F451486

General Info

Members Datasets Scaffolds Average Seq Length
476 283 475 254

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100054784|Ga0070661_1000547842
Length 312
Sequence VEISNGLGNEPTARADVVICSLLLVVVRTGSSAALPENYISTDVSRGTGPVRAPTIAAMTNDGGGRAVLVTGASRGIGAAVARAFAEAGDRVAVHHGRNAEKARAVAAALPGDGHAVVGADLADPDAVRAMVDEAAERLGGLDVLVNNAGIFEPHPIAETTYEEWQKGWRDTLGVNLVGAANVTWCAVRHMLRAGGGRIVNVSSRGAFRGEPAQPAYGASKAGLIAFGQSLARDLGPHGITVAAVAPGFTETDMAAEALSGERGAARRAESPLGRVATPDEVAAAVVFLASPGATMATGAVLDVNGASYLRM

Samples

Sample ID Description Type Environment
1 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
161 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
162 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
275 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.63
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 7.35
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1005612 3300002741 Bacteria 2017
2 JGI25406J46586_10011734 3300003203 Bacteria 3827
3 JGI25407J50210_10008220 3300003373 Bacteria 2630
4 Ga0070683_100056689 3300005329 Bacteria 3639
5 Ga0070683_100296887 3300005329 Bacteria 1537
6 Ga0070682_100101365 3300005337 Bacteria 1901
7 Ga0070682_100226560 3300005337 Bacteria 1334
8 Ga0068868_100006099 3300005338 Bacteria 8515
9 Ga0070660_100411193 3300005339 Bacteria 1119
10 Ga0070689_100073628 3300005340 Bacteria 2672
11 Ga0070661_100054784 3300005344 Bacteria 2921
12 Ga0070668_100504071 3300005347 Bacteria 1048
13 Ga0070659_100016315 3300005366 Bacteria 5575
14 Ga0070659_100209020 3300005366 Bacteria 1608
15 Ga0070659_100344270 3300005366 Bacteria 1250
16 Ga0070714_100009950 3300005435 Bacteria 7500
17 Ga0070710_10001048 3300005437 Bacteria 13127
18 Ga0070710_10028091 3300005437 Bacteria 3006
19 Ga0070710_10037423 3300005437 Bacteria 2659
20 Ga0070701_10030467 3300005438 Bacteria 2669
21 Ga0070711_100016189 3300005439 Bacteria 4732
22 Ga0070700_100070983 3300005441 Bacteria 2222
23 Ga0070694_100195488 3300005444 Bacteria 1505
24 Ga0070663_100489160 3300005455 Bacteria 1020
25 Ga0070685_10039128 3300005466 Bacteria 2692
26 Ga0070706_100030490 3300005467 Bacteria 4970
27 Ga0070707_100000043 3300005468 Bacteria 108893
28 Ga0070707_100504379 3300005468 Bacteria 1172
29 Ga0070698_100020025 3300005471 Bacteria 7014
30 Ga0070698_100082246 3300005471 Bacteria 3212
31 Ga0070698_100140113 3300005471 Bacteria 2370
32 Ga0070699_100145332 3300005518 Bacteria 2095
33 Ga0070684_100113090 3300005535 Bacteria 2436
34 Ga0070684_100155038 3300005535 Bacteria 2077
35 Ga0070693_100371922 3300005547 Bacteria 983
36 Ga0070704_100129265 3300005549 Bacteria 1955
37 Ga0070664_100121713 3300005564 Bacteria 2285
38 Ga0068857_100075949 3300005577 Bacteria 2995
39 Ga0068857_100186867 3300005577 Bacteria 1887
40 Ga0068854_100463362 3300005578 Bacteria 1061
41 Ga0068856_100003242 3300005614 Bacteria 16561
42 Ga0068856_100073333 3300005614 Bacteria 3389
43 Ga0070702_100040267 3300005615 Bacteria 2613
44 Ga0070702_100083148 3300005615 Bacteria 1922
45 Ga0068852_100059456 3300005616 Bacteria 3314
46 Ga0068859_100029201 3300005617 Bacteria 5534
47 Ga0068859_100844714 3300005617 Bacteria 1002
48 Ga0068861_100018838 3300005719 Bacteria 4921
49 Ga0068861_100059745 3300005719 Bacteria 2920
50 Ga0068861_100062319 3300005719 Bacteria 2864
51 Ga0068870_10100624 3300005840 Bacteria 1633
52 Ga0068862_100007874 3300005844 Bacteria 8816
53 Ga0068862_100041138 3300005844 Bacteria 3932
54 Ga0081455_10007254 3300005937 Bacteria 11703
55 Ga0081455_10015298 3300005937 Bacteria 7461
56 Ga0081455_10269554 3300005937 Bacteria 1236
57 Ga0081538_10000370 3300005981 Bacteria 51234
58 Ga0081538_10001449 3300005981 Bacteria 24381
59 Ga0081538_10009867 3300005981 Bacteria 7896
60 Ga0081538_10010977 3300005981 Bacteria 7376
61 Ga0081538_10024438 3300005981 Bacteria 4303
62 Ga0081538_10101116 3300005981 Bacteria 1451
63 Ga0081538_10117155 3300005981 Bacteria 1290
64 Ga0081540_1012006 3300005983 Bacteria 5737
65 Ga0081540_1081069 3300005983 Bacteria 1460
66 Ga0081539_10006982 3300005985 Bacteria 10487
67 Ga0081539_10007364 3300005985 Bacteria 10068
68 Ga0081539_10016163 3300005985 Bacteria 5357
69 Ga0081539_10023480 3300005985 Bacteria 4040
70 Ga0081539_10033570 3300005985 Bacteria 3122
71 Ga0081539_10046459 3300005985 Bacteria 2488
72 Ga0081539_10083752 3300005985 Bacteria 1669
73 Ga0081539_10091854 3300005985 Bacteria 1567
74 Ga0070717_10127341 3300006028 Bacteria 2187
75 Ga0070717_10309120 3300006028 Bacteria 1406
76 Ga0070715_10012575 3300006163 Bacteria 3085
77 Ga0070715_10015336 3300006163 Bacteria 2855
78 Ga0070715_10163312 3300006163 Bacteria 1102
79 Ga0070716_100003927 3300006173 Bacteria 7055
80 Ga0070716_100050126 3300006173 Bacteria 2368
81 Ga0070712_100005496 3300006175 Bacteria 7847
82 Ga0070712_100260512 3300006175 Bacteria 1389
83 Ga0075366_10000062 3300006195 Bacteria 39833
84 Ga0075366_10117635 3300006195 Bacteria 1601
85 Ga0075428_100008866 3300006844 Bacteria 11157
86 Ga0075428_100178099 3300006844 Bacteria 2302
87 Ga0075430_100047266 3300006846 Bacteria 3633
88 Ga0075430_100092523 3300006846 Bacteria 2528
89 Ga0075431_100001557 3300006847 Bacteria 21285
90 Ga0075431_100078557 3300006847 Bacteria 3406
91 Ga0075431_100277879 3300006847 Bacteria 1696
92 Ga0075431_100651709 3300006847 Bacteria 1033
93 Ga0075433_10100698 3300006852 Bacteria 2558
94 Ga0075433_10240616 3300006852 Bacteria 1607
95 Ga0075433_10429057 3300006852 Bacteria 1165
96 Ga0075434_100128416 3300006871 Bacteria 2553
97 Ga0075434_100173562 3300006871 Bacteria 2176
98 Ga0075429_100013160 3300006880 Bacteria 7177
99 Ga0075429_100264107 3300006880 Bacteria 1507
100 Ga0097620_100029201 3300006931 Bacteria 5534
101 Ga0097620_100844795 3300006931 Bacteria 1002
102 Ga0105240_10974667 3300009093 Bacteria 908
103 Ga0105240_11125679 3300009093 Bacteria 834
104 Ga0111539_10002959 3300009094 Bacteria 22536
105 Ga0111539_10033539 3300009094 Bacteria 6232
106 Ga0111539_10035517 3300009094 Bacteria 6034
107 Ga0111539_10205927 3300009094 Bacteria 2293
108 Ga0114129_10013764 3300009147 Bacteria 11529
109 Ga0114129_10161784 3300009147 Bacteria 3057
110 Ga0105243_10567802 3300009148 Bacteria 1087
111 Ga0105241_10200448 3300009174 Bacteria 1667
112 Ga0105238_10491664 3300009551 Bacteria 1227
113 Ga0105249_10111364 3300009553 Bacteria 2588
114 Ga0157371_10001599 3300013102 Bacteria 23231
115 Ga0157369_10056641 3300013105 Unclassified 4230
116 Ga0157374_10125674 3300013296 Bacteria 2479
117 Ga0157378_10087064 3300013297 Bacteria 2833
118 Ga0163162_10109212 3300013306 Bacteria 2863
119 Ga0157372_10223860 3300013307 Bacteria 2181
120 Ga0157372_10255540 3300013307 Bacteria 2034
121 Ga0157375_10453433 3300013308 Bacteria 1448
122 Ga0163163_10212469 3300014325 Bacteria 1984
123 Ga0206354_11182079 3300020081 Bacteria 1315
124 Ga0206353_10709762 3300020082 Bacteria 2785
125 Ga0206353_10713231 3300020082 Bacteria 2247
126 Ga0209026_1000993 3300025250 Bacteria 14098
127 Ga0209026_1003598 3300025250 Bacteria 4990
128 Ga0207692_10030304 3300025898 Bacteria 2579
129 Ga0207710_10085244 3300025900 Bacteria 1471
130 Ga0207688_10016342 3300025901 Bacteria 4025
131 Ga0207685_10002860 3300025905 Bacteria 4066
132 Ga0207699_10002722 3300025906 Bacteria 8357
133 Ga0207699_10006974 3300025906 Bacteria 5502
134 Ga0207643_10015338 3300025908 Bacteria 4171
135 Ga0207684_10054175 3300025910 Bacteria 3403
136 Ga0207693_10001968 3300025915 Bacteria 18005
137 Ga0207693_10584374 3300025915 Bacteria 870
138 Ga0207663_10013891 3300025916 Bacteria 4392
139 Ga0207660_10233517 3300025917 Bacteria 1447
140 Ga0207646_10041191 3300025922 Bacteria 4153
141 Ga0207650_10240763 3300025925 Bacteria 1462
142 Ga0207664_10048274 3300025929 Bacteria 3347
143 Ga0207664_10072328 3300025929 Bacteria 2780
144 Ga0207644_10143231 3300025931 Bacteria 1843
145 Ga0207709_10249157 3300025935 Bacteria 1296
146 Ga0207670_10121704 3300025936 Bacteria 1898
147 Ga0207669_10166665 3300025937 Bacteria 1563
148 Ga0207704_10052787 3300025938 Bacteria 2466
149 Ga0207665_10003371 3300025939 Bacteria 10698
150 Ga0207689_10108304 3300025942 Bacteria 2283
151 Ga0207661_10130388 3300025944 Bacteria 2153
152 Ga0207712_10130420 3300025961 Bacteria 1915
153 Ga0207668_10125194 3300025972 Bacteria 1953
154 Ga0207677_10162933 3300026023 Bacteria 1735
155 Ga0207678_10215941 3300026067 Bacteria 1641
156 Ga0207708_10025533 3300026075 Bacteria 4471
157 Ga0207708_10097498 3300026075 Bacteria 2272
158 Ga0207702_10244860 3300026078 Bacteria 1681
159 Ga0207641_10366447 3300026088 Bacteria 1377
160 Ga0207648_10050363 3300026089 Bacteria 3642
161 Ga0207676_10392403 3300026095 Bacteria 1295
162 Ga0207674_10115266 3300026116 Bacteria 2659
163 Ga0207674_10214317 3300026116 Bacteria 1874
164 Ga0207675_100031587 3300026118 Bacteria 4933
165 Ga0207675_100117968 3300026118 Bacteria 2509
166 Ga0207683_10054921 3300026121 Bacteria 3493
167 Ga0207683_10209051 3300026121 Bacteria 1776
168 Ga0207428_10001857 3300027907 Bacteria 21562
169 Ga0207428_10002935 3300027907 Bacteria 16896
170 Ga0207428_10008457 3300027907 Bacteria 9292
171 Ga0268265_10081817 3300028380 Bacteria 2551
172 Ga0265318_10004322 3300028577 Bacteria 6906
173 Ga0265323_10014707 3300028653 Bacteria 3089
174 Ga0265323_10016933 3300028653 Bacteria 2838
175 Ga0265322_10010386 3300028654 Bacteria 2699
176 Ga0265336_10014411 3300028666 Bacteria 2621
177 Ga0307515_10000430 3300028794 Bacteria 101168
178 Ga0307515_10000910 3300028794 Bacteria 68112
179 Ga0265330_10016065 3300031235 Bacteria 3458
180 Ga0265332_10114637 3300031238 Bacteria 1134
181 Ga0265320_10006459 3300031240 Bacteria 7388
182 Ga0265331_10074420 3300031250 Bacteria 1585
183 Ga0265316_10021189 3300031344 Bacteria 5513
184 Ga0265316_10074555 3300031344 Bacteria 2611
185 Ga0265316_10217631 3300031344 Bacteria 1410
186 Ga0307408_100247535 3300031548 Bacteria 1468
187 Ga0307408_100425105 3300031548 Bacteria 1147
188 Ga0316579_10008495 3300031691 Bacteria 4284
189 Ga0316579_10171812 3300031691 Bacteria 1048
190 Ga0265342_10036610 3300031712 Bacteria 2997
191 Ga0265342_10042615 3300031712 Bacteria 2741
192 Ga0316576_10066602 3300031727 Bacteria 2649
193 Ga0316576_10132863 3300031727 Bacteria 1873
194 Ga0316578_10007870 3300031728 Bacteria 5382
195 Ga0307405_10020061 3300031731 Bacteria 3727
196 Ga0307405_10026247 3300031731 Bacteria 3358
197 Ga0307405_10091639 3300031731 Bacteria 2014
198 Ga0307405_10648682 3300031731 Bacteria 868
199 Ga0316577_10001065 3300031733 Bacteria 12412
200 Ga0307413_10016398 3300031824 Bacteria 3826
201 Ga0307413_10057090 3300031824 Bacteria 2385
202 Ga0307410_10122104 3300031852 Bacteria 1901
203 Ga0307410_10158245 3300031852 Bacteria 1694
204 Ga0307406_10011663 3300031901 Bacteria 4988
205 Ga0307406_10028441 3300031901 Bacteria 3377
206 Ga0307406_10361098 3300031901 Bacteria 1138
207 Ga0307407_10007627 3300031903 Bacteria 4910
208 Ga0307407_10069394 3300031903 Bacteria 2092
209 Ga0307407_10089174 3300031903 Bacteria 1886
210 Ga0307412_10025061 3300031911 Bacteria 3689
211 Ga0307412_10273030 3300031911 Bacteria 1324
212 Ga0307409_100006897 3300031995 Bacteria 6734
213 Ga0307409_100038265 3300031995 Bacteria 3546
214 Ga0307409_100052002 3300031995 Bacteria 3138
215 Ga0307409_100072452 3300031995 Bacteria 2743
216 Ga0307409_100074764 3300031995 Bacteria 2709
217 Ga0307409_100248944 3300031995 Bacteria 1623
218 Ga0307409_100273701 3300031995 Bacteria 1556
219 Ga0307409_100359795 3300031995 Bacteria 1376
220 Ga0307409_100373926 3300031995 Bacteria 1352
221 Ga0307409_100459946 3300031995 Bacteria 1230
222 Ga0307416_100005275 3300032002 Bacteria 7913
223 Ga0307416_100014790 3300032002 Bacteria 5363
224 Ga0307416_100029865 3300032002 Bacteria 4080
225 Ga0307416_100160287 3300032002 Bacteria 2078
226 Ga0307416_100270032 3300032002 Bacteria 1669
227 Ga0307416_100496742 3300032002 Bacteria 1283
228 Ga0307416_100582375 3300032002 Bacteria 1196
229 Ga0307416_100768166 3300032002 Bacteria 1057
230 Ga0307414_10060430 3300032004 Bacteria 2680
231 Ga0307414_10168535 3300032004 Bacteria 1748
232 Ga0307411_10612360 3300032005 Bacteria 938
233 Ga0307415_100011475 3300032126 Bacteria 5073
234 Ga0307415_100012167 3300032126 Bacteria 4966
235 Ga0307415_100012227 3300032126 Bacteria 4956
236 Ga0307415_100032590 3300032126 Bacteria 3371
237 Ga0307415_100069361 3300032126 Bacteria 2472
238 Ga0307415_100162888 3300032126 Bacteria 1731
239 Ga0307415_100207936 3300032126 Bacteria 1559
240 Ga0307415_100237395 3300032126 Bacteria 1472
241 Ga0307415_100242744 3300032126 Bacteria 1458
242 Ga0316583_10019472 3300032133 Bacteria 2436
243 Ga0316583_10057360 3300032133 Bacteria 1368
244 Ga0316585_10027912 3300032137 Bacteria 1764
245 Ga0307507_10007309 3300033179 Bacteria 16152
246 Ga0307510_10036540 3300033180 Bacteria 5465
247 Ga0373930_0008506 3300034816 Bacteria 1797
248 Ga0373934_0081156 3300035086 Bacteria 1303
249 Ga0373952_0038889 3300035092 Bacteria 1091
250 Ga0373939_0002556 3300035114 Bacteria 4277
251 Ga0373956_0045728 3300035119 Bacteria 1954
252 Ga0373957_0199043 3300035120 Bacteria 834
253 Ga0373960_0012234 3300035121 Bacteria 2129
254 Ga0373946_0029358 3300035171 Bacteria 2188
255 Ga0373961_0003398 3300035241 Bacteria 3947
256 Ga0316574_0046038 3300035398 Bacteria 2703
257 Ga0316574_0067001 3300035398 Bacteria 2263
258 Ga0373927_0087271 3300035695 Bacteria 2025
259 Ga0373933_0061685 3300035724 Bacteria 2262
260 Ga0373947_0006881 3300035725 Bacteria 6590
261 Ga0373937_0074554 3300036401 Bacteria 3131
262 Ga0316582_0020120 3300036647 Bacteria 3919
263 Ga0316582_0042895 3300036647 Bacteria 2836
264 Ga0316582_0133937 3300036647 Bacteria 1667
265 Ga0316584_0005243 3300036712 Bacteria 8672
266 Ga0316584_0074225 3300036712 Bacteria 2550
267 Ga0373925_0004845 3300037068 Bacteria 10131
268 Ga0373925_0018871 3300037068 Bacteria 5013
269 Ga0395899_0016540 3300037312 Bacteria 5627
270 Ga0395900_0041499 3300037418 Bacteria 4743
271 Ga0395898_0061564 3300037466 Bacteria 3646
272 Ga0395898_0188753 3300037466 Bacteria 1969
273 Ga0395898_0295366 3300037466 Bacteria 1546
274 Ga0395898_0597084 3300037466 Bacteria 1046
275 Ga0395901_0003409 3300038443 Bacteria 16013
276 Ga0395901_0200925 3300038443 Bacteria 2089
277 Ga0439450_000504 3300042008 Bacteria 5118
278 Ga0439454_001104 3300042011 Bacteria 2476
279 Ga0439454_005611 3300042011 Bacteria 1506
280 Ga0439463_003019 3300042016 Bacteria 4272
281 Ga0450902_002394 3300042137 Bacteria 2656
282 Ga0439458_0037862 3300042157 Bacteria 1164
283 Ga0439435_0025518 3300042436 Bacteria 1568
284 Ga0439444_0001976 3300042437 Bacteria 2740
285 Ga0439444_0006861 3300042437 Bacteria 1732
286 Ga0439464_0002157 3300042439 Bacteria 4810
287 Ga0439460_0004906 3300042461 Bacteria 3268
288 Ga0439460_0020685 3300042461 Bacteria 1790
289 Ga0466972_0006003 3300044658 Bacteria 6101
290 Ga0466965_0112054 3300044683 Bacteria 1403
291 Ga0466965_0309471 3300044683 Bacteria 859
292 Ga0466966_0032259 3300044684 Bacteria 3396
293 Ga0466963_0042493 3300044694 Bacteria 2985
294 Ga0466971_0033469 3300044719 Bacteria 2303
295 Ga0466971_0236272 3300044719 Bacteria 869
296 Ga0466970_0029432 3300044765 Bacteria 2891
297 Ga0466970_0191223 3300044765 Bacteria 1137
298 Ga0466960_0022356 3300044901 Bacteria 2827
299 Ga0466960_0086584 3300044901 Bacteria 1589
300 Ga0466960_0170983 3300044901 Bacteria 1173
301 Ga0466959_0043461 3300045049 Bacteria 3312
302 Ga0466959_0084456 3300045049 Bacteria 2285
303 Ga0466959_0149905 3300045049 Bacteria 1644
304 Ga0451576_0352697 3300045051 Bacteria 1540
305 Ga0466958_0027072 3300045836 Bacteria 3392
306 Ga0466958_0158590 3300045836 Bacteria 1429
307 Ga0466967_0012927 3300045976 Bacteria 6419
308 Ga0466967_0028925 3300045976 Bacteria 4632
309 Ga0466967_0256034 3300045976 Bacteria 1673
310 Ga0466967_0287910 3300045976 Bacteria 1578
311 Ga0466967_0312860 3300045976 Bacteria 1513
312 Ga0466967_0352579 3300045976 Bacteria 1425
313 Ga0466967_0986892 3300045976 Bacteria 838
314 Ga0495592_0044324 3300046454 Bacteria 3324
315 Ga0495629_0000311 3300046459 Bacteria 41767
316 Ga0495651_0057486 3300046462 Bacteria 2986
317 Ga0495651_0082875 3300046462 Bacteria 2419
318 Ga0495653_0030205 3300046463 Bacteria 4319
319 Ga0495650_0109680 3300046471 Bacteria 1026
320 Ga0495580_0056935 3300046472 Bacteria 2752
321 Ga0495582_0001098 3300046473 Bacteria 15184
322 Ga0495639_0011683 3300046475 Bacteria 3788
323 Ga0495585_0000237 3300046492 Bacteria 57136
324 Ga0495585_0054666 3300046492 Bacteria 2207
325 Ga0495594_0026178 3300046499 Bacteria 3137
326 Ga0495608_0006984 3300046511 Bacteria 7989
327 Ga0495618_0119742 3300046514 Bacteria 1686
328 Ga0495628_0038315 3300046516 Bacteria 3837
329 Ga0495628_0387724 3300046516 Bacteria 1022
330 Ga0495648_0066421 3300046524 Bacteria 2114
331 Ga0495652_0001491 3300046529 Bacteria 25795
332 Ga0495652_0404454 3300046529 Bacteria 966
333 Ga0495654_0067216 3300046530 Bacteria 1707
334 Ga0495640_0039929 3300046533 Bacteria 3290
335 Ga0495587_0003560 3300046536 Bacteria 10378
336 Ga0495645_0059914 3300046543 Bacteria 2759
337 Ga0495622_0011084 3300046557 Bacteria 4161
338 Ga0495633_0000174 3300046558 Bacteria 83814
339 Ga0495667_0011006 3300046559 Bacteria 6115
340 Ga0495668_0000017 3300046616 Bacteria 434025
341 Ga0495625_0001771 3300046660 Bacteria 24956
342 Ga0495625_0003957 3300046660 Bacteria 14228
343 Ga0495635_0002718 3300046663 Bacteria 12115
344 Ga0495657_0021478 3300046675 Bacteria 4630
345 Ga0495599_0134758 3300046678 Bacteria 1533
346 Ga0495646_0108759 3300046680 Bacteria 1580
347 Ga0495658_0002301 3300046683 Bacteria 9634
348 Ga0495613_0008248 3300046689 Bacteria 7733
349 Ga0495600_0051220 3300046809 Bacteria 2695
350 Ga0495581_0003795 3300047315 Bacteria 8694
351 Ga0495604_0015905 3300047317 Bacteria 6007
352 Ga0495604_0279684 3300047317 Bacteria 1128
353 Ga0495676_0075101 3300047321 Bacteria 2586
354 Ga0495680_0084081 3300047322 Bacteria 2398
355 Ga0495675_0018187 3300047444 Bacteria 4459
356 Ga0495677_0122342 3300047445 Bacteria 993
357 Ga0495685_062488 3300047447 Bacteria 1254
358 Ga0495684_0030167 3300047471 Bacteria 4163
359 Ga0495602_0060540 3300048088 Bacteria 3298
360 Ga0495602_0084067 3300048088 Bacteria 2663
361 Ga0495614_0007165 3300048089 Bacteria 4973
362 Ga0495614_0014306 3300048089 Bacteria 3475
363 Ga0496100_0198731 3300048903 Bacteria 1460
364 Ga0496100_0213104 3300048903 Bacteria 1414
365 Ga0496100_0229850 3300048903 Bacteria 1364
366 Ga0496101_0024751 3300048904 Bacteria 4159
367 Ga0496101_0504854 3300048904 Bacteria 955
368 Ga0496102_0077707 3300048905 Bacteria 3055
369 Ga0496102_0351221 3300048905 Bacteria 1388
370 Ga0496103_0073787 3300048906 Bacteria 2138
371 Ga0496104_0000996 3300048907 Bacteria 24228
372 Ga0496104_0309728 3300048907 Bacteria 1492
373 Ga0496105_0001412 3300048908 Bacteria 16884
374 Ga0496105_0413402 3300048908 Bacteria 1069
375 Ga0496106_0064619 3300048909 Bacteria 2784
376 Ga0496106_0070852 3300048909 Bacteria 2663
377 Ga0496106_0230140 3300048909 Bacteria 1480
378 Ga0496106_0327186 3300048909 Bacteria 1230
379 Ga0496107_0305781 3300048910 Bacteria 1183
380 Ga0496108_0003268 3300048911 Bacteria 13036
381 Ga0496108_0031172 3300048911 Bacteria 4421
382 Ga0496109_0010540 3300048912 Bacteria 7902
383 Ga0496109_0077478 3300048912 Bacteria 3059
384 Ga0496109_0253078 3300048912 Bacteria 1659
385 Ga0496109_0306636 3300048912 Bacteria 1497
386 Ga0496110_0011497 3300048913 Bacteria 7247
387 Ga0496110_0074559 3300048913 Bacteria 3013
388 Ga0496110_0369729 3300048913 Bacteria 1306
389 Ga0496110_0463771 3300048913 Bacteria 1154
390 Ga0496112_0059870 3300048915 Bacteria 3752
391 Ga0496112_0125400 3300048915 Bacteria 2539
392 Ga0496112_0156171 3300048915 Bacteria 2248
393 Ga0496113_0023818 3300048916 Bacteria 4345
394 Ga0496113_0216272 3300048916 Bacteria 1526
395 Ga0496113_0224130 3300048916 Bacteria 1499
396 Ga0496115_0029794 3300048918 Bacteria 4289
397 Ga0496115_0205781 3300048918 Bacteria 1625
398 Ga0495682_0027706 3300049460 Bacteria 2101
399 Ga0501032_0080131 3300049569 Bacteria 2173
400 Ga0501033_0047073 3300049570 Bacteria 3207
401 Ga0501036_0022113 3300049572 Bacteria 5349
402 Ga0501036_0048271 3300049572 Bacteria 3604
403 Ga0501037_0040271 3300049573 Bacteria 3438
404 Ga0501038_0015130 3300049574 Bacteria 7019
405 Ga0501038_0035123 3300049574 Bacteria 4403
406 Ga0501039_0002175 3300049575 Bacteria 14487
407 Ga0501040_0037154 3300049576 Bacteria 3307
408 Ga0501040_0127059 3300049576 Unclassified 1791
409 Ga0501041_0000413 3300049577 Bacteria 21589
410 Ga0501042_0000479 3300049578 Bacteria 20707
411 Ga0501046_0001640 3300049580 Bacteria 21418
412 Ga0501047_0282862 3300049581 Bacteria 1503
413 Ga0501048_0016438 3300049582 Bacteria 5453
414 Ga0501068_0075353 3300049584 Bacteria 2064
415 Ga0501070_0593805 3300049586 Bacteria 883
416 Ga0501071_0010509 3300049587 Bacteria 6207
417 Ga0501071_0109479 3300049587 Bacteria 2041
418 Ga0501071_0173022 3300049587 Bacteria 1617
419 Ga0501072_0471678 3300049588 Bacteria 993
420 Ga0501073_0085215 3300049589 Bacteria 2199
421 Ga0501074_0000625 3300049590 Bacteria 21967
422 Ga0501074_0058354 3300049590 Bacteria 2780
423 Ga0501075_0050461 3300049591 Bacteria 3127
424 Ga0501076_0017542 3300049592 Bacteria 5441
425 Ga0501077_0012030 3300049593 Bacteria 5417
426 Ga0501079_0039509 3300049741 Bacteria 3639
427 Ga0501080_0101871 3300049742 Bacteria 2664
428 Ga0501081_0032610 3300049743 Bacteria 3534
429 Ga0501081_0093444 3300049743 Bacteria 2118
430 Ga0501083_0224673 3300049744 Bacteria 1223
431 Ga0501044_0190798 3300049823 Bacteria 2012
432 Ga0501044_0245372 3300049823 Bacteria 1734
433 Ga0501045_0034283 3300049824 Bacteria 3684
434 Ga0501045_0121502 3300049824 Bacteria 1939
435 nmdc:mga05p37_1141_c1 3300050507 Bacteria 30525
436 nmdc:mga05p37_157888_c1 3300050507 Bacteria 2771
437 nmdc:mga05p37_17510_c1 3300050507 Bacteria 8650
438 nmdc:mga05p37_57394_c1 3300050507 Bacteria 4795
439 nmdc:mga09592_20_c1 3300050508 Bacteria 92890
440 nmdc:mga09592_8245_c1 3300050508 Bacteria 8475
441 nmdc:mga0qj67_1820_c1 3300050509 Bacteria 15094
442 nmdc:mga0qj67_451499_c1 3300050509 Bacteria 1035
443 nmdc:mga0qj67_87615_c1 3300050509 Bacteria 2499
444 nmdc:mga06r32_5255_c1 3300050510 Bacteria 11646
445 nmdc:mga06r32_86407_c1 3300050510 Bacteria 3059
446 nmdc:mga06r32_89_c1 3300050510 Bacteria 63337
447 nmdc:mga08y16_107135_c1 3300050511 Bacteria 2909
448 nmdc:mga08y16_2306_c1 3300050511 Bacteria 19533
449 nmdc:mga08y16_27019_c1 3300050511 Bacteria 6049
450 nmdc:mga08y16_8129_c1 3300050511 Bacteria 10972
451 nmdc:mga0n895_197793_c1 3300050512 Bacteria 2041
452 nmdc:mga0n895_88055_c1 3300050512 Bacteria 3104
453 nmdc:mga0rr50_301562_c1 3300050513 Bacteria 1340
454 nmdc:mga0rr50_485793_c1 3300050513 Bacteria 1049
455 nmdc:mga0a205_334988_c1 3300050515 Bacteria 1382
456 nmdc:mga0a205_3599_c1 3300050515 Bacteria 13867
457 nmdc:mga0a205_58776_c1 3300050515 Bacteria 3714
458 nmdc:mga0a205_7549_c2 3300050515 Bacteria 7279
459 Ga0495619_0063313 3300053085 Bacteria 2464
460 Ga0500647_0149468 3300053091 Bacteria 1091
461 Ga0500555_026859 3300053103 Bacteria 1643
462 Ga0500562_049782 3300053108 Bacteria 1120
463 Ga0500614_005172 3300053123 Bacteria 2738
464 Ga0500618_000011 3300053125 Bacteria 198091
465 Ga0500627_0063574 3300053158 Bacteria 1627
466 Ga0501084_0001896 3300054114 Bacteria 16697
467 Ga0501084_0003761 3300054114 Bacteria 12337
468 Ga0590071_004699 3300059421 Bacteria 3299
469 Ga0590074_004498 3300059423 Bacteria 2308
470 Ga0590077_003186 3300059426 Bacteria 3421
471 Ga0501082_0017973 3300060353 Bacteria 6089
472 Ga0501082_0852816 3300060353 Bacteria 797
473 Ga0466962_0024988 3300061719 Bacteria 2868
474 Ga0466962_0045487 3300061719 Bacteria 2098
475 Ga0530510_0005003 3300061734 Bacteria 9155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0309471 Ga0466965_0309471_11_676 221
2 3300005340 Ga0070689_100073628 Ga0070689_1000736282 223
3 3300005617 Ga0068859_100844714 Ga0068859_1008447142 223
4 3300005844 Ga0068862_100007874 Ga0068862_1000078748 223
5 3300006931 Ga0097620_100844795 Ga0097620_1008447952 223
6 3300013102 Ga0157371_10001599 Ga0157371_1000159916 228
7 3300013105 Ga0157369_10056641 Ga0157369_100566411 228
8 3300005844 Ga0068862_100041138 Ga0068862_1000411382 230
9 3300006844 Ga0075428_100178099 Ga0075428_1001780992 230
10 3300006847 Ga0075431_100277879 Ga0075431_1002778792 230
11 3300028380 Ga0268265_10081817 Ga0268265_100818172 230
12 3300009094 Ga0111539_10205927 Ga0111539_102059272 234
13 3300025931 Ga0207644_10143231 Ga0207644_101432311 244
14 3300005983 Ga0081540_1012006 Ga0081540_10120062 246
15 3300046492 Ga0495585_0054666 Ga0495585_0054666_243_983 246
16 3300005347 Ga0070668_100504071 Ga0070668_1005040711 247
17 3300005577 Ga0068857_100186867 Ga0068857_1001868672 247
18 3300013307 Ga0157372_10255540 Ga0157372_102555402 247
19 3300020081 Ga0206354_11182079 Ga0206354_111820792 247
20 3300020082 Ga0206353_10709762 Ga0206353_107097623 247
21 3300025972 Ga0207668_10125194 Ga0207668_101251942 247
22 3300026116 Ga0207674_10214317 Ga0207674_102143172 247
23 3300037466 Ga0395898_0295366 Ga0395898_0295366_67_810 247
24 3300049823 Ga0501044_0245372 Ga0501044_0245372_688_1431 247
25 3300005329 Ga0070683_100296887 Ga0070683_1002968871 248
26 3300005366 Ga0070659_100344270 Ga0070659_1003442702 248
27 3300005535 Ga0070684_100113090 Ga0070684_1001130903 248
28 3300005719 Ga0068861_100059745 Ga0068861_1000597452 248
29 3300009551 Ga0105238_10491664 Ga0105238_104916642 248
30 3300025917 Ga0207660_10233517 Ga0207660_102335172 248
31 3300025944 Ga0207661_10130388 Ga0207661_101303884 248
32 3300026118 Ga0207675_100117968 Ga0207675_1001179682 248
33 3300031548 Ga0307408_100425105 Ga0307408_1004251051 248
34 3300031901 Ga0307406_10361098 Ga0307406_103610982 248
35 3300031903 Ga0307407_10069394 Ga0307407_100693942 248
36 3300031903 Ga0307407_10089174 Ga0307407_100891742 248
37 3300031995 Ga0307409_100006897 Ga0307409_1000068974 248
38 3300031995 Ga0307409_100359795 Ga0307409_1003597952 248
39 3300032002 Ga0307416_100160287 Ga0307416_1001602872 248
40 3300032004 Ga0307414_10168535 Ga0307414_101685352 248
41 3300032126 Ga0307415_100012167 Ga0307415_1000121673 248
42 3300032126 Ga0307415_100069361 Ga0307415_1000693612 248
43 3300032126 Ga0307415_100162888 Ga0307415_1001628881 248
44 3300032126 Ga0307415_100207936 Ga0307415_1002079362 248
45 3300037312 Ga0395899_0016540 Ga0395899_0016540_2736_3491 248
46 3300037418 Ga0395900_0041499 Ga0395900_0041499_3347_4102 248
47 3300037466 Ga0395898_0188753 Ga0395898_0188753_625_1380 248
48 3300037466 Ga0395898_0597084 Ga0395898_0597084_191_952 248
49 3300038443 Ga0395901_0003409 Ga0395901_0003409_11696_12457 248
50 3300044683 Ga0466965_0112054 Ga0466965_0112054_229_984 248
51 3300044684 Ga0466966_0032259 Ga0466966_0032259_2504_3265 248
52 3300044694 Ga0466963_0042493 Ga0466963_0042493_700_1455 248
53 3300044719 Ga0466971_0033469 Ga0466971_0033469_574_1335 248
54 3300044719 Ga0466971_0236272 Ga0466971_0236272_66_827 248
55 3300044765 Ga0466970_0029432 Ga0466970_0029432_714_1475 248
56 3300044765 Ga0466970_0191223 Ga0466970_0191223_11_766 248
57 3300044901 Ga0466960_0022356 Ga0466960_0022356_913_1674 248
58 3300044901 Ga0466960_0086584 Ga0466960_0086584_65_826 248
59 3300044901 Ga0466960_0170983 Ga0466960_0170983_365_1126 248
60 3300045049 Ga0466959_0043461 Ga0466959_0043461_917_1678 248
61 3300045049 Ga0466959_0084456 Ga0466959_0084456_1320_2081 248
62 3300045049 Ga0466959_0149905 Ga0466959_0149905_661_1464 248
63 3300045836 Ga0466958_0027072 Ga0466958_0027072_2410_3171 248
64 3300045836 Ga0466958_0158590 Ga0466958_0158590_290_1051 248
65 3300045976 Ga0466967_0012927 Ga0466967_0012927_2370_3131 248
66 3300045976 Ga0466967_0312860 Ga0466967_0312860_293_1054 248
67 3300045976 Ga0466967_0352579 Ga0466967_0352579_32_793 248
68 3300045976 Ga0466967_0986892 Ga0466967_0986892_46_801 248
69 3300048916 Ga0496113_0224130 Ga0496113_0224130_383_1144 248
70 3300061719 Ga0466962_0045487 Ga0466962_0045487_1244_1999 248
71 3300005578 Ga0068854_100463362 Ga0068854_1004633622 249
72 3300005937 Ga0081455_10015298 Ga0081455_100152984 249
73 3300005983 Ga0081540_1081069 Ga0081540_10810692 249
74 3300033179 Ga0307507_10007309 Ga0307507_100073098 249
75 3300033180 Ga0307510_10036540 Ga0307510_100365406 249
76 3300035086 Ga0373934_0081156 Ga0373934_0081156_442_1191 249
77 3300035119 Ga0373956_0045728 Ga0373956_0045728_916_1665 249
78 3300035120 Ga0373957_0199043 Ga0373957_0199043_41_790 249
79 3300035695 Ga0373927_0087271 Ga0373927_0087271_783_1541 249
80 3300035724 Ga0373933_0061685 Ga0373933_0061685_942_1691 249
81 3300044658 Ga0466972_0006003 Ga0466972_0006003_5072_5830 249
82 3300046462 Ga0495651_0057486 Ga0495651_0057486_1025_1774 249
83 3300046516 Ga0495628_0387724 Ga0495628_0387724_57_806 249
84 3300047317 Ga0495604_0279684 Ga0495604_0279684_247_996 249
85 3300047447 Ga0495685_062488 Ga0495685_062488_29_787 249
86 3300048088 Ga0495602_0060540 Ga0495602_0060540_1357_2106 249
87 3300048903 Ga0496100_0198731 Ga0496100_0198731_641_1399 249
88 3300048903 Ga0496100_0213104 Ga0496100_0213104_331_1089 249
89 3300048905 Ga0496102_0077707 Ga0496102_0077707_871_1629 249
90 3300048907 Ga0496104_0309728 Ga0496104_0309728_397_1155 249
91 3300048909 Ga0496106_0070852 Ga0496106_0070852_694_1452 249
92 3300048911 Ga0496108_0031172 Ga0496108_0031172_2148_2906 249
93 3300048912 Ga0496109_0253078 Ga0496109_0253078_538_1296 249
94 3300048913 Ga0496110_0074559 Ga0496110_0074559_2182_2940 249
95 3300005337 Ga0070682_100101365 Ga0070682_1001013651 250
96 3300005366 Ga0070659_100209020 Ga0070659_1002090202 250
97 3300005435 Ga0070714_100009950 Ga0070714_1000099507 250
98 3300005437 Ga0070710_10001048 Ga0070710_100010486 250
99 3300005437 Ga0070710_10028091 Ga0070710_100280912 250
100 3300005437 Ga0070710_10037423 Ga0070710_100374232 250
101 3300005439 Ga0070711_100016189 Ga0070711_1000161892 250
102 3300005468 Ga0070707_100000043 Ga0070707_10000004388 250
103 3300005468 Ga0070707_100504379 Ga0070707_1005043791 250
104 3300005471 Ga0070698_100020025 Ga0070698_1000200256 250
105 3300005471 Ga0070698_100082246 Ga0070698_1000822463 250
106 3300005614 Ga0068856_100003242 Ga0068856_1000032423 250
107 3300005614 Ga0068856_100073333 Ga0068856_1000733331 250
108 3300005616 Ga0068852_100059456 Ga0068852_1000594562 250
109 3300006028 Ga0070717_10127341 Ga0070717_101273412 250
110 3300006028 Ga0070717_10309120 Ga0070717_103091202 250
111 3300006163 Ga0070715_10012575 Ga0070715_100125753 250
112 3300006163 Ga0070715_10015336 Ga0070715_100153363 250
113 3300006163 Ga0070715_10163312 Ga0070715_101633122 250
114 3300006173 Ga0070716_100003927 Ga0070716_1000039274 250
115 3300006173 Ga0070716_100050126 Ga0070716_1000501261 250
116 3300006175 Ga0070712_100005496 Ga0070712_1000054963 250
117 3300006175 Ga0070712_100260512 Ga0070712_1002605121 250
118 3300009093 Ga0105240_11125679 Ga0105240_111256791 250
119 3300009174 Ga0105241_10200448 Ga0105241_102004482 250
120 3300025898 Ga0207692_10030304 Ga0207692_100303043 250
121 3300025905 Ga0207685_10002860 Ga0207685_100028603 250
122 3300025906 Ga0207699_10002722 Ga0207699_100027224 250
123 3300025906 Ga0207699_10006974 Ga0207699_100069744 250
124 3300025915 Ga0207693_10001968 Ga0207693_1000196811 250
125 3300025915 Ga0207693_10584374 Ga0207693_105843741 250
126 3300025916 Ga0207663_10013891 Ga0207663_100138913 250
127 3300025929 Ga0207664_10048274 Ga0207664_100482744 250
128 3300025939 Ga0207665_10003371 Ga0207665_100033718 250
129 3300026078 Ga0207702_10244860 Ga0207702_102448601 250
130 3300026121 Ga0207683_10209051 Ga0207683_102090512 250
131 3300031995 Ga0307409_100459946 Ga0307409_1004599462 250
132 3300032005 Ga0307411_10612360 Ga0307411_106123601 250
133 3300034816 Ga0373930_0008506 Ga0373930_0008506_953_1723 250
134 3300035092 Ga0373952_0038889 Ga0373952_0038889_29_799 250
135 3300035114 Ga0373939_0002556 Ga0373939_0002556_940_1710 250
136 3300035121 Ga0373960_0012234 Ga0373960_0012234_806_1576 250
137 3300035241 Ga0373961_0003398 Ga0373961_0003398_2351_3121 250
138 3300046529 Ga0495652_0404454 Ga0495652_0404454_189_950 250
139 3300048904 Ga0496101_0024751 Ga0496101_0024751_1385_2155 250
140 3300048906 Ga0496103_0073787 Ga0496103_0073787_473_1243 250
141 3300048907 Ga0496104_0000996 Ga0496104_0000996_18996_19748 250
142 3300048908 Ga0496105_0001412 Ga0496105_0001412_15481_16233 250
143 3300048909 Ga0496106_0230140 Ga0496106_0230140_53_805 250
144 3300048910 Ga0496107_0305781 Ga0496107_0305781_356_1126 250
145 3300048911 Ga0496108_0003268 Ga0496108_0003268_9677_10429 250
146 3300048912 Ga0496109_0306636 Ga0496109_0306636_59_829 250
147 3300048913 Ga0496110_0463771 Ga0496110_0463771_90_860 250
148 3300048915 Ga0496112_0059870 Ga0496112_0059870_163_915 250
149 3300048916 Ga0496113_0023818 Ga0496113_0023818_2180_2950 250
150 3300048916 Ga0496113_0216272 Ga0496113_0216272_199_951 250
151 3300048918 Ga0496115_0029794 Ga0496115_0029794_356_1126 250
152 3300048918 Ga0496115_0205781 Ga0496115_0205781_265_1017 250
153 3300003203 JGI25406J46586_10011734 JGI25406J46586_100117343 251
154 3300003373 JGI25407J50210_10008220 JGI25407J50210_100082203 251
155 3300005329 Ga0070683_100056689 Ga0070683_1000566892 251
156 3300005337 Ga0070682_100226560 Ga0070682_1002265601 251
157 3300005338 Ga0068868_100006099 Ga0068868_1000060992 251
158 3300005339 Ga0070660_100411193 Ga0070660_1004111931 251
159 3300005344 Ga0070661_100054784 Ga0070661_1000547842 251
160 3300005366 Ga0070659_100016315 Ga0070659_1000163157 251
161 3300005438 Ga0070701_10030467 Ga0070701_100304672 251
162 3300005444 Ga0070694_100195488 Ga0070694_1001954882 251
163 3300005455 Ga0070663_100489160 Ga0070663_1004891601 251
164 3300005466 Ga0070685_10039128 Ga0070685_100391282 251
165 3300005535 Ga0070684_100155038 Ga0070684_1001550382 251
166 3300005547 Ga0070693_100371922 Ga0070693_1003719222 251
167 3300005549 Ga0070704_100129265 Ga0070704_1001292653 251
168 3300005564 Ga0070664_100121713 Ga0070664_1001217132 251
169 3300005577 Ga0068857_100075949 Ga0068857_1000759492 251
170 3300005615 Ga0070702_100040267 Ga0070702_1000402672 251
171 3300005615 Ga0070702_100083148 Ga0070702_1000831482 251
172 3300005719 Ga0068861_100018838 Ga0068861_1000188383 251
173 3300005719 Ga0068861_100062319 Ga0068861_1000623195 251
174 3300005840 Ga0068870_10100624 Ga0068870_101006242 251
175 3300005981 Ga0081538_10000370 Ga0081538_1000037015 251
176 3300005981 Ga0081538_10001449 Ga0081538_100014499 251
177 3300005981 Ga0081538_10009867 Ga0081538_100098677 251
178 3300005981 Ga0081538_10010977 Ga0081538_100109773 251
179 3300005981 Ga0081538_10024438 Ga0081538_100244385 251
180 3300005981 Ga0081538_10117155 Ga0081538_101171552 251
181 3300005985 Ga0081539_10007364 Ga0081539_100073644 251
182 3300005985 Ga0081539_10023480 Ga0081539_100234803 251
183 3300005985 Ga0081539_10046459 Ga0081539_100464594 251
184 3300005985 Ga0081539_10083752 Ga0081539_100837521 251
185 3300005985 Ga0081539_10091854 Ga0081539_100918542 251
186 3300006846 Ga0075430_100047266 Ga0075430_1000472662 251
187 3300006852 Ga0075433_10100698 Ga0075433_101006983 251
188 3300006852 Ga0075433_10240616 Ga0075433_102406162 251
189 3300006871 Ga0075434_100128416 Ga0075434_1001284163 251
190 3300009093 Ga0105240_10974667 Ga0105240_109746671 251
191 3300009094 Ga0111539_10002959 Ga0111539_100029594 251
192 3300009094 Ga0111539_10035517 Ga0111539_100355172 251
193 3300009147 Ga0114129_10013764 Ga0114129_100137643 251
194 3300009147 Ga0114129_10161784 Ga0114129_101617843 251
195 3300009148 Ga0105243_10567802 Ga0105243_105678021 251
196 3300009553 Ga0105249_10111364 Ga0105249_101113642 251
197 3300013296 Ga0157374_10125674 Ga0157374_101256742 251
198 3300013297 Ga0157378_10087064 Ga0157378_100870645 251
199 3300013306 Ga0163162_10109212 Ga0163162_101092122 251
200 3300013308 Ga0157375_10453433 Ga0157375_104534332 251
201 3300014325 Ga0163163_10212469 Ga0163163_102124692 251
202 3300025900 Ga0207710_10085244 Ga0207710_100852442 251
203 3300025901 Ga0207688_10016342 Ga0207688_100163422 251
204 3300025908 Ga0207643_10015338 Ga0207643_100153383 251
205 3300025925 Ga0207650_10240763 Ga0207650_102407632 251
206 3300025935 Ga0207709_10249157 Ga0207709_102491571 251
207 3300025937 Ga0207669_10166665 Ga0207669_101666652 251
208 3300025938 Ga0207704_10052787 Ga0207704_100527875 251
209 3300025942 Ga0207689_10108304 Ga0207689_101083043 251
210 3300025961 Ga0207712_10130420 Ga0207712_101304202 251
211 3300026023 Ga0207677_10162933 Ga0207677_101629333 251
212 3300026067 Ga0207678_10215941 Ga0207678_102159412 251
213 3300026075 Ga0207708_10025533 Ga0207708_100255332 251
214 3300026089 Ga0207648_10050363 Ga0207648_100503632 251
215 3300026095 Ga0207676_10392403 Ga0207676_103924032 251
216 3300026116 Ga0207674_10115266 Ga0207674_101152662 251
217 3300026118 Ga0207675_100031587 Ga0207675_1000315875 251
218 3300026121 Ga0207683_10054921 Ga0207683_100549215 251
219 3300027907 Ga0207428_10002935 Ga0207428_1000293511 251
220 3300031548 Ga0307408_100247535 Ga0307408_1002475351 251
221 3300031731 Ga0307405_10020061 Ga0307405_100200615 251
222 3300031731 Ga0307405_10026247 Ga0307405_100262472 251
223 3300031731 Ga0307405_10091639 Ga0307405_100916391 251
224 3300031731 Ga0307405_10648682 Ga0307405_106486821 251
225 3300031824 Ga0307413_10016398 Ga0307413_100163983 251
226 3300031824 Ga0307413_10057090 Ga0307413_100570902 251
227 3300031852 Ga0307410_10122104 Ga0307410_101221042 251
228 3300031852 Ga0307410_10158245 Ga0307410_101582452 251
229 3300031901 Ga0307406_10011663 Ga0307406_100116635 251
230 3300031901 Ga0307406_10028441 Ga0307406_100284414 251
231 3300031903 Ga0307407_10007627 Ga0307407_100076274 251
232 3300031911 Ga0307412_10025061 Ga0307412_100250613 251
233 3300031911 Ga0307412_10273030 Ga0307412_102730302 251
234 3300031995 Ga0307409_100038265 Ga0307409_1000382656 251
235 3300031995 Ga0307409_100052002 Ga0307409_1000520023 251
236 3300031995 Ga0307409_100072452 Ga0307409_1000724523 251
237 3300031995 Ga0307409_100074764 Ga0307409_1000747642 251
238 3300031995 Ga0307409_100248944 Ga0307409_1002489442 251
239 3300031995 Ga0307409_100273701 Ga0307409_1002737012 251
240 3300031995 Ga0307409_100373926 Ga0307409_1003739261 251
241 3300032002 Ga0307416_100005275 Ga0307416_1000052754 251
242 3300032002 Ga0307416_100014790 Ga0307416_1000147905 251
243 3300032002 Ga0307416_100029865 Ga0307416_1000298654 251
244 3300032002 Ga0307416_100270032 Ga0307416_1002700322 251
245 3300032002 Ga0307416_100496742 Ga0307416_1004967422 251
246 3300032002 Ga0307416_100582375 Ga0307416_1005823752 251
247 3300032002 Ga0307416_100768166 Ga0307416_1007681661 251
248 3300032004 Ga0307414_10060430 Ga0307414_100604304 251
249 3300032126 Ga0307415_100011475 Ga0307415_1000114754 251
250 3300032126 Ga0307415_100012227 Ga0307415_1000122275 251
251 3300032126 Ga0307415_100032590 Ga0307415_1000325902 251
252 3300032126 Ga0307415_100237395 Ga0307415_1002373953 251
253 3300032126 Ga0307415_100242744 Ga0307415_1002427442 251
254 3300032133 Ga0316583_10057360 Ga0316583_100573602 251
255 3300035171 Ga0373946_0029358 Ga0373946_0029358_1145_1900 251
256 3300035725 Ga0373947_0006881 Ga0373947_0006881_609_1364 251
257 3300036401 Ga0373937_0074554 Ga0373937_0074554_1614_2390 251
258 3300037068 Ga0373925_0004845 Ga0373925_0004845_696_1451 251
259 3300037068 Ga0373925_0018871 Ga0373925_0018871_3542_4318 251
260 3300037466 Ga0395898_0061564 Ga0395898_0061564_916_1680 251
261 3300038443 Ga0395901_0200925 Ga0395901_0200925_681_1445 251
262 3300042011 Ga0439454_001104 Ga0439454_001104_381_1139 251
263 3300042011 Ga0439454_005611 Ga0439454_005611_316_1080 251
264 3300042436 Ga0439435_0025518 Ga0439435_0025518_728_1486 251
265 3300042437 Ga0439444_0006861 Ga0439444_0006861_920_1678 251
266 3300042461 Ga0439460_0020685 Ga0439460_0020685_335_1093 251
267 3300046454 Ga0495592_0044324 Ga0495592_0044324_1898_2674 251
268 3300046459 Ga0495629_0000311 Ga0495629_0000311_20735_21490 251
269 3300046462 Ga0495651_0082875 Ga0495651_0082875_632_1408 251
270 3300046463 Ga0495653_0030205 Ga0495653_0030205_1244_2020 251
271 3300046472 Ga0495580_0056935 Ga0495580_0056935_625_1380 251
272 3300046473 Ga0495582_0001098 Ga0495582_0001098_11137_11892 251
273 3300046475 Ga0495639_0011683 Ga0495639_0011683_840_1595 251
274 3300046499 Ga0495594_0026178 Ga0495594_0026178_568_1323 251
275 3300046511 Ga0495608_0006984 Ga0495608_0006984_5706_6482 251
276 3300046514 Ga0495618_0119742 Ga0495618_0119742_549_1325 251
277 3300046516 Ga0495628_0038315 Ga0495628_0038315_1200_1976 251
278 3300046529 Ga0495652_0001491 Ga0495652_0001491_8461_9237 251
279 3300046533 Ga0495640_0039929 Ga0495640_0039929_1161_1937 251
280 3300046536 Ga0495587_0003560 Ga0495587_0003560_4869_5645 251
281 3300046543 Ga0495645_0059914 Ga0495645_0059914_604_1380 251
282 3300046559 Ga0495667_0011006 Ga0495667_0011006_719_1495 251
283 3300046663 Ga0495635_0002718 Ga0495635_0002718_7772_8548 251
284 3300046675 Ga0495657_0021478 Ga0495657_0021478_757_1533 251
285 3300046678 Ga0495599_0134758 Ga0495599_0134758_580_1356 251
286 3300046680 Ga0495646_0108759 Ga0495646_0108759_555_1331 251
287 3300046683 Ga0495658_0002301 Ga0495658_0002301_3307_4062 251
288 3300046689 Ga0495613_0008248 Ga0495613_0008248_3328_4083 251
289 3300046809 Ga0495600_0051220 Ga0495600_0051220_1056_1832 251
290 3300047315 Ga0495581_0003795 Ga0495581_0003795_4637_5392 251
291 3300047317 Ga0495604_0015905 Ga0495604_0015905_4216_4992 251
292 3300047321 Ga0495676_0075101 Ga0495676_0075101_576_1331 251
293 3300047322 Ga0495680_0084081 Ga0495680_0084081_566_1342 251
294 3300047444 Ga0495675_0018187 Ga0495675_0018187_2643_3419 251
295 3300047471 Ga0495684_0030167 Ga0495684_0030167_1910_2686 251
296 3300048088 Ga0495602_0084067 Ga0495602_0084067_719_1495 251
297 3300048089 Ga0495614_0014306 Ga0495614_0014306_1375_2130 251
298 3300048903 Ga0496100_0229850 Ga0496100_0229850_373_1137 251
299 3300048904 Ga0496101_0504854 Ga0496101_0504854_28_792 251
300 3300048905 Ga0496102_0351221 Ga0496102_0351221_105_869 251
301 3300048908 Ga0496105_0413402 Ga0496105_0413402_143_907 251
302 3300048909 Ga0496106_0064619 Ga0496106_0064619_1481_2245 251
303 3300048909 Ga0496106_0327186 Ga0496106_0327186_27_791 251
304 3300048912 Ga0496109_0077478 Ga0496109_0077478_1143_1907 251
305 3300048913 Ga0496110_0369729 Ga0496110_0369729_16_780 251
306 3300048915 Ga0496112_0156171 Ga0496112_0156171_358_1122 251
307 3300049569 Ga0501032_0080131 Ga0501032_0080131_1106_1873 251
308 3300049570 Ga0501033_0047073 Ga0501033_0047073_38_805 251
309 3300049572 Ga0501036_0022113 Ga0501036_0022113_4517_5293 251
310 3300049572 Ga0501036_0048271 Ga0501036_0048271_1709_2476 251
311 3300049573 Ga0501037_0040271 Ga0501037_0040271_1525_2292 251
312 3300049574 Ga0501038_0015130 Ga0501038_0015130_4436_5203 251
313 3300049574 Ga0501038_0035123 Ga0501038_0035123_3504_4280 251
314 3300049575 Ga0501039_0002175 Ga0501039_0002175_1178_1945 251
315 3300049576 Ga0501040_0037154 Ga0501040_0037154_1330_2097 251
316 3300049576 Ga0501040_0127059 Ga0501040_0127059_759_1535 251
317 3300049577 Ga0501041_0000413 Ga0501041_0000413_1082_1849 251
318 3300049578 Ga0501042_0000479 Ga0501042_0000479_18887_19654 251
319 3300049580 Ga0501046_0001640 Ga0501046_0001640_17731_18498 251
320 3300049581 Ga0501047_0282862 Ga0501047_0282862_550_1317 251
321 3300049582 Ga0501048_0016438 Ga0501048_0016438_2926_3693 251
322 3300049587 Ga0501071_0010509 Ga0501071_0010509_4595_5362 251
323 3300049587 Ga0501071_0109479 Ga0501071_0109479_1245_2021 251
324 3300049588 Ga0501072_0471678 Ga0501072_0471678_136_903 251
325 3300049589 Ga0501073_0085215 Ga0501073_0085215_529_1296 251
326 3300049590 Ga0501074_0000625 Ga0501074_0000625_6154_6921 251
327 3300049590 Ga0501074_0058354 Ga0501074_0058354_1880_2656 251
328 3300049591 Ga0501075_0050461 Ga0501075_0050461_1879_2646 251
329 3300049592 Ga0501076_0017542 Ga0501076_0017542_1761_2528 251
330 3300049593 Ga0501077_0012030 Ga0501077_0012030_132_899 251
331 3300049741 Ga0501079_0039509 Ga0501079_0039509_1708_2475 251
332 3300049742 Ga0501080_0101871 Ga0501080_0101871_842_1609 251
333 3300049743 Ga0501081_0032610 Ga0501081_0032610_1118_1885 251
334 3300049743 Ga0501081_0093444 Ga0501081_0093444_1168_1944 251
335 3300049744 Ga0501083_0224673 Ga0501083_0224673_76_852 251
336 3300049823 Ga0501044_0190798 Ga0501044_0190798_1027_1794 251
337 3300049824 Ga0501045_0034283 Ga0501045_0034283_1102_1869 251
338 3300049824 Ga0501045_0121502 Ga0501045_0121502_873_1649 251
339 3300050507 nmdc:mga05p37_157888_c1 nmdc:mga05p37_157888_c1_1350_2111 251
340 3300050507 nmdc:mga05p37_17510_c1 nmdc:mga05p37_17510_c1_3050_3814 251
341 3300050507 nmdc:mga05p37_57394_c1 nmdc:mga05p37_57394_c1_2768_3532 251
342 3300050508 nmdc:mga09592_8245_c1 nmdc:mga09592_8245_c1_6451_7215 251
343 3300050509 nmdc:mga0qj67_1820_c1 nmdc:mga0qj67_1820_c1_13095_13859 251
344 3300050511 nmdc:mga08y16_107135_c1 nmdc:mga08y16_107135_c1_443_1207 251
345 3300050511 nmdc:mga08y16_8129_c1 nmdc:mga08y16_8129_c1_10171_10935 251
346 3300050512 nmdc:mga0n895_88055_c1 nmdc:mga0n895_88055_c1_795_1559 251
347 3300050513 nmdc:mga0rr50_485793_c1 nmdc:mga0rr50_485793_c1_84_848 251
348 3300050515 nmdc:mga0a205_334988_c1 nmdc:mga0a205_334988_c1_466_1230 251
349 3300050515 nmdc:mga0a205_3599_c1 nmdc:mga0a205_3599_c1_4326_5090 251
350 3300050515 nmdc:mga0a205_7549_c2 nmdc:mga0a205_7549_c2_32_796 251
351 3300053085 Ga0495619_0063313 Ga0495619_0063313_1516_2292 251
352 3300054114 Ga0501084_0001896 Ga0501084_0001896_6113_6880 251
353 3300054114 Ga0501084_0003761 Ga0501084_0003761_8680_9456 251
354 3300059421 Ga0590071_004699 Ga0590071_004699_879_1658 251
355 3300059423 Ga0590074_004498 Ga0590074_004498_334_1113 251
356 3300059426 Ga0590077_003186 Ga0590077_003186_2348_3127 251
357 3300060353 Ga0501082_0017973 Ga0501082_0017973_4152_4919 251
358 3300061734 Ga0530510_0005003 Ga0530510_0005003_1272_2039 251
359 3300005937 Ga0081455_10269554 Ga0081455_102695542 252
360 3300005985 Ga0081539_10006982 Ga0081539_100069829 252
361 3300005985 Ga0081539_10016163 Ga0081539_100161637 252
362 3300006847 Ga0075431_100651709 Ga0075431_1006517092 252
363 3300006852 Ga0075433_10429057 Ga0075433_104290571 252
364 3300006871 Ga0075434_100173562 Ga0075434_1001735622 252
365 3300013307 Ga0157372_10223860 Ga0157372_102238602 252
366 3300025929 Ga0207664_10072328 Ga0207664_100723282 252
367 3300031691 Ga0316579_10008495 Ga0316579_100084952 252
368 3300031691 Ga0316579_10171812 Ga0316579_101718121 252
369 3300031727 Ga0316576_10066602 Ga0316576_100666022 252
370 3300031727 Ga0316576_10132863 Ga0316576_101328632 252
371 3300031728 Ga0316578_10007870 Ga0316578_100078702 252
372 3300031733 Ga0316577_10001065 Ga0316577_100010654 252
373 3300032133 Ga0316583_10019472 Ga0316583_100194722 252
374 3300032137 Ga0316585_10027912 Ga0316585_100279122 252
375 3300035398 Ga0316574_0046038 Ga0316574_0046038_175_933 252
376 3300035398 Ga0316574_0067001 Ga0316574_0067001_27_785 252
377 3300036647 Ga0316582_0042895 Ga0316582_0042895_1514_2272 252
378 3300036712 Ga0316584_0005243 Ga0316584_0005243_776_1534 252
379 3300042008 Ga0439450_000504 Ga0439450_000504_2022_2807 252
380 3300042016 Ga0439463_003019 Ga0439463_003019_1113_1898 252
381 3300042137 Ga0450902_002394 Ga0450902_002394_1396_2181 252
382 3300042157 Ga0439458_0037862 Ga0439458_0037862_109_894 252
383 3300042437 Ga0439444_0001976 Ga0439444_0001976_1112_1897 252
384 3300042439 Ga0439464_0002157 Ga0439464_0002157_2303_3088 252
385 3300042461 Ga0439460_0004906 Ga0439460_0004906_729_1514 252
386 3300049586 Ga0501070_0593805 Ga0501070_0593805_77_835 252
387 3300050509 nmdc:mga0qj67_451499_c1 nmdc:mga0qj67_451499_c1_11_769 252
388 3300050510 nmdc:mga06r32_5255_c1 nmdc:mga06r32_5255_c1_5153_5911 252
389 3300050512 nmdc:mga0n895_197793_c1 nmdc:mga0n895_197793_c1_371_1129 252
390 3300050513 nmdc:mga0rr50_301562_c1 nmdc:mga0rr50_301562_c1_364_1122 252
391 3300050515 nmdc:mga0a205_58776_c1 nmdc:mga0a205_58776_c1_1143_1901 252
392 3300053103 Ga0500555_026859 Ga0500555_026859_764_1522 252
393 3300053108 Ga0500562_049782 Ga0500562_049782_17_775 252
394 3300053158 Ga0500627_0063574 Ga0500627_0063574_469_1227 252
395 3300060353 Ga0501082_0852816 Ga0501082_0852816_20_778 252
396 3300061719 Ga0466962_0024988 Ga0466962_0024988_1406_2164 252
397 3300005985 Ga0081539_10033570 Ga0081539_100335703 253
398 3300006880 Ga0075429_100264107 Ga0075429_1002641072 253
399 3300028653 Ga0265323_10016933 Ga0265323_100169333 253
400 3300028654 Ga0265322_10010386 Ga0265322_100103863 253
401 3300028666 Ga0265336_10014411 Ga0265336_100144113 253
402 3300031238 Ga0265332_10114637 Ga0265332_101146371 253
403 3300031712 Ga0265342_10036610 Ga0265342_100366102 253
404 3300045051 Ga0451576_0352697 Ga0451576_0352697_481_1242 253
405 3300045976 Ga0466967_0028925 Ga0466967_0028925_1701_2462 253
406 3300045976 Ga0466967_0256034 Ga0466967_0256034_221_982 253
407 3300045976 Ga0466967_0287910 Ga0466967_0287910_633_1394 253
408 3300048912 Ga0496109_0010540 Ga0496109_0010540_1740_2501 253
409 3300048913 Ga0496110_0011497 Ga0496110_0011497_4979_5740 253
410 3300048915 Ga0496112_0125400 Ga0496112_0125400_1336_2097 253
411 3300002741 JGI25157J39369_1005612 JGI25157J39369_10056122 254
412 3300005441 Ga0070700_100070983 Ga0070700_1000709832 254
413 3300005467 Ga0070706_100030490 Ga0070706_1000304904 254
414 3300005471 Ga0070698_100140113 Ga0070698_1001401133 254
415 3300005518 Ga0070699_100145332 Ga0070699_1001453322 254
416 3300005617 Ga0068859_100029201 Ga0068859_1000292017 254
417 3300005937 Ga0081455_10007254 Ga0081455_1000725414 254
418 3300005981 Ga0081538_10101116 Ga0081538_101011162 254
419 3300006195 Ga0075366_10000062 Ga0075366_1000006221 254
420 3300006195 Ga0075366_10117635 Ga0075366_101176352 254
421 3300006844 Ga0075428_100008866 Ga0075428_1000088664 254
422 3300006846 Ga0075430_100092523 Ga0075430_1000925231 254
423 3300006847 Ga0075431_100001557 Ga0075431_10000155715 254
424 3300006847 Ga0075431_100078557 Ga0075431_1000785573 254
425 3300006880 Ga0075429_100013160 Ga0075429_10001316010 254
426 3300006931 Ga0097620_100029201 Ga0097620_1000292017 254
427 3300009094 Ga0111539_10033539 Ga0111539_100335395 254
428 3300020082 Ga0206353_10713231 Ga0206353_107132312 254
429 3300025250 Ga0209026_1000993 Ga0209026_10009935 254
430 3300025250 Ga0209026_1003598 Ga0209026_10035984 254
431 3300025910 Ga0207684_10054175 Ga0207684_100541753 254
432 3300025922 Ga0207646_10041191 Ga0207646_100411911 254
433 3300025936 Ga0207670_10121704 Ga0207670_101217042 254
434 3300026075 Ga0207708_10097498 Ga0207708_100974983 254
435 3300026088 Ga0207641_10366447 Ga0207641_103664472 254
436 3300027907 Ga0207428_10001857 Ga0207428_100018574 254
437 3300027907 Ga0207428_10008457 Ga0207428_100084571 254
438 3300028577 Ga0265318_10004322 Ga0265318_100043227 254
439 3300028653 Ga0265323_10014707 Ga0265323_100147072 254
440 3300028794 Ga0307515_10000430 Ga0307515_1000043084 254
441 3300028794 Ga0307515_10000910 Ga0307515_1000091039 254
442 3300031235 Ga0265330_10016065 Ga0265330_100160653 254
443 3300031240 Ga0265320_10006459 Ga0265320_100064597 254
444 3300031250 Ga0265331_10074420 Ga0265331_100744202 254
445 3300031344 Ga0265316_10021189 Ga0265316_100211895 254
446 3300031344 Ga0265316_10074555 Ga0265316_100745552 254
447 3300031344 Ga0265316_10217631 Ga0265316_102176312 254
448 3300031712 Ga0265342_10042615 Ga0265342_100426152 254
449 3300036647 Ga0316582_0020120 Ga0316582_0020120_3002_3790 254
450 3300036647 Ga0316582_0133937 Ga0316582_0133937_542_1372 254
451 3300036712 Ga0316584_0074225 Ga0316584_0074225_296_1084 254
452 3300046471 Ga0495650_0109680 Ga0495650_0109680_37_804 254
453 3300046492 Ga0495585_0000237 Ga0495585_0000237_48029_48793 254
454 3300046524 Ga0495648_0066421 Ga0495648_0066421_1205_1969 254
455 3300046530 Ga0495654_0067216 Ga0495654_0067216_813_1577 254
456 3300046557 Ga0495622_0011084 Ga0495622_0011084_2353_3117 254
457 3300046558 Ga0495633_0000174 Ga0495633_0000174_18653_19420 254
458 3300046616 Ga0495668_0000017 Ga0495668_0000017_126843_127607 254
459 3300046660 Ga0495625_0001771 Ga0495625_0001771_6890_7654 254
460 3300046660 Ga0495625_0003957 Ga0495625_0003957_344_1111 254
461 3300047445 Ga0495677_0122342 Ga0495677_0122342_199_963 254
462 3300048089 Ga0495614_0007165 Ga0495614_0007165_682_1446 254
463 3300049460 Ga0495682_0027706 Ga0495682_0027706_465_1229 254
464 3300049584 Ga0501068_0075353 Ga0501068_0075353_857_1633 254
465 3300049587 Ga0501071_0173022 Ga0501071_0173022_121_897 254
466 3300050507 nmdc:mga05p37_1141_c1 nmdc:mga05p37_1141_c1_28601_29380 254
467 3300050508 nmdc:mga09592_20_c1 nmdc:mga09592_20_c1_86975_87754 254
468 3300050509 nmdc:mga0qj67_87615_c1 nmdc:mga0qj67_87615_c1_1632_2411 254
469 3300050510 nmdc:mga06r32_86407_c1 nmdc:mga06r32_86407_c1_203_991 254
470 3300050510 nmdc:mga06r32_89_c1 nmdc:mga06r32_89_c1_60447_61226 254
471 3300050511 nmdc:mga08y16_2306_c1 nmdc:mga08y16_2306_c1_4305_5084 254
472 3300050511 nmdc:mga08y16_27019_c1 nmdc:mga08y16_27019_c1_179_967 254
473 3300053091 Ga0500647_0149468 Ga0500647_0149468_52_819 254
474 3300053123 Ga0500614_005172 Ga0500614_005172_815_1579 254
475 3300053125 Ga0500618_000011 Ga0500618_000011_72497_73261 254
476 iso_pu_bacteria 2977232053 2977233598 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

66

263

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

72

307

0.88

PF08659

KR

KR domain

66

249

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

68

225

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
3enn-assembly1.cif.gz_B 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9502 2 250
3emk-assembly1.cif.gz_D 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.948 1 250
3emk-assembly1.cif.gz_C 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.947 1 250
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.945 5 251
3enn-assembly1.cif.gz_D 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9446 3 250
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9606 1 248 3.40.50.720
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 2 250 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 1 248 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9427 8 186 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9375 4 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A354NET0-F1-model_v4 deleted 0.9517 8 249
AF-A0A2D9DQU0-F1-model_v4 3-oxoacyl-ACP reductase 0.9501 1 254
AF-A0A7Y6MVD7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9486 3 248 GO:0004316
GO:0006633
GO:0051287
AF-A0A2D9DQU0-F1-model_v4 3-oxoacyl-ACP reductase 0.9464 1 254
AF-A0A3M1YKC1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9444 6 249 GO:0004316
GO:0006633
GO:0051287

Feature Viewer

pLDDT pTM Quality
93.52 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map