0373956_0240923
757 Ga0373957_0022750
758 Ga0373957_0027200
759 Ga0373955_0068510
760 Ga0373955_0103369
761 Ga0373942_0372936
762 Ga0373961_0272277
763 Ga0373924_0030934
764 Ga0373924_0145530
765 Ga0373931_0149812
766 Ga0373931_0199258
767 Ga0373931_0324779
768 Ga0373935_0091591
769 Ga0373927_0083949
770 Ga0373927_0264384
771 Ga0373933_0088162
772 Ga0373933_0107298
773 Ga0373947_0129199
774 Ga0373947_0148522
775 Ga0373937_0177539
776 Ga0373937_0312004
777 Ga0373937_0330570
778 Ga0373937_0586621
779 Ga0373937_0652694
780 Ga0373925_0069811
781 Ga0373925_1152789
782 Ga0395899_0084237
783 Ga0395900_0071225
784 Ga0395898_0062703
785 Ga0436364_0031556
786 Ga0436364_0395952
787 Ga0436364_0989768
788 Ga0436364_1121355
789 Ga0395901_0087728
790 Ga0436360_0437231
791 Ga0436361_0101507
792 Ga0436362_0098068
793 Ga0439439_0126009
794 Ga0451839_1253083
795 Ga0451853_0236040
796 Ga0439433_0185493
797 Ga0439450_007377
798 Ga0439435_0025354
799 Ga0439444_0013453
800 Ga0439464_0097385
801 Ga0439460_0125532
802 Ga0453684_1468075
803 Ga0451576_0100857
804 Ga0495592_0098196
805 Ga0495603_0059473
806 Ga0495629_0114826
807 Ga0495629_0115363
808 Ga0495651_0035355
809 Ga0495651_0082628
810 Ga0495651_0158335
811 Ga0495651_0251561
812 Ga0495653_0050004
813 Ga0495653_0109441
814 Ga0495580_0092933
815 Ga0495580_0926650
816 Ga0495582_0054260
817 Ga0495582_0189675
818 Ga0495639_0014440
819 Ga0495639_0153010
820 Ga0495662_0040816
821 Ga0495664_0022555
822 Ga0495664_0066215
823 Ga0495594_0031732
824 Ga0495608_0011316
825 Ga0495608_0117047
826 Ga0495608_0461042
827 Ga0495618_0111107
828 Ga0495618_0112074
829 Ga0495628_0046495
830 Ga0495628_0099594
831 Ga0495628_0984392
832 Ga0495630_0039501
833 Ga0495630_0115159
834 Ga0495630_0382343
835 Ga0495630_0826709
836 Ga0495666_0046091
837 Ga0495666_0476717
838 Ga0495642_0321743
839 Ga0495652_0046896
840 Ga0495652_0060763
841 Ga0495652_0066328
842 Ga0495665_0065526
843 Ga0495665_0067306
844 Ga0495640_0042422
845 Ga0495640_0221448
846 Ga0495640_0486329
847 Ga0495586_0058598
848 Ga0495586_0063825
849 Ga0495587_0047278
850 Ga0495587_0048560
851 Ga0495587_0074015
852 Ga0495621_0263476
853 Ga0495645_0005826
854 Ga0495645_0083621
855 Ga0495645_0170747
856 Ga0495622_0044516
857 Ga0495667_0028528
858 Ga0495667_0060980
859 Ga0495667_0133758
860 Ga0495667_0245787
861 Ga0495667_0777725
862 Ga0495634_0072733
863 Ga0495634_0075106
864 Ga0495634_0089805
865 Ga0495635_0072485
866 Ga0495635_0288638
867 Ga0495659_0298864
868 Ga0495657_0073409
869 Ga0495657_0182310
870 Ga0495599_0022640
871 Ga0495599_0059488
872 Ga0495623_0010072
873 Ga0495623_0027263
874 Ga0495623_0068326
875 Ga0495647_0485354
876 Ga0495658_0074144
877 Ga0495669_0099241
878 Ga0495613_0057904
879 Ga0495613_0114037
880 Ga0495613_0383067
881 Ga0495600_0071375
882 Ga0495581_0066370
883 Ga0495604_0064007
884 Ga0495604_0084057
885 Ga0495604_0487496
886 Ga0495674_0127853
887 Ga0495674_0323715
888 Ga0495674_0593004
889 Ga0495680_0076203
890 Ga0495680_0266887
891 Ga0495680_0291387
892 Ga0495675_0008781
893 Ga0495675_0060462
894 Ga0495675_0134214
895 Ga0495677_0230388
896 Ga0495684_0043950
897 Ga0495684_0097820
898 Ga0495684_0130078
899 Ga0495684_0813162
900 Ga0495602_0124305
901 Ga0495602_0132699
902 Ga0495602_0877272
903 Ga0496101_0126237
904 Ga0496104_0768523
905 Ga0496106_0288783
906 Ga0496112_0125979
907 Ga0496115_0407341
908 Ga0501292_076806
909 Ga0501299_025971
910 Ga0501068_0109719
911 Ga0501208_145142
912 Ga0501209_074575
913 Ga0501217_090643
914 Ga0501238_037114
915 Ga0501239_002310
916 Ga0501239_044720
917 Ga0501248_002893
918 Ga0501248_024040
919 Ga0501249_076099
920 Ga0501251_058307
921 Ga0501257_271206
922 Ga0501225_0317166
923 Ga0501079_0573684
924 Ga0501080_0717639
925 Ga0501080_1547734
926 Ga0501264_020771
927 Ga0501268_002796
928 Ga0501270_172827
929 Ga0501273_002832
930 Ga0501273_003181
931 Ga0501204_058919
932 Ga0501226_014330
933 nmdc:mga09592_283754_c1
934 nmdc:mga08y16_178901_c1
935 nmdc:mga08y16_183676_c1
936 nmdc:mga08y16_202741_c1
937 nmdc:mga08y16_208860_c1
938 nmdc:mga0n895_172028_c1
939 nmdc:mga0n895_1938510_c1
940 nmdc:mga0n895_706668_c1
941 nmdc:mga0a205_176068_c1
942 nmdc:mga0a205_194070_c1
943 Ga0495612_0075949
944 Ga0495595_0053503
945 Ga0495595_0408082
946 Ga0495619_0045388
947 Ga0501084_0237841
948 Ga0590071_014176
949 Ga0590074_003042
950 Ga0590075_011261
951 Ga0590077_009572
952 Ga0530510_0042684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sj9-assembly2.cif.gz_B proteasome accessory factor b/c (pafbc) of arthrobacter aurescens 0.7765 14 99
2qyh-assembly2.cif.gz_C crystal structure of the hypothetical protein (gk1056) from geobacillus kaustophilus hta426 0.7752 8 38
7cce-assembly1.cif.gz_A crystal structure of arabidopsis aipp3 bah domain in complex with an h3k27me3 peptide 0.7496 25 58
8tpk-assembly1.cif.gz_A p6522 crystal form of c. crescentus drid-ssdna-dna complex 0.7483 12 99
3pt9-assembly1.cif.gz_A crystal structure of mouse dnmt1(731-1602) in the free state 0.7002 24 58
ID Description Score Start End Superfamily
af_P52133_127_211_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8491 15 96 2.30.29.30
af_E7F226_64_240_2.30.30.490 Mainly Beta;Roll;SH3 type barrels.;Bromo adjacent homology (BAH) domain 0.7062 24 58 2.30.30.490
af_Q09228_71_222_2.30.30.490 Mainly Beta;Roll;SH3 type barrels.;Bromo adjacent homology (BAH) domain 0.705 25 58 2.30.30.490
af_Q54GS9_478_542_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6951 25 93 2.30.30.30
af_P52133_127_211_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6838 15 96 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7Y5GIA6-F1-model_v4 Uncharacterized protein 0.9281 1 126
AF-A0A538J563-F1-model_v4 WYL domain-containing protein 0.9235 14 114
AF-A0A508ZGJ8-F1-model_v4 deleted 0.9225 13 92
AF-Q01TG8-F1-model_v4 Uncharacterized protein 0.9203 16 92
AF-A0A6N9A548-F1-model_v4 WYL domain-containing protein 0.9192 14 113

Map