F451487

General Info

Members Datasets Scaffolds Average Seq Length
476 254 459 241

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100001888|Ga0070667_10000188822
Length 280
Sequence MPQAANASVTRSSGHHQAPSCQSRGEGHVDAMTATRLFDRAVIRLSARDGASEDVGAFLQGLVTNDVTGALPVWAALLSPQGKALFDFIVWPAGQGLLIDCEATAADSLVKRLSLYRLRKPIDIAIDPALAVHWRPHVGDGAAPDPRLAALGERWVAAIDETDPEEQEKGADAAWRAHRLQQGVCEGRDELGDGETLWLECNAAELHGVSFTKGCYVGQENTARMNWRQKVNRRLVVVPLDHSNERRRRAAYPDLGLAVDHLRVEDLTPEISPGWLRAEL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
6 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
7 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
8 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
9 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
10 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
11 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
12 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
13 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
14 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
15 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
235 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
236 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
244 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
250 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
251 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.55
Nodule 0.21
Rhizoplane 3.57
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2557718 2162886007 Bacteria 3275
2 SwRhRL2b_contig_3444055 2162886007 Bacteria 26279
3 JGI24737J22298_10007992 3300001990 Bacteria 3554
4 JGI24034J26672_10007656 3300002239 Bacteria 1570
5 Ga0055536_1002827 3300003781 Bacteria 9561
6 Ga0055536_1009652 3300003781 Bacteria 3954
7 Ga0055530_10000203 3300003791 Bacteria 53592
8 Ga0055531_10005851 3300003794 Bacteria 7104
9 Ga0065704_10000204 3300005289 Bacteria 211587
10 Ga0065704_10079454 3300005289 Bacteria 4156
11 Ga0065704_10080702 3300005289 Bacteria 3896
12 Ga0065715_10002327 3300005293 Bacteria 5416
13 Ga0065707_10102680 3300005295 Bacteria 2791
14 Ga0070658_10007918 3300005327 Bacteria 8556
15 Ga0070658_10020535 3300005327 Bacteria 5294
16 Ga0070658_10027186 3300005327 Bacteria 4593
17 Ga0070676_10196444 3300005328 Bacteria 1320
18 Ga0070670_100000333 3300005331 Bacteria 39598
19 Ga0070670_100020754 3300005331 Bacteria 5648
20 Ga0070670_100236985 3300005331 Bacteria 1588
21 Ga0070677_10069480 3300005333 Bacteria 1477
22 Ga0070666_10252771 3300005335 Bacteria 1248
23 Ga0070666_10434015 3300005335 Bacteria 947
24 Ga0070660_100136070 3300005339 Bacteria 1969
25 Ga0070660_100193530 3300005339 Bacteria 1648
26 Ga0070660_100195348 3300005339 Bacteria 1640
27 Ga0070660_100422499 3300005339 Bacteria 1104
28 Ga0070661_100040419 3300005344 Bacteria 3403
29 Ga0070661_100126552 3300005344 Bacteria 1917
30 Ga0070661_100151033 3300005344 Bacteria 1756
31 Ga0070661_100173119 3300005344 Bacteria 1640
32 Ga0070668_100002363 3300005347 Bacteria 13868
33 Ga0070668_100002440 3300005347 Bacteria 13678
34 Ga0070668_100221066 3300005347 Bacteria 1562
35 Ga0070668_100233727 3300005347 Bacteria 1520
36 Ga0070668_100389975 3300005347 Bacteria 1187
37 Ga0070669_100000193 3300005353 Bacteria 53850
38 Ga0070669_100002206 3300005353 Bacteria 14110
39 Ga0070669_100013436 3300005353 Bacteria 5821
40 Ga0070669_100247983 3300005353 Bacteria 1417
41 Ga0070669_100356361 3300005353 Bacteria 1189
42 Ga0070675_100005716 3300005354 Bacteria 9516
43 Ga0070675_100012897 3300005354 Bacteria 6560
44 Ga0070675_100340651 3300005354 Bacteria 1328
45 Ga0070671_100000322 3300005355 Bacteria 32627
46 Ga0070671_100002891 3300005355 Bacteria 13371
47 Ga0070671_100009970 3300005355 Bacteria 7627
48 Ga0070671_100057950 3300005355 Bacteria 3224
49 Ga0070674_100037322 3300005356 Bacteria 3267
50 Ga0070673_100002044 3300005364 Bacteria 12181
51 Ga0070673_100299576 3300005364 Bacteria 1415
52 Ga0070673_100562920 3300005364 Bacteria 1036
53 Ga0070659_100001062 3300005366 Bacteria 20090
54 Ga0070659_100002387 3300005366 Bacteria 13352
55 Ga0070659_100470699 3300005366 Bacteria 1068
56 Ga0070659_100477969 3300005366 Bacteria 1060
57 Ga0070659_100560332 3300005366 Bacteria 979
58 Ga0070667_100001888 3300005367 Bacteria 18600
59 Ga0070667_100027459 3300005367 Bacteria 4735
60 Ga0070667_100125868 3300005367 Bacteria 2233
61 Ga0070667_100138218 3300005367 Bacteria 2131
62 Ga0070705_100073046 3300005440 Bacteria 2080
63 Ga0070694_100001882 3300005444 Bacteria 12423
64 Ga0070663_100070316 3300005455 Bacteria 2545
65 Ga0070663_100160478 3300005455 Bacteria 1730
66 Ga0070678_100543876 3300005456 Bacteria 1030
67 Ga0070662_100005254 3300005457 Bacteria 8262
68 Ga0070662_100028881 3300005457 Bacteria 3865
69 Ga0070662_100039124 3300005457 Bacteria 3373
70 Ga0068853_100115861 3300005539 Bacteria 2386
71 Ga0070672_100004771 3300005543 Bacteria 8896
72 Ga0070672_100009460 3300005543 Bacteria 6719
73 Ga0070696_100143499 3300005546 Bacteria 1747
74 Ga0070665_100001012 3300005548 Bacteria 35432
75 Ga0070665_100011456 3300005548 Bacteria 8964
76 Ga0070665_100028368 3300005548 Bacteria 5639
77 Ga0070665_100051741 3300005548 Bacteria 4119
78 Ga0068855_100013435 3300005563 Bacteria 9872
79 Ga0070664_100014998 3300005564 Bacteria 6325
80 Ga0070664_100064890 3300005564 Bacteria 3114
81 Ga0070664_100095858 3300005564 Bacteria 2574
82 Ga0068856_100509544 3300005614 Bacteria 1224
83 Ga0068852_100098854 3300005616 Bacteria 2629
84 Ga0068852_100274230 3300005616 Bacteria 1624
85 Ga0068859_100072791 3300005617 Bacteria 3473
86 Ga0068859_100486573 3300005617 Bacteria 1329
87 Ga0068864_100047245 3300005618 Bacteria 3696
88 Ga0068864_100205274 3300005618 Bacteria 1812
89 Ga0068851_10073471 3300005834 Bacteria 1774
90 Ga0068863_100000106 3300005841 Bacteria 90344
91 Ga0068863_100005101 3300005841 Bacteria 12954
92 Ga0068863_100018487 3300005841 Bacteria 6670
93 Ga0068863_100073546 3300005841 Bacteria 3234
94 Ga0068863_100631267 3300005841 Bacteria 1062
95 Ga0068858_100025779 3300005842 Bacteria 5469
96 Ga0068858_100049017 3300005842 Bacteria 3912
97 Ga0068860_100000187 3300005843 Bacteria 98756
98 Ga0068860_100079954 3300005843 Bacteria 3109
99 Ga0068860_100249386 3300005843 Bacteria 1728
100 Ga0068860_100443948 3300005843 Bacteria 1289
101 Ga0068860_100825862 3300005843 Bacteria 941
102 Ga0068862_100005927 3300005844 Bacteria 10176
103 Ga0068862_100017716 3300005844 Bacteria 5928
104 Ga0068862_100022859 3300005844 Bacteria 5234
105 Ga0075365_10006663 3300006038 Bacteria 6380
106 Ga0075368_10000197 3300006042 Bacteria 16662
107 Ga0075363_100006937 3300006048 Bacteria 5178
108 Ga0075364_10405136 3300006051 Bacteria 931
109 Ga0075362_10003545 3300006177 Bacteria 5478
110 Ga0075362_10034006 3300006177 Bacteria 2220
111 Ga0075367_10003387 3300006178 Bacteria 7592
112 Ga0075369_10009990 3300006186 Bacteria 3705
113 Ga0075369_10075019 3300006186 Bacteria 1493
114 Ga0075366_10003089 3300006195 Bacteria 8695
115 Ga0075366_10003942 3300006195 Bacteria 7917
116 Ga0075366_10027754 3300006195 Bacteria 3322
117 Ga0075366_10035477 3300006195 Bacteria 2940
118 Ga0075370_10000139 3300006353 Bacteria 24533
119 Ga0075370_10004676 3300006353 Bacteria 6678
120 Ga0075370_10005075 3300006353 Bacteria 6489
121 Ga0075370_10029090 3300006353 Bacteria 3075
122 Ga0075370_10348793 3300006353 Bacteria 884
123 Ga0075433_10040363 3300006852 Bacteria 4039
124 Ga0068865_100092170 3300006881 Bacteria 2201
125 Ga0097620_100072797 3300006931 Bacteria 3473
126 Ga0097620_100486587 3300006931 Bacteria 1329
127 Ga0079104_1010239 3300006946 Bacteria 3105
128 Ga0105251_10004489 3300009011 Bacteria 9471
129 Ga0105243_10033559 3300009148 Bacteria 3969
130 Ga0105243_10093986 3300009148 Bacteria 2475
131 Ga0105241_10096556 3300009174 Bacteria 2341
132 Ga0105248_10002100 3300009177 Bacteria 22075
133 Ga0105248_10022015 3300009177 Bacteria 7062
134 Ga0105248_10113775 3300009177 Bacteria 3052
135 Ga0105248_10183452 3300009177 Bacteria 2358
136 Ga0105248_10254077 3300009177 Bacteria 1978
137 Ga0105238_10314009 3300009551 Bacteria 1552
138 Ga0105249_10002812 3300009553 Bacteria 15022
139 Ga0105239_10162874 3300010375 Bacteria 2493
140 Ga0105246_10328663 3300011119 Bacteria 1245
141 Ga0157373_10147202 3300013100 Bacteria 1657
142 Ga0157371_10115133 3300013102 Bacteria 1910
143 Ga0157371_10257684 3300013102 Bacteria 1257
144 Ga0157370_10350843 3300013104 Bacteria 1360
145 Ga0157374_10149918 3300013296 Bacteria 2267
146 Ga0163162_10017371 3300013306 Bacteria 7037
147 Ga0163162_10182817 3300013306 Bacteria 2223
148 Ga0163162_10211463 3300013306 Bacteria 2069
149 Ga0163162_10614862 3300013306 Bacteria 1212
150 Ga0157372_10632635 3300013307 Bacteria 1246
151 Ga0157375_10148081 3300013308 Bacteria 2480
152 Ga0157375_11336511 3300013308 Bacteria 843
153 Ga0163163_10012847 3300014325 Bacteria 7641
154 Ga0157380_10083655 3300014326 Bacteria 2615
155 Ga0157380_10115132 3300014326 Bacteria 2267
156 Ga0157380_10740730 3300014326 Bacteria 993
157 Ga0163161_10001748 3300017792 Bacteria 15903
158 Ga0213875_10023931 3300021388 Bacteria 2914
159 Ga0209675_1000399 3300025291 Bacteria 36040
160 Ga0209676_1000358 3300025292 Bacteria 86541
161 Ga0209676_1000829 3300025292 Bacteria 40137
162 Ga0209676_1001005 3300025292 Bacteria 33061
163 Ga0209676_1034795 3300025292 Bacteria 1485
164 Ga0209025_1013690 3300025294 Bacteria 5070
165 Ga0209025_1090701 3300025294 Bacteria 1000
166 Ga0209050_1000437 3300025298 Bacteria 76322
167 Ga0209050_1004189 3300025298 Bacteria 9981
168 Ga0209257_1000328 3300025304 Bacteria 99542
169 Ga0209257_1002217 3300025304 Bacteria 19994
170 Ga0209257_1006957 3300025304 Bacteria 7051
171 Ga0209257_1047813 3300025304 Bacteria 1228
172 Ga0207656_10165780 3300025321 Bacteria 1054
173 Ga0207696_1005679 3300025711 Bacteria 5142
174 Ga0207682_10065383 3300025893 Bacteria 1531
175 Ga0207710_10133831 3300025900 Bacteria 1192
176 Ga0207680_10247773 3300025903 Bacteria 1230
177 Ga0207680_10392310 3300025903 Bacteria 980
178 Ga0207647_10000575 3300025904 Bacteria 28658
179 Ga0207645_10116989 3300025907 Bacteria 1729
180 Ga0207705_10026658 3300025909 Bacteria 4119
181 Ga0207705_10144431 3300025909 Bacteria 1779
182 Ga0207705_10406346 3300025909 Bacteria 1053
183 Ga0207657_10003334 3300025919 Bacteria 17170
184 Ga0207657_10118924 3300025919 Bacteria 2175
185 Ga0207649_10070991 3300025920 Bacteria 2223
186 Ga0207649_10086076 3300025920 Bacteria 2047
187 Ga0207649_10105549 3300025920 Bacteria 1873
188 Ga0207649_10765783 3300025920 Bacteria 752
189 Ga0207681_10000176 3300025923 Bacteria 52358
190 Ga0207681_10018082 3300025923 Bacteria 4437
191 Ga0207681_10212019 3300025923 Bacteria 1493
192 Ga0207650_10001934 3300025925 Bacteria 14585
193 Ga0207650_10122154 3300025925 Bacteria 2029
194 Ga0207650_10677691 3300025925 Bacteria 870
195 Ga0207659_10185375 3300025926 Bacteria 1652
196 Ga0207644_10000293 3300025931 Bacteria 32998
197 Ga0207644_10000941 3300025931 Bacteria 18539
198 Ga0207644_10002537 3300025931 Bacteria 11747
199 Ga0207644_10204330 3300025931 Bacteria 1559
200 Ga0207690_10004613 3300025932 Bacteria 8148
201 Ga0207690_10064194 3300025932 Bacteria 2506
202 Ga0207690_10080295 3300025932 Bacteria 2276
203 Ga0207706_10005399 3300025933 Bacteria 11913
204 Ga0207706_10018353 3300025933 Bacteria 6295
205 Ga0207706_10027770 3300025933 Bacteria 5059
206 Ga0207669_10139914 3300025937 Bacteria 1678
207 Ga0207691_10009536 3300025940 Bacteria 9318
208 Ga0207711_10151553 3300025941 Bacteria 2092
209 Ga0207711_10158897 3300025941 Bacteria 2044
210 Ga0207711_10429763 3300025941 Bacteria 1229
211 Ga0207689_10166122 3300025942 Bacteria 1818
212 Ga0207661_10083694 3300025944 Bacteria 2640
213 Ga0207679_10035063 3300025945 Bacteria 3547
214 Ga0207679_10124289 3300025945 Bacteria 2059
215 Ga0207679_10200123 3300025945 Bacteria 1668
216 Ga0207667_10138723 3300025949 Bacteria 2503
217 Ga0207651_10001423 3300025960 Bacteria 10882
218 Ga0207651_10403870 3300025960 Bacteria 1163
219 Ga0207712_10000269 3300025961 Bacteria 50416
220 Ga0207668_10003524 3300025972 Bacteria 9194
221 Ga0207668_10039424 3300025972 Bacteria 3179
222 Ga0207668_10152688 3300025972 Bacteria 1790
223 Ga0207668_10168996 3300025972 Bacteria 1713
224 Ga0207668_10590578 3300025972 Bacteria 966
225 Ga0207658_10002259 3300025986 Bacteria 14252
226 Ga0207658_10002285 3300025986 Bacteria 14158
227 Ga0207658_10006559 3300025986 Bacteria 7937
228 Ga0207658_10025817 3300025986 Bacteria 4114
229 Ga0207703_10035817 3300026035 Bacteria 3946
230 Ga0207703_10058604 3300026035 Bacteria 3143
231 Ga0207703_10072667 3300026035 Bacteria 2844
232 Ga0207703_10077560 3300026035 Bacteria 2759
233 Ga0207639_10141896 3300026041 Bacteria 2002
234 Ga0207639_10250311 3300026041 Bacteria 1545
235 Ga0207678_10196162 3300026067 Bacteria 1726
236 Ga0207678_10299368 3300026067 Bacteria 1382
237 Ga0207678_10421385 3300026067 Bacteria 1158
238 Ga0207678_10446131 3300026067 Bacteria 1124
239 Ga0207641_10001210 3300026088 Bacteria 25818
240 Ga0207641_10006329 3300026088 Bacteria 10006
241 Ga0207641_10170609 3300026088 Bacteria 1985
242 Ga0207641_10551206 3300026088 Bacteria 1124
243 Ga0207676_10012528 3300026095 Bacteria 6079
244 Ga0207674_10002652 3300026116 Bacteria 22343
245 Ga0207683_10007755 3300026121 Bacteria 9187
246 Ga0207683_10269676 3300026121 Bacteria 1555
247 Ga0207698_10136399 3300026142 Bacteria 2106
248 Ga0207698_10252449 3300026142 Bacteria 1615
249 Ga0207698_10273230 3300026142 Bacteria 1559
250 Ga0209983_1010464 3300027665 Bacteria 1896
251 Ga0209813_10000081 3300027866 Bacteria 35059
252 Ga0209974_10002931 3300027876 Bacteria 6188
253 Ga0268266_10000471 3300028379 Bacteria 58314
254 Ga0268266_10008594 3300028379 Bacteria 9070
255 Ga0268266_10023067 3300028379 Bacteria 5297
256 Ga0268266_10099532 3300028379 Bacteria 2559
257 Ga0268265_10011459 3300028380 Bacteria 5995
258 Ga0268265_10029976 3300028380 Bacteria 3914
259 Ga0268265_10037750 3300028380 Bacteria 3547
260 Ga0268265_10102362 3300028380 Bacteria 2316
261 Ga0268264_10000040 3300028381 Bacteria 373714
262 Ga0268264_10000567 3300028381 Bacteria 45270
263 Ga0268264_10005153 3300028381 Bacteria 11076
264 Ga0268264_10738327 3300028381 Bacteria 980
265 Ga0307408_100100768 3300031548 Bacteria 2200
266 Ga0307508_10134225 3300031616 Bacteria 2078
267 Ga0307405_10015786 3300031731 Bacteria 4099
268 Ga0307405_10028785 3300031731 Bacteria 3240
269 Ga0307405_10082147 3300031731 Bacteria 2108
270 Ga0307405_10212672 3300031731 Bacteria 1413
271 Ga0307410_10048191 3300031852 Bacteria 2852
272 Ga0307407_10050367 3300031903 Bacteria 2382
273 Ga0307407_10104769 3300031903 Bacteria 1763
274 Ga0307407_10110419 3300031903 Bacteria 1725
275 Ga0307412_10026753 3300031911 Bacteria 3590
276 Ga0307412_10098442 3300031911 Bacteria 2063
277 Ga0307412_10172315 3300031911 Bacteria 1619
278 Ga0307412_10230016 3300031911 Bacteria 1427
279 Ga0307412_10444660 3300031911 Bacteria 1066
280 Ga0307409_100445563 3300031995 Bacteria 1248
281 Ga0307416_100011585 3300032002 Bacteria 5891
282 Ga0307416_100070012 3300032002 Bacteria 2906
283 Ga0307416_100074527 3300032002 Bacteria 2836
284 Ga0307416_100280507 3300032002 Bacteria 1642
285 Ga0307416_100365342 3300032002 Bacteria 1467
286 Ga0307416_100874145 3300032002 Bacteria 998
287 Ga0307414_10001714 3300032004 Bacteria 11419
288 Ga0307414_10019979 3300032004 Bacteria 4164
289 Ga0307414_10034726 3300032004 Bacteria 3348
290 Ga0307414_10204025 3300032004 Bacteria 1610
291 Ga0307414_10730045 3300032004 Bacteria 899
292 Ga0307411_10002493 3300032005 Bacteria 8171
293 Ga0307411_10071633 3300032005 Bacteria 2350
294 Ga0307411_10084042 3300032005 Bacteria 2201
295 Ga0307411_10142256 3300032005 Bacteria 1770
296 Ga0307411_10473485 3300032005 Bacteria 1053
297 Ga0307411_10613440 3300032005 Bacteria 937
298 Ga0307415_100040729 3300032126 Bacteria 3080
299 Ga0373939_0033454 3300035114 Bacteria 1502
300 Ga0373960_0103709 3300035121 Bacteria 925
301 Ga0316584_0040702 3300036712 Bacteria 3463
302 Ga0395899_0001123 3300037312 Bacteria 23902
303 Ga0395899_0004324 3300037312 Bacteria 11091
304 Ga0395900_0000161 3300037418 Bacteria 110637
305 Ga0395900_0017917 3300037418 Bacteria 7228
306 Ga0395900_0107659 3300037418 Bacteria 2864
307 Ga0395900_0537498 3300037418 Bacteria 1115
308 Ga0395898_0000937 3300037466 Bacteria 46531
309 Ga0395898_0050360 3300037466 Bacteria 4076
310 Ga0395905_0000120 3300037471 Bacteria 130865
311 Ga0395905_0011956 3300037471 Bacteria 8368
312 Ga0395905_0141921 3300037471 Bacteria 2259
313 Ga0395905_0192718 3300037471 Bacteria 1912
314 Ga0395905_0369140 3300037471 Bacteria 1328
315 Ga0436364_0243496 3300037853 Bacteria 17551
316 Ga0395901_0004800 3300038443 Bacteria 13639
317 Ga0395901_0040781 3300038443 Bacteria 4808
318 Ga0439432_049892 3300042006 Bacteria 1307
319 Ga0466969_0013773 3300044656 Bacteria 4258
320 Ga0466966_0002814 3300044684 Bacteria 11446
321 Ga0466966_0054357 3300044684 Bacteria 2538
322 Ga0466961_0055205 3300044693 Bacteria 2533
323 Ga0466971_0048777 3300044719 Bacteria 1904
324 Ga0466968_0032203 3300044735 Bacteria 2179
325 Ga0466970_0027706 3300044765 Bacteria 2974
326 Ga0466957_0182407 3300044842 Bacteria 1371
327 Ga0466960_0079432 3300044901 Bacteria 1650
328 Ga0466959_0012973 3300045049 Bacteria 6034
329 Ga0466959_0176021 3300045049 Bacteria 1499
330 Ga0451576_0000007 3300045051 Bacteria 782228
331 Ga0451576_0210744 3300045051 Bacteria 2029
332 Ga0466958_0021618 3300045836 Bacteria 3762
333 Ga0466967_0186175 3300045976 Bacteria 1960
334 Ga0466967_0607144 3300045976 Bacteria 1080
335 Ga0495629_0319147 3300046459 Bacteria 1062
336 Ga0495638_0024309 3300046460 Bacteria 3952
337 Ga0495596_0013766 3300046500 Bacteria 3422
338 Ga0495606_0032783 3300046507 Bacteria 3594
339 Ga0495610_0001956 3300046512 Bacteria 17724
340 Ga0495610_0006022 3300046512 Bacteria 8472
341 Ga0495643_0033647 3300046522 Bacteria 2834
342 Ga0495663_0000681 3300046525 Bacteria 11718
343 Ga0495654_0030907 3300046530 Bacteria 2721
344 Ga0495598_0012393 3300046537 Bacteria 2092
345 Ga0495621_0000022 3300046539 Bacteria 28970
346 Ga0495656_0057106 3300046615 Bacteria 1689
347 Ga0495668_0000387 3300046616 Bacteria 58040
348 Ga0495668_0299394 3300046616 Bacteria 882
349 Ga0495625_0002985 3300046660 Bacteria 17532
350 Ga0495625_0012965 3300046660 Bacteria 6726
351 Ga0495669_0004792 3300046684 Bacteria 5611
352 Ga0495670_0010931 3300046691 Bacteria 4462
353 Ga0495671_0015916 3300046692 Bacteria 4025
354 Ga0495636_0269867 3300047318 Bacteria 790
355 Ga0495677_0021267 3300047445 Bacteria 2351
356 Ga0495615_0000060 3300048090 Bacteria 34266
357 Ga0495626_0000877 3300048091 Bacteria 26762
358 Ga0496100_0061192 3300048903 Bacteria 2480
359 Ga0496100_0421670 3300048903 Bacteria 1019
360 Ga0496102_0000160 3300048905 Bacteria 90633
361 Ga0496102_0000445 3300048905 Bacteria 47017
362 Ga0496102_0336463 3300048905 Bacteria 1422
363 Ga0496103_0000021 3300048906 Bacteria 229062
364 Ga0496103_0000198 3300048906 Bacteria 60215
365 Ga0496104_0000131 3300048907 Bacteria 69658
366 Ga0496104_0058606 3300048907 Bacteria 3645
367 Ga0496105_0000111 3300048908 Bacteria 55868
368 Ga0496105_0009657 3300048908 Bacteria 7554
369 Ga0496107_0169740 3300048910 Bacteria 1618
370 Ga0496109_0153130 3300048912 Bacteria 2159
371 Ga0496111_0009804 3300048914 Bacteria 6402
372 Ga0496112_0099076 3300048915 Bacteria 2884
373 Ga0496113_0001810 3300048916 Bacteria 12139
374 Ga0496114_0026523 3300048917 Bacteria 4744
375 Ga0496116_0000045 3300048919 Bacteria 324307
376 Ga0496116_0008688 3300048919 Bacteria 8776
377 Ga0496116_0025398 3300048919 Bacteria 4356
378 Ga0496117_0000578 3300048920 Bacteria 60229
379 Ga0496117_0173712 3300048920 Bacteria 1247
380 Ga0496118_0000585 3300048921 Bacteria 60229
381 Ga0496118_0021880 3300048921 Bacteria 5609
382 Ga0496118_0082580 3300048921 Bacteria 2250
383 Ga0496119_0000339 3300048922 Bacteria 65402
384 Ga0496119_0128824 3300048922 Bacteria 1381
385 Ga0496119_0204430 3300048922 Bacteria 1020
386 Ga0496119_0222145 3300048922 Bacteria 966
387 Ga0496120_0000334 3300048923 Bacteria 78728
388 Ga0496120_0018750 3300048923 Bacteria 4449
389 Ga0496121_0001923 3300048924 Bacteria 33167
390 Ga0496121_0007837 3300048924 Bacteria 12771
391 Ga0496121_0088818 3300048924 Bacteria 2422
392 Ga0496122_0001206 3300048925 Bacteria 44057
393 Ga0496122_0009937 3300048925 Bacteria 9911
394 Ga0496122_0121277 3300048925 Bacteria 1685
395 Ga0496122_0159639 3300048925 Bacteria 1377
396 Ga0496122_0313799 3300048925 Bacteria 838
397 Ga0496123_0000367 3300048926 Bacteria 84634
398 Ga0496123_0001112 3300048926 Bacteria 40286
399 Ga0496124_0000607 3300048927 Bacteria 60229
400 Ga0496124_0005380 3300048927 Bacteria 14456
401 Ga0496124_0180594 3300048927 Bacteria 1624
402 Ga0496124_0303972 3300048927 Bacteria 1150
403 Ga0496125_0011446 3300048928 Bacteria 8870
404 Ga0496125_0012034 3300048928 Bacteria 8613
405 Ga0496126_0000367 3300048929 Bacteria 93102
406 Ga0496126_0055365 3300048929 Bacteria 3589
407 Ga0501032_0035085 3300049569 Bacteria 3430
408 Ga0501033_0013859 3300049570 Bacteria 6133
409 Ga0501034_0054767 3300049571 Bacteria 4015
410 Ga0501037_0206973 3300049573 Bacteria 1385
411 Ga0501038_0016042 3300049574 Bacteria 6803
412 Ga0501039_0026008 3300049575 Bacteria 4499
413 Ga0501043_0101072 3300049579 Bacteria 2266
414 Ga0501047_0541017 3300049581 Bacteria 989
415 Ga0501035_0320448 3300049822 Bacteria 1302
416 Ga0501044_0004367 3300049823 Bacteria 15826
417 Ga0501044_0167494 3300049823 Bacteria 2171
418 Ga0501045_0294866 3300049824 Bacteria 1207
419 nmdc:mga03683_28065_c1 3300050489 Bacteria 2235
420 nmdc:mga03683_5814_c1 3300050489 Bacteria 4188
421 nmdc:mga03n38_192355_c1 3300050490 Bacteria 1052
422 nmdc:mga0k408_15552_c1 3300050493 Bacteria 4208
423 nmdc:mga0k408_25019_c1 3300050493 Bacteria 3378
424 nmdc:mga06z11_904_c1 3300050494 Bacteria 10791
425 nmdc:mga04h51_172_c1 3300050495 Bacteria 18653
426 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
427 nmdc:mga07m45_2225_c1 3300050496 Bacteria 9063
428 nmdc:mga07m45_28076_c1 3300050496 Bacteria 3105
429 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
430 nmdc:mga0a205_6246_c1 3300050515 Bacteria 10755
431 nmdc:mga0sz30_4999_c1 3300050516 Bacteria 4840
432 nmdc:mga0sz30_70114_c1 3300050516 Bacteria 1508
433 Ga0500643_000001 3300053087 Bacteria 1440111
434 Ga0500647_0063783 3300053091 Bacteria 1772
435 Ga0500592_010740 3300053116 Bacteria 1461
436 Ga0500607_000107 3300053121 Bacteria 64565
437 Ga0500607_001731 3300053121 Bacteria 18963
438 Ga0500608_000363 3300053122 Bacteria 17531
439 Ga0500614_010208 3300053123 Bacteria 2015
440 Ga0500658_0008071 3300053134 Bacteria 3892
441 Ga0500559_0000616 3300053136 Bacteria 24116
442 Ga0500559_0003627 3300053136 Bacteria 7551
443 Ga0500564_003611 3300053138 Bacteria 6031
444 Ga0500564_062972 3300053138 Bacteria 1680
445 Ga0500568_0003154 3300053139 Bacteria 9393
446 Ga0500573_0049365 3300053140 Bacteria 2422
447 Ga0500590_007500 3300053148 Bacteria 5391
448 Ga0500616_0005069 3300053153 Bacteria 9094
449 Ga0500619_079542 3300053154 Bacteria 1099
450 Ga0500622_0000283 3300053156 Bacteria 51667
451 Ga0500622_0123517 3300053156 Bacteria 1253
452 Ga0500627_0000056 3300053158 Bacteria 53879
453 Ga0500637_0000400 3300053178 Bacteria 16532
454 Ga0500567_001935 3300053723 Bacteria 8600
455 Ga0500625_000019 3300053729 Bacteria 93445
456 Ga0500645_002886 3300053730 Bacteria 7355
457 Ga0500645_008480 3300053730 Bacteria 3507
458 Ga0466962_0001938 3300061719 Bacteria 9749
459 Ga0466962_0035555 3300061719 Bacteria 2385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025900 Ga0207710_10133831 Ga0207710_101338312 209
2 3300047318 Ga0495636_0269867 Ga0495636_0269867_32_676 211
3 3300027876 Ga0209974_10002931 Ga0209974_100029316 216
4 3300048905 Ga0496102_0000160 Ga0496102_0000160_54758_55456 217
5 3300048906 Ga0496103_0000198 Ga0496103_0000198_54758_55456 217
6 3300048919 Ga0496116_0008688 Ga0496116_0008688_4757_5455 217
7 3300048920 Ga0496117_0000578 Ga0496117_0000578_4774_5472 217
8 3300048921 Ga0496118_0000585 Ga0496118_0000585_54758_55456 217
9 3300048922 Ga0496119_0128824 Ga0496119_0128824_141_839 217
10 3300048923 Ga0496120_0018750 Ga0496120_0018750_1165_1863 217
11 3300048927 Ga0496124_0000607 Ga0496124_0000607_54758_55456 217
12 3300044735 Ga0466968_0032203 Ga0466968_0032203_81_845 221
13 3300048927 Ga0496124_0005380 Ga0496124_0005380_11793_12539 226
14 3300025942 Ga0207689_10166122 Ga0207689_101661222 227
15 3300031731 Ga0307405_10028785 Ga0307405_100287852 227
16 3300032002 Ga0307416_100074527 Ga0307416_1000745275 227
17 3300032005 Ga0307411_10071633 Ga0307411_100716333 227
18 3300032126 Ga0307415_100040729 Ga0307415_1000407293 227
19 3300048924 Ga0496121_0001923 Ga0496121_0001923_9413_10159 227
20 3300005614 Ga0068856_100509544 Ga0068856_1005095441 229
21 3300009148 Ga0105243_10033559 Ga0105243_100335595 229
22 3300021388 Ga0213875_10023931 Ga0213875_100239315 229
23 3300025944 Ga0207661_10083694 Ga0207661_100836945 229
24 3300025945 Ga0207679_10124289 Ga0207679_101242895 229
25 3300031731 Ga0307405_10212672 Ga0307405_102126722 229
26 3300031903 Ga0307407_10104769 Ga0307407_101047693 229
27 3300031911 Ga0307412_10098442 Ga0307412_100984422 229
28 3300031995 Ga0307409_100445563 Ga0307409_1004455632 229
29 3300032004 Ga0307414_10204025 Ga0307414_102040253 229
30 3300032005 Ga0307411_10142256 Ga0307411_101422563 229
31 3300032005 Ga0307411_10613440 Ga0307411_106134401 229
32 3300037853 Ga0436364_0243496 Ga0436364_0243496_1470_2165 229
33 3300046525 Ga0495663_0000681 Ga0495663_0000681_3895_4593 229
34 3300046537 Ga0495598_0012393 Ga0495598_0012393_366_1064 229
35 3300046539 Ga0495621_0000022 Ga0495621_0000022_12768_13466 229
36 3300046615 Ga0495656_0057106 Ga0495656_0057106_251_949 229
37 3300046691 Ga0495670_0010931 Ga0495670_0010931_683_1381 229
38 3300047445 Ga0495677_0021267 Ga0495677_0021267_332_1030 229
39 2162886007 SwRhRL2b_contig_3444055 SwRhRL2b_0270.00000620 230
40 3300005289 Ga0065704_10000204 Ga0065704_10000204171 230
41 3300005327 Ga0070658_10007918 Ga0070658_100079188 230
42 3300005327 Ga0070658_10020535 Ga0070658_100205354 230
43 3300005339 Ga0070660_100193530 Ga0070660_1001935301 230
44 3300005339 Ga0070660_100195348 Ga0070660_1001953482 230
45 3300005344 Ga0070661_100040419 Ga0070661_1000404194 230
46 3300005344 Ga0070661_100126552 Ga0070661_1001265522 230
47 3300005366 Ga0070659_100002387 Ga0070659_1000023875 230
48 3300005366 Ga0070659_100470699 Ga0070659_1004706991 230
49 3300005455 Ga0070663_100070316 Ga0070663_1000703162 230
50 3300005455 Ga0070663_100160478 Ga0070663_1001604782 230
51 3300005457 Ga0070662_100039124 Ga0070662_1000391244 230
52 3300005539 Ga0068853_100115861 Ga0068853_1001158613 230
53 3300005548 Ga0070665_100011456 Ga0070665_1000114565 230
54 3300005564 Ga0070664_100064890 Ga0070664_1000648904 230
55 3300005564 Ga0070664_100095858 Ga0070664_1000958585 230
56 3300005616 Ga0068852_100098854 Ga0068852_1000988542 230
57 3300005616 Ga0068852_100274230 Ga0068852_1002742301 230
58 3300005618 Ga0068864_100047245 Ga0068864_1000472454 230
59 3300005834 Ga0068851_10073471 Ga0068851_100734713 230
60 3300006195 Ga0075366_10035477 Ga0075366_100354772 230
61 3300009551 Ga0105238_10314009 Ga0105238_103140092 230
62 3300013100 Ga0157373_10147202 Ga0157373_101472022 230
63 3300013104 Ga0157370_10350843 Ga0157370_103508432 230
64 3300014325 Ga0163163_10012847 Ga0163163_100128476 230
65 3300025321 Ga0207656_10165780 Ga0207656_101657802 230
66 3300025909 Ga0207705_10026658 Ga0207705_100266582 230
67 3300025909 Ga0207705_10406346 Ga0207705_104063461 230
68 3300025919 Ga0207657_10003334 Ga0207657_1000333410 230
69 3300025920 Ga0207649_10086076 Ga0207649_100860762 230
70 3300025920 Ga0207649_10105549 Ga0207649_101055492 230
71 3300025925 Ga0207650_10677691 Ga0207650_106776912 230
72 3300025932 Ga0207690_10064194 Ga0207690_100641943 230
73 3300025933 Ga0207706_10027770 Ga0207706_100277702 230
74 3300025945 Ga0207679_10035063 Ga0207679_100350635 230
75 3300025945 Ga0207679_10200123 Ga0207679_102001232 230
76 3300026041 Ga0207639_10141896 Ga0207639_101418962 230
77 3300026067 Ga0207678_10196162 Ga0207678_101961622 230
78 3300026067 Ga0207678_10299368 Ga0207678_102993682 230
79 3300026116 Ga0207674_10002652 Ga0207674_100026525 230
80 3300026121 Ga0207683_10007755 Ga0207683_100077558 230
81 3300026142 Ga0207698_10136399 Ga0207698_101363992 230
82 3300026142 Ga0207698_10252449 Ga0207698_102524492 230
83 3300028379 Ga0268266_10099532 Ga0268266_100995325 230
84 3300031903 Ga0307407_10110419 Ga0307407_101104191 230
85 3300032002 Ga0307416_100280507 Ga0307416_1002805072 230
86 3300037312 Ga0395899_0001123 Ga0395899_0001123_222_935 230
87 3300037312 Ga0395899_0004324 Ga0395899_0004324_7346_8059 230
88 3300037418 Ga0395900_0000161 Ga0395900_0000161_96065_96778 230
89 3300037418 Ga0395900_0017917 Ga0395900_0017917_5270_5983 230
90 3300037418 Ga0395900_0107659 Ga0395900_0107659_359_1072 230
91 3300037418 Ga0395900_0537498 Ga0395900_0537498_355_1074 230
92 3300037466 Ga0395898_0000937 Ga0395898_0000937_14379_15092 230
93 3300037466 Ga0395898_0050360 Ga0395898_0050360_2234_2947 230
94 3300037471 Ga0395905_0000120 Ga0395905_0000120_96253_96966 230
95 3300037471 Ga0395905_0011956 Ga0395905_0011956_3146_3859 230
96 3300037471 Ga0395905_0192718 Ga0395905_0192718_563_1273 230
97 3300037471 Ga0395905_0369140 Ga0395905_0369140_34_747 230
98 3300038443 Ga0395901_0004800 Ga0395901_0004800_10257_10970 230
99 3300038443 Ga0395901_0040781 Ga0395901_0040781_2905_3618 230
100 3300044656 Ga0466969_0013773 Ga0466969_0013773_1520_2230 230
101 3300044684 Ga0466966_0002814 Ga0466966_0002814_8451_9161 230
102 3300044684 Ga0466966_0054357 Ga0466966_0054357_1644_2357 230
103 3300044693 Ga0466961_0055205 Ga0466961_0055205_894_1607 230
104 3300044719 Ga0466971_0048777 Ga0466971_0048777_525_1238 230
105 3300044842 Ga0466957_0182407 Ga0466957_0182407_160_873 230
106 3300045049 Ga0466959_0012973 Ga0466959_0012973_3019_3729 230
107 3300045049 Ga0466959_0176021 Ga0466959_0176021_335_1048 230
108 3300045836 Ga0466958_0021618 Ga0466958_0021618_1985_2698 230
109 3300045976 Ga0466967_0186175 Ga0466967_0186175_1182_1895 230
110 3300048915 Ga0496112_0099076 Ga0496112_0099076_1008_1721 230
111 3300061719 Ga0466962_0001938 Ga0466962_0001938_1566_2279 230
112 3300061719 Ga0466962_0035555 Ga0466962_0035555_187_900 230
113 3300001990 JGI24737J22298_10007992 JGI24737J22298_100079923 231
114 3300002239 JGI24034J26672_10007656 JGI24034J26672_100076561 231
115 3300005293 Ga0065715_10002327 Ga0065715_100023273 231
116 3300005327 Ga0070658_10027186 Ga0070658_100271862 231
117 3300005328 Ga0070676_10196444 Ga0070676_101964442 231
118 3300005331 Ga0070670_100000333 Ga0070670_10000033334 231
119 3300005331 Ga0070670_100020754 Ga0070670_1000207542 231
120 3300005333 Ga0070677_10069480 Ga0070677_100694802 231
121 3300005339 Ga0070660_100136070 Ga0070660_1001360701 231
122 3300005339 Ga0070660_100422499 Ga0070660_1004224992 231
123 3300005344 Ga0070661_100151033 Ga0070661_1001510331 231
124 3300005344 Ga0070661_100173119 Ga0070661_1001731193 231
125 3300005347 Ga0070668_100221066 Ga0070668_1002210662 231
126 3300005347 Ga0070668_100233727 Ga0070668_1002337272 231
127 3300005353 Ga0070669_100013436 Ga0070669_1000134366 231
128 3300005353 Ga0070669_100247983 Ga0070669_1002479832 231
129 3300005353 Ga0070669_100356361 Ga0070669_1003563611 231
130 3300005354 Ga0070675_100005716 Ga0070675_1000057164 231
131 3300005354 Ga0070675_100012897 Ga0070675_1000128973 231
132 3300005354 Ga0070675_100340651 Ga0070675_1003406512 231
133 3300005355 Ga0070671_100000322 Ga0070671_1000003227 231
134 3300005355 Ga0070671_100057950 Ga0070671_1000579505 231
135 3300005356 Ga0070674_100037322 Ga0070674_1000373224 231
136 3300005364 Ga0070673_100002044 Ga0070673_1000020444 231
137 3300005364 Ga0070673_100299576 Ga0070673_1002995762 231
138 3300005366 Ga0070659_100001062 Ga0070659_10000106212 231
139 3300005366 Ga0070659_100477969 Ga0070659_1004779691 231
140 3300005366 Ga0070659_100560332 Ga0070659_1005603321 231
141 3300005367 Ga0070667_100138218 Ga0070667_1001382182 231
142 3300005444 Ga0070694_100001882 Ga0070694_1000018826 231
143 3300005456 Ga0070678_100543876 Ga0070678_1005438762 231
144 3300005457 Ga0070662_100005254 Ga0070662_1000052544 231
145 3300005457 Ga0070662_100028881 Ga0070662_1000288813 231
146 3300005543 Ga0070672_100004771 Ga0070672_1000047719 231
147 3300005543 Ga0070672_100009460 Ga0070672_1000094602 231
148 3300005546 Ga0070696_100143499 Ga0070696_1001434991 231
149 3300005563 Ga0068855_100013435 Ga0068855_10001343510 231
150 3300005564 Ga0070664_100014998 Ga0070664_1000149985 231
151 3300005617 Ga0068859_100072791 Ga0068859_1000727912 231
152 3300005618 Ga0068864_100205274 Ga0068864_1002052742 231
153 3300005841 Ga0068863_100073546 Ga0068863_1000735462 231
154 3300005841 Ga0068863_100631267 Ga0068863_1006312672 231
155 3300005842 Ga0068858_100025779 Ga0068858_1000257795 231
156 3300005843 Ga0068860_100249386 Ga0068860_1002493862 231
157 3300006852 Ga0075433_10040363 Ga0075433_100403635 231
158 3300006881 Ga0068865_100092170 Ga0068865_1000921702 231
159 3300006931 Ga0097620_100072797 Ga0097620_1000727972 231
160 3300009011 Ga0105251_10004489 Ga0105251_1000448912 231
161 3300009148 Ga0105243_10093986 Ga0105243_100939862 231
162 3300009174 Ga0105241_10096556 Ga0105241_100965562 231
163 3300009177 Ga0105248_10002100 Ga0105248_100021005 231
164 3300009177 Ga0105248_10022015 Ga0105248_100220157 231
165 3300009553 Ga0105249_10002812 Ga0105249_100028124 231
166 3300010375 Ga0105239_10162874 Ga0105239_101628742 231
167 3300011119 Ga0105246_10328663 Ga0105246_103286632 231
168 3300013102 Ga0157371_10257684 Ga0157371_102576842 231
169 3300013296 Ga0157374_10149918 Ga0157374_101499184 231
170 3300013306 Ga0163162_10211463 Ga0163162_102114632 231
171 3300013307 Ga0157372_10632635 Ga0157372_106326352 231
172 3300013308 Ga0157375_10148081 Ga0157375_101480812 231
173 3300013308 Ga0157375_11336511 Ga0157375_113365111 231
174 3300014326 Ga0157380_10115132 Ga0157380_101151324 231
175 3300025893 Ga0207682_10065383 Ga0207682_100653832 231
176 3300025904 Ga0207647_10000575 Ga0207647_1000057520 231
177 3300025907 Ga0207645_10116989 Ga0207645_101169892 231
178 3300025909 Ga0207705_10144431 Ga0207705_101444312 231
179 3300025919 Ga0207657_10118924 Ga0207657_101189241 231
180 3300025920 Ga0207649_10070991 Ga0207649_100709912 231
181 3300025920 Ga0207649_10765783 Ga0207649_107657831 231
182 3300025923 Ga0207681_10018082 Ga0207681_100180824 231
183 3300025923 Ga0207681_10212019 Ga0207681_102120192 231
184 3300025925 Ga0207650_10001934 Ga0207650_1000193414 231
185 3300025925 Ga0207650_10122154 Ga0207650_101221544 231
186 3300025926 Ga0207659_10185375 Ga0207659_101853752 231
187 3300025931 Ga0207644_10000941 Ga0207644_1000094112 231
188 3300025932 Ga0207690_10004613 Ga0207690_100046133 231
189 3300025932 Ga0207690_10080295 Ga0207690_100802954 231
190 3300025933 Ga0207706_10005399 Ga0207706_100053997 231
191 3300025933 Ga0207706_10018353 Ga0207706_100183537 231
192 3300025937 Ga0207669_10139914 Ga0207669_101399142 231
193 3300025940 Ga0207691_10009536 Ga0207691_100095367 231
194 3300025941 Ga0207711_10151553 Ga0207711_101515533 231
195 3300025949 Ga0207667_10138723 Ga0207667_101387232 231
196 3300025960 Ga0207651_10001423 Ga0207651_100014233 231
197 3300025961 Ga0207712_10000269 Ga0207712_1000026931 231
198 3300025972 Ga0207668_10152688 Ga0207668_101526882 231
199 3300025972 Ga0207668_10590578 Ga0207668_105905781 231
200 3300026035 Ga0207703_10077560 Ga0207703_100775603 231
201 3300026041 Ga0207639_10250311 Ga0207639_102503112 231
202 3300026067 Ga0207678_10421385 Ga0207678_104213851 231
203 3300026067 Ga0207678_10446131 Ga0207678_104461312 231
204 3300026088 Ga0207641_10551206 Ga0207641_105512062 231
205 3300026121 Ga0207683_10269676 Ga0207683_102696762 231
206 3300028380 Ga0268265_10037750 Ga0268265_100377504 231
207 3300028380 Ga0268265_10102362 Ga0268265_101023622 231
208 3300028381 Ga0268264_10000567 Ga0268264_1000056737 231
209 3300031616 Ga0307508_10134225 Ga0307508_101342254 231
210 3300031852 Ga0307410_10048191 Ga0307410_100481913 231
211 3300032002 Ga0307416_100011585 Ga0307416_1000115857 231
212 3300032002 Ga0307416_100874145 Ga0307416_1008741451 231
213 3300032004 Ga0307414_10730045 Ga0307414_107300451 231
214 3300032005 Ga0307411_10002493 Ga0307411_100024936 231
215 3300035121 Ga0373960_0103709 Ga0373960_0103709_85_798 231
216 3300037471 Ga0395905_0141921 Ga0395905_0141921_352_1071 231
217 3300042006 Ga0439432_049892 Ga0439432_049892_56_760 231
218 3300044765 Ga0466970_0027706 Ga0466970_0027706_224_937 231
219 3300044901 Ga0466960_0079432 Ga0466960_0079432_207_920 231
220 3300045976 Ga0466967_0607144 Ga0466967_0607144_119_829 231
221 3300046459 Ga0495629_0319147 Ga0495629_0319147_314_1027 231
222 3300046512 Ga0495610_0006022 Ga0495610_0006022_4648_5397 231
223 3300046684 Ga0495669_0004792 Ga0495669_0004792_1054_1764 231
224 3300048903 Ga0496100_0421670 Ga0496100_0421670_206_919 231
225 3300048905 Ga0496102_0336463 Ga0496102_0336463_519_1229 231
226 3300048910 Ga0496107_0169740 Ga0496107_0169740_800_1510 231
227 3300048912 Ga0496109_0153130 Ga0496109_0153130_69_779 231
228 3300048914 Ga0496111_0009804 Ga0496111_0009804_548_1258 231
229 3300048917 Ga0496114_0026523 Ga0496114_0026523_1029_1739 231
230 3300048919 Ga0496116_0025398 Ga0496116_0025398_311_1021 231
231 3300048920 Ga0496117_0173712 Ga0496117_0173712_110_820 231
232 3300048921 Ga0496118_0021880 Ga0496118_0021880_4572_5282 231
233 3300048924 Ga0496121_0007837 Ga0496121_0007837_2827_3537 231
234 3300048925 Ga0496122_0159639 Ga0496122_0159639_179_889 231
235 3300048927 Ga0496124_0180594 Ga0496124_0180594_169_879 231
236 3300048928 Ga0496125_0012034 Ga0496125_0012034_710_1420 231
237 3300050515 nmdc:mga0a205_6246_c1 nmdc:mga0a205_6246_c1_9437_10150 231
238 3300005364 Ga0070673_100562920 Ga0070673_1005629201 232
239 3300025931 Ga0207644_10204330 Ga0207644_102043303 232
240 3300025960 Ga0207651_10403870 Ga0207651_104038701 232
241 3300048919 Ga0496116_0000045 Ga0496116_0000045_248793_249551 232
242 3300048925 Ga0496122_0121277 Ga0496122_0121277_840_1598 232
243 3300005347 Ga0070668_100002363 Ga0070668_1000023634 233
244 3300025972 Ga0207668_10003524 Ga0207668_100035247 233
245 3300045051 Ga0451576_0210744 Ga0451576_0210744_633_1343 233
246 iso_pu_bacteria 2643221560 2643821903 233
247 iso_pu_bacteria 2643221563 2643835329 233
248 iso_pu_bacteria 2643221608 2644056255 233
249 iso_pu_bacteria 2852653556 2852654912 233
250 iso_pu_bacteria 2852680915 2852684370 233
251 3300046692 Ga0495671_0015916 Ga0495671_0015916_1290_2012 234
252 iso_pu_bacteria 2896184354 2896185344 235
253 3300003781 Ga0055536_1002827 Ga0055536_10028275 236
254 3300003781 Ga0055536_1009652 Ga0055536_10096523 236
255 3300003791 Ga0055530_10000203 Ga0055530_1000020338 236
256 3300003794 Ga0055531_10005851 Ga0055531_100058515 236
257 3300005367 Ga0070667_100027459 Ga0070667_1000274595 236
258 3300005548 Ga0070665_100051741 Ga0070665_1000517413 236
259 3300005617 Ga0068859_100486573 Ga0068859_1004865732 236
260 3300005841 Ga0068863_100000106 Ga0068863_10000010691 236
261 3300005843 Ga0068860_100000187 Ga0068860_10000018778 236
262 3300006353 Ga0075370_10000139 Ga0075370_1000013918 236
263 3300006931 Ga0097620_100486587 Ga0097620_1004865872 236
264 3300009177 Ga0105248_10113775 Ga0105248_101137754 236
265 3300025291 Ga0209675_1000399 Ga0209675_100039926 236
266 3300025292 Ga0209676_1000358 Ga0209676_100035827 236
267 3300025292 Ga0209676_1000829 Ga0209676_100082922 236
268 3300025292 Ga0209676_1034795 Ga0209676_10347952 236
269 3300025294 Ga0209025_1013690 Ga0209025_10136905 236
270 3300025294 Ga0209025_1090701 Ga0209025_10907012 236
271 3300025298 Ga0209050_1000437 Ga0209050_100043733 236
272 3300025298 Ga0209050_1004189 Ga0209050_100418914 236
273 3300025304 Ga0209257_1000328 Ga0209257_100032824 236
274 3300025304 Ga0209257_1002217 Ga0209257_100221727 236
275 3300025304 Ga0209257_1006957 Ga0209257_10069577 236
276 3300025304 Ga0209257_1047813 Ga0209257_10478132 236
277 3300025986 Ga0207658_10002259 Ga0207658_100022591 236
278 3300026035 Ga0207703_10035817 Ga0207703_100358172 236
279 3300026088 Ga0207641_10001210 Ga0207641_1000121019 236
280 3300026095 Ga0207676_10012528 Ga0207676_100125285 236
281 3300028379 Ga0268266_10008594 Ga0268266_100085945 236
282 3300028381 Ga0268264_10000040 Ga0268264_10000040295 236
283 3300031911 Ga0307412_10026753 Ga0307412_100267534 236
284 3300032004 Ga0307414_10001714 Ga0307414_1000171416 236
285 3300032004 Ga0307414_10019979 Ga0307414_100199795 236
286 3300032004 Ga0307414_10034726 Ga0307414_100347264 236
287 3300035114 Ga0373939_0033454 Ga0373939_0033454_547_1263 236
288 3300046522 Ga0495643_0033647 Ga0495643_0033647_2070_2795 236
289 3300046616 Ga0495668_0000387 Ga0495668_0000387_26101_26832 236
290 3300046660 Ga0495625_0002985 Ga0495625_0002985_12758_13483 236
291 3300048907 Ga0496104_0058606 Ga0496104_0058606_2179_3039 236
292 3300048908 Ga0496105_0009657 Ga0496105_0009657_3579_4439 236
293 3300048922 Ga0496119_0204430 Ga0496119_0204430_191_928 236
294 3300048924 Ga0496121_0088818 Ga0496121_0088818_751_1488 236
295 3300049569 Ga0501032_0035085 Ga0501032_0035085_1531_2262 236
296 3300049570 Ga0501033_0013859 Ga0501033_0013859_3686_4417 236
297 3300049571 Ga0501034_0054767 Ga0501034_0054767_1218_1949 236
298 3300049574 Ga0501038_0016042 Ga0501038_0016042_2174_2905 236
299 3300049575 Ga0501039_0026008 Ga0501039_0026008_2783_3514 236
300 3300049579 Ga0501043_0101072 Ga0501043_0101072_1221_1952 236
301 3300049581 Ga0501047_0541017 Ga0501047_0541017_181_912 236
302 3300049822 Ga0501035_0320448 Ga0501035_0320448_79_810 236
303 3300049824 Ga0501045_0294866 Ga0501045_0294866_460_1191 236
304 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_66547_67263 236
305 3300053116 Ga0500592_010740 Ga0500592_010740_227_952 236
306 3300053139 Ga0500568_0003154 Ga0500568_0003154_8379_9104 236
307 3300053158 Ga0500627_0000056 Ga0500627_0000056_32878_33603 236
308 3300025292 Ga0209676_1001005 Ga0209676_100100511 237
309 3300053134 Ga0500658_0008071 Ga0500658_0008071_2746_3483 237
310 iso_pu_bacteria 2739367664 2739649218 237
311 iso_pu_bacteria 2739367865 2740027691 237
312 iso_pu_bacteria 8054302542 8054305362 237
313 3300005843 Ga0068860_100825862 Ga0068860_1008258621 238
314 3300006195 Ga0075366_10003089 Ga0075366_100030898 238
315 3300027665 Ga0209983_1010464 Ga0209983_10104642 238
316 3300028381 Ga0268264_10738327 Ga0268264_107383271 238
317 3300045051 Ga0451576_0000007 Ga0451576_0000007_633379_634116 238
318 3300050493 nmdc:mga0k408_15552_c1 nmdc:mga0k408_15552_c1_3078_3803 238
319 iso_pu_bacteria 2882806704 2882807640 238
320 3300006038 Ga0075365_10006663 Ga0075365_100066633 239
321 3300006042 Ga0075368_10000197 Ga0075368_100001976 239
322 3300006048 Ga0075363_100006937 Ga0075363_1000069373 239
323 3300006177 Ga0075362_10003545 Ga0075362_100035453 239
324 3300006178 Ga0075367_10003387 Ga0075367_100033875 239
325 3300006186 Ga0075369_10009990 Ga0075369_100099906 239
326 3300006195 Ga0075366_10003942 Ga0075366_100039424 239
327 3300006353 Ga0075370_10004676 Ga0075370_100046766 239
328 3300027866 Ga0209813_10000081 Ga0209813_1000008131 239
329 3300048929 Ga0496126_0055365 Ga0496126_0055365_1381_2115 239
330 3300050489 nmdc:mga03683_5814_c1 nmdc:mga03683_5814_c1_1688_2413 239
331 3300050490 nmdc:mga03n38_192355_c1 nmdc:mga03n38_192355_c1_221_946 239
332 3300050494 nmdc:mga06z11_904_c1 nmdc:mga06z11_904_c1_232_957 239
333 3300050495 nmdc:mga04h51_172_c1 nmdc:mga04h51_172_c1_11976_12701 239
334 3300050496 nmdc:mga07m45_15_c1 nmdc:mga07m45_15_c1_37747_38472 239
335 3300050516 nmdc:mga0sz30_4999_c1 nmdc:mga0sz30_4999_c1_1736_2461 239
336 3300053121 Ga0500607_001731 Ga0500607_001731_5335_6060 239
337 3300053730 Ga0500645_002886 Ga0500645_002886_962_1735 239
338 3300005295 Ga0065707_10102680 Ga0065707_101026803 240
339 3300005347 Ga0070668_100389975 Ga0070668_1003899752 240
340 3300005440 Ga0070705_100073046 Ga0070705_1000730461 240
341 3300005843 Ga0068860_100079954 Ga0068860_1000799542 240
342 3300006177 Ga0075362_10034006 Ga0075362_100340061 240
343 3300006186 Ga0075369_10075019 Ga0075369_100750192 240
344 3300006353 Ga0075370_10029090 Ga0075370_100290903 240
345 3300014326 Ga0157380_10083655 Ga0157380_100836552 240
346 3300014326 Ga0157380_10740730 Ga0157380_107407302 240
347 3300025972 Ga0207668_10168996 Ga0207668_101689962 240
348 3300026142 Ga0207698_10273230 Ga0207698_102732302 240
349 3300032002 Ga0307416_100365342 Ga0307416_1003653422 240
350 3300032005 Ga0307411_10473485 Ga0307411_104734852 240
351 3300036712 Ga0316584_0040702 Ga0316584_0040702_962_1696 240
352 3300046616 Ga0495668_0299394 Ga0495668_0299394_75_803 240
353 3300050489 nmdc:mga03683_28065_c1 nmdc:mga03683_28065_c1_106_834 240
354 3300050496 nmdc:mga07m45_28076_c1 nmdc:mga07m45_28076_c1_1304_2032 240
355 3300050516 nmdc:mga0sz30_70114_c1 nmdc:mga0sz30_70114_c1_338_1066 240
356 3300053087 Ga0500643_000001 Ga0500643_000001_559453_560181 240
357 3300053121 Ga0500607_000107 Ga0500607_000107_49621_50349 240
358 3300053136 Ga0500559_0000616 Ga0500559_0000616_20535_21263 240
359 3300053136 Ga0500559_0003627 Ga0500559_0003627_2554_3282 240
360 3300053178 Ga0500637_0000400 Ga0500637_0000400_14143_14871 240
361 3300053730 Ga0500645_008480 Ga0500645_008480_976_1704 240
362 iso_pu_bacteria 2738541275 2738711604 240
363 iso_pu_bacteria 2738541301 2738850029 240
364 iso_pu_bacteria 2738541304 2738865758 240
365 iso_pu_bacteria 2738543022 2739298276 240
366 iso_pu_bacteria 2738543033 2739359954 240
367 iso_pu_bacteria 2928100450 2928103759 240
368 iso_pu_bacteria 2928959182 2928961687 240
369 3300005289 Ga0065704_10079454 Ga0065704_100794544 241
370 3300005331 Ga0070670_100236985 Ga0070670_1002369852 241
371 3300005335 Ga0070666_10252771 Ga0070666_102527712 241
372 3300005347 Ga0070668_100002440 Ga0070668_10000244014 241
373 3300005353 Ga0070669_100002206 Ga0070669_10000220614 241
374 3300005355 Ga0070671_100002891 Ga0070671_1000028911 241
375 3300005367 Ga0070667_100001888 Ga0070667_10000188822 241
376 3300005548 Ga0070665_100001012 Ga0070665_10000101211 241
377 3300005841 Ga0068863_100005101 Ga0068863_1000051015 241
378 3300005841 Ga0068863_100018487 Ga0068863_1000184876 241
379 3300005844 Ga0068862_100005927 Ga0068862_10000592712 241
380 3300005844 Ga0068862_100022859 Ga0068862_1000228596 241
381 3300006195 Ga0075366_10027754 Ga0075366_100277542 241
382 3300006353 Ga0075370_10005075 Ga0075370_100050756 241
383 3300006353 Ga0075370_10348793 Ga0075370_103487931 241
384 3300006946 Ga0079104_1010239 Ga0079104_10102393 241
385 3300013102 Ga0157371_10115133 Ga0157371_101151333 241
386 3300013306 Ga0163162_10182817 Ga0163162_101828172 241
387 3300017792 Ga0163161_10001748 Ga0163161_1000174813 241
388 3300025903 Ga0207680_10247773 Ga0207680_102477732 241
389 3300025931 Ga0207644_10000293 Ga0207644_1000029334 241
390 3300025941 Ga0207711_10158897 Ga0207711_101588973 241
391 3300025972 Ga0207668_10039424 Ga0207668_100394243 241
392 3300025986 Ga0207658_10006559 Ga0207658_100065594 241
393 3300025986 Ga0207658_10025817 Ga0207658_100258172 241
394 3300026035 Ga0207703_10058604 Ga0207703_100586043 241
395 3300026088 Ga0207641_10006329 Ga0207641_100063297 241
396 3300026088 Ga0207641_10170609 Ga0207641_101706092 241
397 3300028379 Ga0268266_10000471 Ga0268266_1000047110 241
398 3300028380 Ga0268265_10011459 Ga0268265_100114597 241
399 3300028380 Ga0268265_10029976 Ga0268265_100299763 241
400 3300028381 Ga0268264_10005153 Ga0268264_1000515310 241
401 3300031548 Ga0307408_100100768 Ga0307408_1001007682 241
402 3300031903 Ga0307407_10050367 Ga0307407_100503672 241
403 3300031911 Ga0307412_10172315 Ga0307412_101723152 241
404 3300031911 Ga0307412_10230016 Ga0307412_102300162 241
405 3300031911 Ga0307412_10444660 Ga0307412_104446602 241
406 3300032002 Ga0307416_100070012 Ga0307416_1000700122 241
407 3300046460 Ga0495638_0024309 Ga0495638_0024309_71_817 241
408 3300046500 Ga0495596_0013766 Ga0495596_0013766_212_958 241
409 3300046507 Ga0495606_0032783 Ga0495606_0032783_190_936 241
410 3300046512 Ga0495610_0001956 Ga0495610_0001956_4837_5583 241
411 3300046530 Ga0495654_0030907 Ga0495654_0030907_1810_2556 241
412 3300046660 Ga0495625_0012965 Ga0495625_0012965_2598_3344 241
413 3300048090 Ga0495615_0000060 Ga0495615_0000060_2650_3399 241
414 3300048091 Ga0495626_0000877 Ga0495626_0000877_12116_12862 241
415 3300048922 Ga0496119_0222145 Ga0496119_0222145_16_756 241
416 3300048925 Ga0496122_0009937 Ga0496122_0009937_7001_7750 241
417 3300048925 Ga0496122_0313799 Ga0496122_0313799_79_825 241
418 3300048926 Ga0496123_0001112 Ga0496123_0001112_2595_3344 241
419 3300049823 Ga0501044_0167494 Ga0501044_0167494_47_808 241
420 3300050493 nmdc:mga0k408_25019_c1 nmdc:mga0k408_25019_c1_862_1620 241
421 3300050496 nmdc:mga07m45_2225_c1 nmdc:mga07m45_2225_c1_6273_7007 241
422 3300053091 Ga0500647_0063783 Ga0500647_0063783_80_820 241
423 3300053122 Ga0500608_000363 Ga0500608_000363_11685_12425 241
424 3300053123 Ga0500614_010208 Ga0500614_010208_1190_1930 241
425 3300053138 Ga0500564_003611 Ga0500564_003611_3568_4308 241
426 3300053138 Ga0500564_062972 Ga0500564_062972_786_1526 241
427 3300053140 Ga0500573_0049365 Ga0500573_0049365_182_922 241
428 3300053153 Ga0500616_0005069 Ga0500616_0005069_8338_9069 241
429 3300053154 Ga0500619_079542 Ga0500619_079542_95_835 241
430 3300053156 Ga0500622_0000283 Ga0500622_0000283_2577_3311 241
431 3300053156 Ga0500622_0123517 Ga0500622_0123517_156_896 241
432 3300053723 Ga0500567_001935 Ga0500567_001935_6670_7410 241
433 3300053729 Ga0500625_000019 Ga0500625_000019_54219_54959 241
434 3300005842 Ga0068858_100049017 Ga0068858_1000490174 242
435 3300005843 Ga0068860_100443948 Ga0068860_1004439482 242
436 3300009177 Ga0105248_10254077 Ga0105248_102540774 242
437 3300013306 Ga0163162_10017371 Ga0163162_100173716 242
438 3300025941 Ga0207711_10429763 Ga0207711_104297632 242
439 3300026035 Ga0207703_10072667 Ga0207703_100726673 242
440 3300031731 Ga0307405_10015786 Ga0307405_100157862 242
441 3300049573 Ga0501037_0206973 Ga0501037_0206973_309_1052 242
442 3300006051 Ga0075364_10405136 Ga0075364_104051361 243
443 3300031731 Ga0307405_10082147 Ga0307405_100821473 243
444 3300032005 Ga0307411_10084042 Ga0307411_100840422 243
445 3300049823 Ga0501044_0004367 Ga0501044_0004367_4064_4810 243
446 2162886007 SwRhRL2b_contig_2557718 SwRhRL2b_0324.00000910 244
447 3300005289 Ga0065704_10080702 Ga0065704_100807025 244
448 3300005335 Ga0070666_10434015 Ga0070666_104340152 244
449 3300005353 Ga0070669_100000193 Ga0070669_10000019327 244
450 3300005355 Ga0070671_100009970 Ga0070671_1000099706 244
451 3300005367 Ga0070667_100125868 Ga0070667_1001258681 244
452 3300005548 Ga0070665_100028368 Ga0070665_1000283684 244
453 3300005844 Ga0068862_100017716 Ga0068862_1000177163 244
454 3300009177 Ga0105248_10183452 Ga0105248_101834522 244
455 3300013306 Ga0163162_10614862 Ga0163162_106148622 244
456 3300025711 Ga0207696_1005679 Ga0207696_10056793 244
457 3300025903 Ga0207680_10392310 Ga0207680_103923101 244
458 3300025923 Ga0207681_10000176 Ga0207681_1000017626 244
459 3300025931 Ga0207644_10002537 Ga0207644_100025376 244
460 3300025986 Ga0207658_10002285 Ga0207658_100022859 244
461 3300028379 Ga0268266_10023067 Ga0268266_100230674 244
462 3300048903 Ga0496100_0061192 Ga0496100_0061192_1683_2417 244
463 3300048905 Ga0496102_0000445 Ga0496102_0000445_116_850 244
464 3300048906 Ga0496103_0000021 Ga0496103_0000021_81697_82431 244
465 3300048907 Ga0496104_0000131 Ga0496104_0000131_25989_26723 244
466 3300048908 Ga0496105_0000111 Ga0496105_0000111_23788_24522 244
467 3300048916 Ga0496113_0001810 Ga0496113_0001810_104_838 244
468 3300048921 Ga0496118_0082580 Ga0496118_0082580_1218_1952 244
469 3300048922 Ga0496119_0000339 Ga0496119_0000339_36666_37400 244
470 3300048923 Ga0496120_0000334 Ga0496120_0000334_21401_22135 244
471 3300048925 Ga0496122_0001206 Ga0496122_0001206_6658_7392 244
472 3300048926 Ga0496123_0000367 Ga0496123_0000367_58736_59470 244
473 3300048927 Ga0496124_0303972 Ga0496124_0303972_173_907 244
474 3300048928 Ga0496125_0011446 Ga0496125_0011446_1436_2170 244
475 3300048929 Ga0496126_0000367 Ga0496126_0000367_140_874 244
476 3300053148 Ga0500590_007500 Ga0500590_007500_937_1764 244

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gah-assembly1.cif.gz_A heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution 0.8443 8 101
1vrq-assembly1.cif.gz_A crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid 0.8346 2 101
6qe4-assembly1.cif.gz_A re-refinement of 5oli human iba57-i3c 0.8052 2 237
7z3h-assembly6.cif.gz_F crystal structure of iba57 from chaetomium thermophilum 0.7994 2 232
6geu-assembly1.cif.gz_A crystal structure of the c230a mutant of human iba57 0.799 2 237
ID Description Score Start End Superfamily
1vlyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8919 10 96 3.30.70.1400
af_G5EE11_2_112_3.30.70.1400 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8818 1 96 3.30.70.1400
4paaA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8692 10 95 3.30.70.1400
1vlyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8626 10 96 3.30.70.1400
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8625 9 94 3.30.70.1400
ID Description Score Start End GO Terms
AF-A0A259HZG2-F1-model_v4 Folate-binding protein YgfZ 0.9922 5 132 GO:0016226
AF-A0A2E7M0F3-F1-model_v4 deleted 0.9819 1 167
AF-A0A259JWF2-F1-model_v4 Folate-binding protein YgfZ 0.9814 1 174 GO:0016226
AF-A0A2E7M0F3-F1-model_v4 deleted 0.9761 1 167
AF-A0A350KRA4-F1-model_v4 deleted 0.9724 1 105

Feature Viewer

pLDDT pTM Quality
91.7 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map