F451330

General Info

Members Datasets Scaffolds Average Seq Length
475 259 950 193

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10122953|Ga0105240_101229532
Length 229
Sequence MLDVGCSSPFRVLDPRLKIVIIPPFPKQPTRIPMSEPTQIKDTTGNPAPLGLLAFGLTTVLLNLHNAGYYELNSMILAMGLCYGGTAQVIAGIMEWKKGNTFATTAFISYGFFWLALVALIVLPKIIPGVTATNESALGTFLLLWGIFTAVMFLGTLKLSRALQFVFASLTLLFFLLAIGKYSEASPAFNHFTGYEGVICGASAIYTGLAQVLNELYGKTVWPLGVMKK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
177 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
257 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
258 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
259 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0.42
Rhizoplane 6.11
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 19.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10122953 3300009093 Bacteria 3123
2 JGI24035J26624_1000844 3300002126 Bacteria 2895
3 JGI24035J26624_1004601 3300002126 Bacteria 1311
4 rootH2_10102467 3300003320 Bacteria 9871
5 Ga0065704_10012572 3300005289 Bacteria 2307
6 Ga0065704_10018022 3300005289 Bacteria 1831
7 Ga0065704_10112327 3300005289 Unclassified 1871
8 Ga0065712_10003851 3300005290 Bacteria 8286
9 Ga0065712_10011629 3300005290 Bacteria 2380
10 Ga0065712_10021571 3300005290 Bacteria 1587
11 Ga0065712_10097251 3300005290 Bacteria 2156
12 Ga0065712_10142149 3300005290 Bacteria 1440
13 Ga0065715_10089135 3300005293 Bacteria 13674
14 Ga0065715_10108426 3300005293 Bacteria 2720
15 Ga0065715_10132602 3300005293 Unclassified 1987
16 Ga0065715_10154907 3300005293 Bacteria 1688
17 Ga0065707_10012136 3300005295 Bacteria 1825
18 Ga0065707_10021718 3300005295 Bacteria 2990
19 Ga0065707_10218383 3300005295 Unclassified 1235
20 Ga0070658_10315794 3300005327 Bacteria 1334
21 Ga0070658_10643979 3300005327 Bacteria 919
22 Ga0070676_10499644 3300005328 Bacteria 863
23 Ga0070683_100006293 3300005329 Bacteria 9964
24 Ga0070683_100049246 3300005329 Unclassified 3896
25 Ga0070683_100162543 3300005329 Bacteria 2119
26 Ga0070683_100277340 3300005329 Bacteria 1595
27 Ga0070690_100009394 3300005330 Bacteria 5664
28 Ga0070670_100029146 3300005331 Bacteria 4750
29 Ga0068869_100956033 3300005334 Unclassified 744
30 Ga0070666_10016901 3300005335 Bacteria 4672
31 Ga0070680_100016470 3300005336 Bacteria 5819
32 Ga0070680_100149295 3300005336 Bacteria 1962
33 Ga0070682_100245503 3300005337 Bacteria 1288
34 Ga0068868_100003638 3300005338 Bacteria 10754
35 Ga0070660_100110463 3300005339 Bacteria 2187
36 Ga0070660_100244902 3300005339 Unclassified 1461
37 Ga0070660_100252984 3300005339 Bacteria 1437
38 Ga0070660_100803468 3300005339 Bacteria 791
39 Ga0070689_100002552 3300005340 Bacteria 11937
40 Ga0070689_100024548 3300005340 Bacteria 4523
41 Ga0070689_100432189 3300005340 Bacteria 1117
42 Ga0070691_10157476 3300005341 Unclassified 1169
43 Ga0070661_100215039 3300005344 Bacteria 1473
44 Ga0070692_10089696 3300005345 Bacteria 1669
45 Ga0070668_100120129 3300005347 Bacteria 2100
46 Ga0070675_100132794 3300005354 Unclassified 2123
47 Ga0070675_100811068 3300005354 Unclassified 856
48 Ga0070671_100013955 3300005355 Bacteria 6484
49 Ga0070671_100035819 3300005355 Unclassified 4112
50 Ga0070671_100092506 3300005355 Bacteria 2533
51 Ga0070673_100025765 3300005364 Bacteria 4334
52 Ga0070688_100093382 3300005365 Bacteria 1970
53 Ga0070688_100185839 3300005365 Bacteria 1444
54 Ga0070667_100004405 3300005367 Bacteria 11873
55 Ga0070667_100287912 3300005367 Bacteria 1477
56 Ga0070709_10139784 3300005434 Bacteria 1663
57 Ga0070709_10553060 3300005434 Unclassified 881
58 Ga0070714_100094111 3300005435 Bacteria 2630
59 Ga0070714_100119975 3300005435 Bacteria 2338
60 Ga0070714_100914529 3300005435 Bacteria 852
61 Ga0070713_100392522 3300005436 Unclassified 1295
62 Ga0070713_100472857 3300005436 Bacteria 1180
63 Ga0070710_10074195 3300005437 Bacteria 1969
64 Ga0070710_10214553 3300005437 Bacteria 1221
65 Ga0070711_100119979 3300005439 Bacteria 1943
66 Ga0070711_100182661 3300005439 Unclassified 1606
67 Ga0070711_101012958 3300005439 Unclassified 713
68 Ga0070705_100732991 3300005440 Unclassified 780
69 Ga0070700_100298718 3300005441 Bacteria 1175
70 Ga0070708_100101766 3300005445 Bacteria 2632
71 Ga0070708_100170106 3300005445 Unclassified 2034
72 Ga0070708_100172083 3300005445 Unclassified 2022
73 Ga0070708_100256040 3300005445 Unclassified 1645
74 Ga0070663_100045081 3300005455 Bacteria 3114
75 Ga0070663_100170317 3300005455 Bacteria 1683
76 Ga0070678_100264697 3300005456 Bacteria 1447
77 Ga0070662_100012776 3300005457 Bacteria 5575
78 Ga0070662_100790551 3300005457 Unclassified 806
79 Ga0070681_10066699 3300005458 Bacteria 3568
80 Ga0070681_10072150 3300005458 Unclassified 3416
81 Ga0070681_10089186 3300005458 Bacteria 3035
82 Ga0070685_10059372 3300005466 Bacteria 2233
83 Ga0070707_100005403 3300005468 Bacteria 11956
84 Ga0070707_100110201 3300005468 Bacteria 2669
85 Ga0070707_100440300 3300005468 Bacteria 1264
86 Ga0070698_100004384 3300005471 Bacteria 15505
87 Ga0070698_100155769 3300005471 Bacteria 2230
88 Ga0070699_100034874 3300005518 Bacteria 4348
89 Ga0070679_100000506 3300005530 Bacteria 33193
90 Ga0070679_100086813 3300005530 Bacteria 3115
91 Ga0070679_100250747 3300005530 Bacteria 1726
92 Ga0070684_100001480 3300005535 Bacteria 16949
93 Ga0070684_100033806 3300005535 Bacteria 4369
94 Ga0070684_100047836 3300005535 Bacteria 3708
95 Ga0070697_100029246 3300005536 Bacteria 4416
96 Ga0070697_100036997 3300005536 Bacteria 3943
97 Ga0070697_100117946 3300005536 Unclassified 2217
98 Ga0070697_100418927 3300005536 Bacteria 1164
99 Ga0070672_100232718 3300005543 Bacteria 1548
100 Ga0070686_100016545 3300005544 Bacteria 4291
101 Ga0070695_100499991 3300005545 Unclassified 940
102 Ga0070665_100853865 3300005548 Bacteria 923
103 Ga0070665_100881804 3300005548 Bacteria 907
104 Ga0068855_100000818 3300005563 Bacteria 38486
105 Ga0068855_100048192 3300005563 Bacteria 5030
106 Ga0068855_100129281 3300005563 Bacteria 2886
107 Ga0068855_100321051 3300005563 Bacteria 1712
108 Ga0068855_100345042 3300005563 Bacteria 1641
109 Ga0070664_100004396 3300005564 Bacteria 11319
110 Ga0070664_100096999 3300005564 Unclassified 2559
111 Ga0068857_100003302 3300005577 Bacteria 13402
112 Ga0068856_100000649 3300005614 Bacteria 37712
113 Ga0068856_100075159 3300005614 Bacteria 3346
114 Ga0068856_100163897 3300005614 Bacteria 2234
115 Ga0068856_100262836 3300005614 Bacteria 1741
116 Ga0070702_100127834 3300005615 Unclassified 1601
117 Ga0068852_100000779 3300005616 Bacteria 20911
118 Ga0068852_100093346 3300005616 Bacteria 2697
119 Ga0068864_100003309 3300005618 Bacteria 13310
120 Ga0068864_100103669 3300005618 Bacteria 2526
121 Ga0068861_100559168 3300005719 Unclassified 1044
122 Ga0068863_100003877 3300005841 Bacteria 14790
123 Ga0068863_100027867 3300005841 Bacteria 5392
124 Ga0068863_100189282 3300005841 Unclassified 1977
125 Ga0068863_100276726 3300005841 Unclassified 1625
126 Ga0068858_100276817 3300005842 Bacteria 1597
127 Ga0068860_100007487 3300005843 Bacteria 10922
128 Ga0068860_100025398 3300005843 Bacteria 5715
129 Ga0081455_10005310 3300005937 Bacteria 14147
130 Ga0081455_10006228 3300005937 Bacteria 12846
131 Ga0081455_10028340 3300005937 Bacteria 5118
132 Ga0081455_10034490 3300005937 Bacteria 4532
133 Ga0081455_10054596 3300005937 Bacteria 3403
134 Ga0081455_10084111 3300005937 Unclassified 2598
135 Ga0081455_10088228 3300005937 Unclassified 2521
136 Ga0081455_10115168 3300005937 Bacteria 2129
137 Ga0081540_1016917 3300005983 Bacteria 4539
138 Ga0081539_10055503 3300005985 Unclassified 2203
139 Ga0081539_10062445 3300005985 Unclassified 2036
140 Ga0070717_10045228 3300006028 Bacteria 3599
141 Ga0070717_10046888 3300006028 Bacteria 3538
142 Ga0070717_10063167 3300006028 Bacteria 3072
143 Ga0070717_10427302 3300006028 Bacteria 1192
144 Ga0070715_10054543 3300006163 Unclassified 1731
145 Ga0070716_100044485 3300006173 Bacteria 2488
146 Ga0070716_100064400 3300006173 Bacteria 2131
147 Ga0070712_100119804 3300006175 Bacteria 1978
148 Ga0070712_100782948 3300006175 Unclassified 818
149 Ga0097621_100012790 3300006237 Bacteria 6235
150 Ga0097621_100124962 3300006237 Bacteria 2185
151 Ga0068871_100038056 3300006358 Bacteria 3838
152 Ga0068871_100144018 3300006358 Bacteria 2028
153 Ga0075428_100283977 3300006844 Bacteria 1781
154 Ga0075434_100172981 3300006871 Unclassified 2179
155 Ga0075436_100808674 3300006914 Bacteria 698
156 Ga0099795_10111411 3300007788 Unclassified 1085
157 Ga0111539_10762385 3300009094 Bacteria 1126
158 Ga0105245_10004487 3300009098 Bacteria 12341
159 Ga0105245_10071735 3300009098 Bacteria 3145
160 Ga0105245_10138679 3300009098 Bacteria 2288
161 Ga0105245_10414011 3300009098 Unclassified 1349
162 Ga0105245_11087899 3300009098 Unclassified 845
163 Ga0105247_10028674 3300009101 Bacteria 3369
164 Ga0105247_10065692 3300009101 Unclassified 2257
165 Ga0114129_10206831 3300009147 Bacteria 2655
166 Ga0114129_11552634 3300009147 Unclassified 812
167 Ga0105241_10092760 3300009174 Unclassified 2385
168 Ga0105241_10359425 3300009174 Bacteria 1267
169 Ga0105242_10282809 3300009176 Bacteria 1507
170 Ga0105248_10014626 3300009177 Bacteria 8636
171 Ga0105248_10272428 3300009177 Unclassified 1906
172 Ga0105237_10460890 3300009545 Bacteria 1277
173 Ga0105237_11294632 3300009545 Unclassified 735
174 Ga0105238_10006987 3300009551 Bacteria 11283
175 Ga0105238_10023519 3300009551 Bacteria 6279
176 Ga0105238_10141605 3300009551 Unclassified 2381
177 Ga0105238_11016885 3300009551 Bacteria 850
178 Ga0105249_10024095 3300009553 Bacteria 5467
179 Ga0105249_10586147 3300009553 Bacteria 1168
180 Ga0105239_10017220 3300010375 Bacteria 7990
181 Ga0105239_10200641 3300010375 Bacteria 2235
182 Ga0105239_10504512 3300010375 Bacteria 1376
183 Ga0105246_10035536 3300011119 Bacteria 3331
184 Ga0105246_10039042 3300011119 Bacteria 3195
185 Ga0157336_1003264 3300012477 Unclassified 967
186 Ga0157373_10319300 3300013100 Bacteria 1105
187 Ga0157371_10014422 3300013102 Bacteria 5962
188 Ga0157369_10129170 3300013105 Bacteria 2678
189 Ga0157369_11334641 3300013105 Bacteria 731
190 Ga0157374_10056753 3300013296 Unclassified 3656
191 Ga0157374_10104515 3300013296 Bacteria 2719
192 Ga0157374_10143872 3300013296 Bacteria 2316
193 Ga0157374_10239446 3300013296 Bacteria 1784
194 Ga0157374_10306228 3300013296 Bacteria 1572
195 Ga0157374_10313588 3300013296 Bacteria 1553
196 Ga0157374_10448303 3300013296 Unclassified 1292
197 Ga0157374_10480533 3300013296 Unclassified 1246
198 Ga0157374_10838414 3300013296 Bacteria 936
199 Ga0157374_11514110 3300013296 Bacteria 694
200 Ga0157378_10022345 3300013297 Bacteria 5568
201 Ga0157378_10174847 3300013297 Bacteria 2016
202 Ga0157378_10229931 3300013297 Bacteria 1767
203 Ga0157378_10619656 3300013297 Bacteria 1095
204 Ga0163162_10015942 3300013306 Bacteria 7343
205 Ga0163162_10906535 3300013306 Bacteria 994
206 Ga0163162_10927882 3300013306 Unclassified 983
207 Ga0157372_10033275 3300013307 Bacteria 5660
208 Ga0157372_10288936 3300013307 Bacteria 1907
209 Ga0157372_10328563 3300013307 Bacteria 1780
210 Ga0157372_10953258 3300013307 Bacteria 995
211 Ga0157375_10003300 3300013308 Bacteria 13973
212 Ga0157375_10025020 3300013308 Bacteria 5537
213 Ga0157375_10085536 3300013308 Bacteria 3203
214 Ga0157375_10324351 3300013308 Bacteria 1705
215 Ga0163163_10081932 3300014325 Bacteria 3229
216 Ga0163163_10299730 3300014325 Unclassified 1660
217 Ga0157380_11086082 3300014326 Unclassified 838
218 Ga0157377_10006181 3300014745 Bacteria 5692
219 Ga0157377_10459803 3300014745 Unclassified 881
220 Ga0157379_10062882 3300014968 Bacteria 3319
221 Ga0157379_10187369 3300014968 Bacteria 1870
222 Ga0157376_10028203 3300014969 Bacteria 4459
223 Ga0157376_10159203 3300014969 Bacteria 2045
224 Ga0157376_10194258 3300014969 Bacteria 1863
225 Ga0157376_10315944 3300014969 Bacteria 1484
226 Ga0157376_10335543 3300014969 Bacteria 1442
227 Ga0157376_10935746 3300014969 Bacteria 886
228 Ga0163161_10134458 3300017792 Bacteria 1868
229 Ga0207666_1003249 3300025271 Bacteria 1991
230 Ga0207673_1001333 3300025290 Bacteria 2675
231 Ga0207697_10000633 3300025315 Bacteria 20039
232 Ga0207697_10067061 3300025315 Bacteria 1500
233 Ga0207653_10022027 3300025885 Bacteria 2023
234 Ga0207692_10372034 3300025898 Bacteria 885
235 Ga0207710_10012030 3300025900 Bacteria 3638
236 Ga0207688_10144863 3300025901 Bacteria 1400
237 Ga0207680_10081209 3300025903 Bacteria 2037
238 Ga0207647_10259722 3300025904 Unclassified 995
239 Ga0207647_10374088 3300025904 Bacteria 805
240 Ga0207699_10094131 3300025906 Bacteria 1887
241 Ga0207645_10113949 3300025907 Bacteria 1752
242 Ga0207705_10332754 3300025909 Bacteria 1168
243 Ga0207705_10374398 3300025909 Bacteria 1099
244 Ga0207684_10063201 3300025910 Bacteria 3143
245 Ga0207707_10008771 3300025912 Bacteria 8776
246 Ga0207707_10659539 3300025912 Bacteria 881
247 Ga0207693_10036553 3300025915 Bacteria 3871
248 Ga0207693_10055355 3300025915 Bacteria 3112
249 Ga0207693_10168746 3300025915 Bacteria 1723
250 Ga0207663_10492482 3300025916 Bacteria 951
251 Ga0207660_10005771 3300025917 Bacteria 8034
252 Ga0207660_10030572 3300025917 Bacteria 3703
253 Ga0207662_10211909 3300025918 Unclassified 1258
254 Ga0207657_10065395 3300025919 Bacteria 3100
255 Ga0207657_10139055 3300025919 Unclassified 1985
256 Ga0207657_10242925 3300025919 Bacteria 1437
257 Ga0207649_10447348 3300025920 Bacteria 974
258 Ga0207652_10000499 3300025921 Bacteria 39843
259 Ga0207652_10100162 3300025921 Bacteria 2558
260 Ga0207646_10006655 3300025922 Bacteria 11913
261 Ga0207646_10301944 3300025922 Unclassified 1446
262 Ga0207694_10001798 3300025924 Bacteria 17857
263 Ga0207650_10038426 3300025925 Bacteria 3495
264 Ga0207659_10011937 3300025926 Bacteria 5502
265 Ga0207687_10014735 3300025927 Bacteria 5120
266 Ga0207687_10055598 3300025927 Bacteria 2774
267 Ga0207700_10007425 3300025928 Bacteria 6697
268 Ga0207700_10350939 3300025928 Bacteria 1285
269 Ga0207664_10123367 3300025929 Bacteria 2171
270 Ga0207644_10093374 3300025931 Bacteria 2246
271 Ga0207644_10650781 3300025931 Bacteria 877
272 Ga0207706_10299652 3300025933 Bacteria 1401
273 Ga0207709_10094445 3300025935 Unclassified 1963
274 Ga0207670_10005557 3300025936 Bacteria 6930
275 Ga0207670_10016925 3300025936 Bacteria 4395
276 Ga0207670_10067839 3300025936 Bacteria 2455
277 Ga0207704_10353415 3300025938 Bacteria 1145
278 Ga0207665_10023238 3300025939 Bacteria 4083
279 Ga0207665_10063826 3300025939 Bacteria 2502
280 Ga0207665_10775425 3300025939 Unclassified 757
281 Ga0207691_10133586 3300025940 Bacteria 2190
282 Ga0207711_10001644 3300025941 Bacteria 20626
283 Ga0207711_10338767 3300025941 Bacteria 1392
284 Ga0207689_10435202 3300025942 Unclassified 1095
285 Ga0207661_10092820 3300025944 Bacteria 2517
286 Ga0207661_10186578 3300025944 Bacteria 1815
287 Ga0207661_10551956 3300025944 Bacteria 1055
288 Ga0207679_10105800 3300025945 Bacteria 2210
289 Ga0207667_10000415 3300025949 Bacteria 57796
290 Ga0207667_10723460 3300025949 Bacteria 996
291 Ga0207651_10121111 3300025960 Bacteria 1984
292 Ga0207712_10034283 3300025961 Unclassified 3439
293 Ga0207658_10170082 3300025986 Bacteria 1795
294 Ga0207658_10250786 3300025986 Bacteria 1504
295 Ga0207677_10457656 3300026023 Bacteria 1094
296 Ga0207703_10012795 3300026035 Bacteria 6542
297 Ga0207639_10453569 3300026041 Bacteria 1164
298 Ga0207678_10003665 3300026067 Bacteria 13808
299 Ga0207678_10267249 3300026067 Bacteria 1466
300 Ga0207702_10000591 3300026078 Bacteria 40087
301 Ga0207702_10000965 3300026078 Bacteria 29560
302 Ga0207702_10761570 3300026078 Bacteria 956
303 Ga0207641_10050381 3300026088 Bacteria 3522
304 Ga0207641_10150904 3300026088 Unclassified 2104
305 Ga0207641_10243197 3300026088 Unclassified 1678
306 Ga0207676_10114740 3300026095 Bacteria 2260
307 Ga0207674_10145832 3300026116 Bacteria 2326
308 Ga0207675_101485062 3300026118 Unclassified 698
309 Ga0207683_10015753 3300026121 Bacteria 6433
310 Ga0207698_10090415 3300026142 Bacteria 2503
311 Ga0268266_10052384 3300028379 Bacteria 3505
312 Ga0268266_10112771 3300028379 Bacteria 2410
313 Ga0268265_10497835 3300028380 Bacteria 1148
314 Ga0268264_10085299 3300028381 Bacteria 2710
315 Ga0265334_10096746 3300028573 Bacteria 1072
316 Ga0265318_10015554 3300028577 Bacteria 3162
317 Ga0265323_10000295 3300028653 Bacteria 28813
318 Ga0265323_10039834 3300028653 Unclassified 1712
319 Ga0265336_10047479 3300028666 Bacteria 1303
320 Ga0265338_10004111 3300028800 Bacteria 19935
321 Ga0265338_10004516 3300028800 Bacteria 18765
322 Ga0265338_10047494 3300028800 Bacteria 3919
323 Ga0265338_10091891 3300028800 Bacteria 2505
324 Ga0265338_10266136 3300028800 Bacteria 1258
325 Ga0265338_10462504 3300028800 Bacteria 897
326 Ga0265330_10000087 3300031235 Bacteria 78938
327 Ga0265330_10046215 3300031235 Bacteria 1919
328 Ga0265330_10217417 3300031235 Bacteria 807
329 Ga0265320_10014868 3300031240 Bacteria 4415
330 Ga0265320_10017930 3300031240 Unclassified 3913
331 Ga0265320_10163012 3300031240 Bacteria 1003
332 Ga0265325_10000064 3300031241 Bacteria 73859
333 Ga0265325_10027533 3300031241 Unclassified 3072
334 Ga0265329_10023331 3300031242 Bacteria 2062
335 Ga0265329_10078973 3300031242 Bacteria 1042
336 Ga0265340_10000225 3300031247 Bacteria 28840
337 Ga0265340_10068314 3300031247 Bacteria 1688
338 Ga0265339_10000268 3300031249 Bacteria 42009
339 Ga0265339_10014051 3300031249 Bacteria 4836
340 Ga0265339_10039272 3300031249 Bacteria 2636
341 Ga0265339_10235646 3300031249 Bacteria 890
342 Ga0265316_10006343 3300031344 Bacteria 11312
343 Ga0265316_10069346 3300031344 Bacteria 2721
344 Ga0265313_10015316 3300031595 Bacteria 4473
345 Ga0265313_10112273 3300031595 Unclassified 1197
346 Ga0265313_10222722 3300031595 Unclassified 777
347 Ga0316579_10020608 3300031691 Bacteria 2928
348 Ga0265314_10000067 3300031711 Bacteria 156225
349 Ga0265314_10013653 3300031711 Bacteria 6550
350 Ga0265314_10082262 3300031711 Bacteria 2119
351 Ga0265342_10000067 3300031712 Bacteria 111040
352 Ga0265342_10023554 3300031712 Bacteria 3896
353 Ga0265342_10063274 3300031712 Bacteria 2175
354 Ga0265342_10322494 3300031712 Unclassified 809
355 Ga0316578_10114072 3300031728 Bacteria 1623
356 Ga0316577_10230161 3300031733 Bacteria 1048
357 Ga0316583_10002049 3300032133 Bacteria 6909
358 Ga0373926_0167265 3300035083 Unclassified 841
359 Ga0373923_0129574 3300035111 Bacteria 1133
360 Ga0373953_0182345 3300035117 Bacteria 906
361 Ga0373954_0160880 3300035118 Unclassified 1099
362 Ga0373956_0036494 3300035119 Bacteria 2170
363 Ga0373943_0012890 3300035170 Bacteria 3769
364 Ga0373955_0523240 3300035172 Unclassified 725
365 Ga0373931_0137233 3300035691 Unclassified 1413
366 Ga0373927_0764885 3300035695 Unclassified 638
367 Ga0373933_0051354 3300035724 Bacteria 2464
368 Ga0373947_0060241 3300035725 Bacteria 2304
369 Ga0373937_0007554 3300036401 Bacteria 9416
370 Ga0373937_0176726 3300036401 Bacteria 2004
371 Ga0373937_0382563 3300036401 Bacteria 1335
372 Ga0316582_0102805 3300036647 Bacteria 1894
373 Ga0373925_0442292 3300037068 Bacteria 1064
374 Ga0395899_0127282 3300037312 Bacteria 1821
375 Ga0395899_0218642 3300037312 Bacteria 1320
376 Ga0395900_0002016 3300037418 Bacteria 22869
377 Ga0395900_0181668 3300037418 Bacteria 2137
378 Ga0395900_0256296 3300037418 Unclassified 1749
379 Ga0395898_0115799 3300037466 Bacteria 2568
380 Ga0395898_0198553 3300037466 Bacteria 1916
381 Ga0395898_0237474 3300037466 Bacteria 1738
382 Ga0395898_0302856 3300037466 Bacteria 1525
383 Ga0395905_0005024 3300037471 Bacteria 13625
384 Ga0395905_0226969 3300037471 Bacteria 1747
385 Ga0395901_0003034 3300038443 Bacteria 16918
386 Ga0395901_0058616 3300038443 Unclassified 4005
387 Ga0395901_0087741 3300038443 Bacteria 3253
388 Ga0395901_0564357 3300038443 Bacteria 1152
389 Ga0451789_0674246 3300041443 Bacteria 922
390 Ga0451802_0026154 3300041460 Unclassified 1151
391 Ga0451839_0160265 3300041496 Bacteria 628
392 Ga0439458_0026064 3300042157 Bacteria 1374
393 Ga0439458_0060388 3300042157 Unclassified 946
394 Ga0466964_0063474 3300044706 Unclassified 1543
395 Ga0453684_0291861 3300044712 Unclassified 1857
396 Ga0451576_1334180 3300045051 Unclassified 747
397 Ga0466967_0629874 3300045976 Bacteria 1060
398 Ga0466967_0821347 3300045976 Unclassified 923
399 Ga0495592_0023819 3300046454 Unclassified 4656
400 Ga0495603_0013315 3300046455 Bacteria 4974
401 Ga0495629_0314049 3300046459 Bacteria 1072
402 Ga0495641_0309047 3300046461 Unclassified 713
403 Ga0495641_0328730 3300046461 Bacteria 690
404 Ga0495580_0000504 3300046472 Bacteria 32829
405 Ga0495580_0226185 3300046472 Bacteria 1285
406 Ga0495662_0154648 3300046476 Bacteria 1130
407 Ga0495583_0007134 3300046506 Bacteria 7117
408 Ga0495608_0128484 3300046511 Unclassified 1623
409 Ga0495628_0080022 3300046516 Bacteria 2540
410 Ga0495628_0557943 3300046516 Bacteria 822
411 Ga0495630_0572449 3300046517 Bacteria 866
412 Ga0495665_0297460 3300046531 Archaea 827
413 Ga0495640_0424937 3300046533 Bacteria 814
414 Ga0495587_0202671 3300046536 Bacteria 1122
415 Ga0495645_0071118 3300046543 Bacteria 2509
416 Ga0495667_0242403 3300046559 Bacteria 1148
417 Ga0495635_0168710 3300046663 Bacteria 1489
418 Ga0495657_0253113 3300046675 Bacteria 1060
419 Ga0495599_0004467 3300046678 Bacteria 8286
420 Ga0495646_0014278 3300046680 Bacteria 5052
421 Ga0495669_0021855 3300046684 Bacteria 2780
422 Ga0495624_0412250 3300046690 Bacteria 811
423 Ga0495674_0010027 3300047319 Bacteria 8980
424 Ga0495674_0031926 3300047319 Unclassified 4779
425 Ga0495680_0721589 3300047322 Bacteria 657
426 Ga0495684_0014921 3300047471 Bacteria 5984
427 Ga0495602_0314141 3300048088 Bacteria 1142
428 Ga0496100_0288534 3300048903 Bacteria 1225
429 Ga0496102_0096286 3300048905 Unclassified 2744
430 Ga0496102_0119186 3300048905 Bacteria 2464
431 Ga0496102_0345415 3300048905 Bacteria 1401
432 Ga0496104_0006204 3300048907 Bacteria 10502
433 Ga0496104_0275102 3300048907 Bacteria 1597
434 Ga0496104_0591669 3300048907 Bacteria 1020
435 Ga0496104_0734040 3300048907 Bacteria 895
436 Ga0496105_0042391 3300048908 Bacteria 3752
437 Ga0496105_0219430 3300048908 Bacteria 1548
438 Ga0496106_0095394 3300048909 Bacteria 2301
439 Ga0496106_0155157 3300048909 Bacteria 1808
440 Ga0496106_0187353 3300048909 Unclassified 1644
441 Ga0496106_0408932 3300048909 Bacteria 1091
442 Ga0496108_0016539 3300048911 Bacteria 6021
443 Ga0496108_0020345 3300048911 Bacteria 5455
444 Ga0496109_0018202 3300048912 Bacteria 6168
445 Ga0496109_0040706 3300048912 Bacteria 4209
446 Ga0496109_0089945 3300048912 Bacteria 2839
447 Ga0496110_0251991 3300048913 Unclassified 1607
448 Ga0496113_0003243 3300048916 Bacteria 9707
449 Ga0496114_0001027 3300048917 Bacteria 20976
450 Ga0496114_0058697 3300048917 Bacteria 3213
451 Ga0496114_0067633 3300048917 Bacteria 2997
452 Ga0496115_0009055 3300048918 Bacteria 7385
453 Ga0496115_0020928 3300048918 Bacteria 5048
454 Ga0496115_0351799 3300048918 Bacteria 1201
455 Ga0495682_0007389 3300049460 Bacteria 4377
456 Ga0501031_0000127 3300049568 Bacteria 42244
457 Ga0501032_0007725 3300049569 Bacteria 7838
458 Ga0501033_0000002 3300049570 Bacteria 668574
459 Ga0501033_0003955 3300049570 Bacteria 12015
460 Ga0501036_0572851 3300049572 Bacteria 938
461 Ga0501035_0007703 3300049822 Bacteria 10060
462 Ga0501044_0000679 3300049823 Bacteria 41172
463 nmdc:mga05p37_100237_c1 3300050507 Unclassified 3567
464 nmdc:mga05p37_1140529_c1 3300050507 Unclassified 812
465 nmdc:mga09592_73230_c1 3300050508 Bacteria 2910
466 nmdc:mga08y16_1247667_c1 3300050511 Unclassified 712
467 nmdc:mga08y16_156199_c1 3300050511 Bacteria 2370
468 nmdc:mga0a205_254677_c1 3300050515 Bacteria 1634
469 Ga0495601_0093075 3300053077 Bacteria 1941
470 Ga0500650_0025187 3300053098 Bacteria 2658
471 Ga0500636_0246106 3300053177 Unclassified 915
472 2512345878 2512047030 Bacteria 9031815
473 2515683874 2515154122 Bacteria 8609520
474 2885280093 2885270888 Bacteria 9831543
475 2902685273 2902682994 Bacteria 8951596
476 Ga0105240_10122953
477 JGI24035J26624_1000844
478 JGI24035J26624_1004601
479 rootH2_10102467
480 Ga0065704_10012572
481 Ga0065704_10018022
482 Ga0065704_10112327
483 Ga0065712_10003851
484 Ga0065712_10011629
485 Ga0065712_10021571
486 Ga0065712_10097251
487 Ga0065712_10142149
488 Ga0065715_10089135
489 Ga0065715_10108426
490 Ga0065715_10132602
491 Ga0065715_10154907
492 Ga0065707_10012136
493 Ga0065707_10021718
494 Ga0065707_10218383
495 Ga0070658_10315794
496 Ga0070658_10643979
497 Ga0070676_10499644
498 Ga0070683_100006293
499 Ga0070683_100049246
500 Ga0070683_100162543
501 Ga0070683_100277340
502 Ga0070690_100009394
503 Ga0070670_100029146
504 Ga0068869_100956033
505 Ga0070666_10016901
506 Ga0070680_100016470
507 Ga0070680_100149295
508 Ga0070682_100245503
509 Ga0068868_100003638
510 Ga0070660_100110463
511 Ga0070660_100244902
512 Ga0070660_100252984
513 Ga0070660_100803468
514 Ga0070689_100002552
515 Ga0070689_100024548
516 Ga0070689_100432189
517 Ga0070691_10157476
518 Ga0070661_100215039
519 Ga0070692_10089696
520 Ga0070668_100120129
521 Ga0070675_100132794
522 Ga0070675_100811068
523 Ga0070671_100013955
524 Ga0070671_100035819
525 Ga0070671_100092506
526 Ga0070673_100025765
527 Ga0070688_100093382
528 Ga0070688_100185839
529 Ga0070667_100004405
530 Ga0070667_100287912
531 Ga0070709_10139784
532 Ga0070709_10553060
533 Ga0070714_100094111
534 Ga0070714_100119975
535 Ga0070714_100914529
536 Ga0070713_100392522
537 Ga0070713_100472857
538 Ga0070710_10074195
539 Ga0070710_10214553
540 Ga0070711_100119979
541 Ga0070711_100182661
542 Ga0070711_101012958
543 Ga0070705_100732991
544 Ga0070700_100298718
545 Ga0070708_100101766
546 Ga0070708_100170106
547 Ga0070708_100172083
548 Ga0070708_100256040
549 Ga0070663_100045081
550 Ga0070663_100170317
551 Ga0070678_100264697
552 Ga0070662_100012776
553 Ga0070662_100790551
554 Ga0070681_10066699
555 Ga0070681_10072150
556 Ga0070681_10089186
557 Ga0070685_10059372
558 Ga0070707_100005403
559 Ga0070707_100110201
560 Ga0070707_100440300
561 Ga0070698_100004384
562 Ga0070698_100155769
563 Ga0070699_100034874
564 Ga0070679_100000506
565 Ga0070679_100086813
566 Ga0070679_100250747
567 Ga0070684_100001480
568 Ga0070684_100033806
569 Ga0070684_100047836
570 Ga0070697_100029246
571 Ga0070697_100036997
572 Ga0070697_100117946
573 Ga0070697_100418927
574 Ga0070672_100232718
575 Ga0070686_100016545
576 Ga0070695_100499991
577 Ga0070665_100853865
578 Ga0070665_100881804
579 Ga0068855_100000818
580 Ga0068855_100048192
581 Ga0068855_100129281
582 Ga0068855_100321051
583 Ga0068855_100345042
584 Ga0070664_100004396
585 Ga0070664_100096999
586 Ga0068857_100003302
587 Ga0068856_100000649
588 Ga0068856_100075159
589 Ga0068856_100163897
590 Ga0068856_100262836
591 Ga0070702_100127834
592 Ga0068852_100000779
593 Ga0068852_100093346
594 Ga0068864_100003309
595 Ga0068864_100103669
596 Ga0068861_100559168
597 Ga0068863_100003877
598 Ga0068863_100027867
599 Ga0068863_100189282
600 Ga0068863_100276726
601 Ga0068858_100276817
602 Ga0068860_100007487
603 Ga0068860_100025398
604 Ga0081455_10005310
605 Ga0081455_10006228
606 Ga0081455_10028340
607 Ga0081455_10034490
608 Ga0081455_10054596
609 Ga0081455_10084111
610 Ga0081455_10088228
611 Ga0081455_10115168
612 Ga0081540_1016917
613 Ga0081539_10055503
614 Ga0081539_10062445
615 Ga0070717_10045228
616 Ga0070717_10046888
617 Ga0070717_10063167
618 Ga0070717_10427302
619 Ga0070715_10054543
620 Ga0070716_100044485
621 Ga0070716_100064400
622 Ga0070712_100119804
623 Ga0070712_100782948
624 Ga0097621_100012790
625 Ga0097621_100124962
626 Ga0068871_100038056
627 Ga0068871_100144018
628 Ga0075428_100283977
629 Ga0075434_100172981
630 Ga0075436_100808674
631 Ga0099795_10111411
632 Ga0111539_10762385
633 Ga0105245_10004487
634 Ga0105245_10071735
635 Ga0105245_10138679
636 Ga0105245_10414011
637 Ga0105245_11087899
638 Ga0105247_10028674
639 Ga0105247_10065692
640 Ga0114129_10206831
641 Ga0114129_11552634
642 Ga0105241_10092760
643 Ga0105241_10359425
644 Ga0105242_10282809
645 Ga0105248_10014626
646 Ga0105248_10272428
647 Ga0105237_10460890
648 Ga0105237_11294632
649 Ga0105238_10006987
650 Ga0105238_10023519
651 Ga0105238_10141605
652 Ga0105238_11016885
653 Ga0105249_10024095
654 Ga0105249_10586147
655 Ga0105239_10017220
656 Ga0105239_10200641
657 Ga0105239_10504512
658 Ga0105246_10035536
659 Ga0105246_10039042
660 Ga0157336_1003264
661 Ga0157373_10319300
662 Ga0157371_10014422
663 Ga0157369_10129170
664 Ga0157369_11334641
665 Ga0157374_10056753
666 Ga0157374_10104515
667 Ga0157374_10143872
668 Ga0157374_10239446
669 Ga0157374_10306228
670 Ga0157374_10313588
671 Ga0157374_10448303
672 Ga0157374_10480533
673 Ga0157374_10838414
674 Ga0157374_11514110
675 Ga0157378_10022345
676 Ga0157378_10174847
677 Ga0157378_10229931
678 Ga0157378_10619656
679 Ga0163162_10015942
680 Ga0163162_10906535
681 Ga0163162_10927882
682 Ga0157372_10033275
683 Ga0157372_10288936
684 Ga0157372_10328563
685 Ga0157372_10953258
686 Ga0157375_10003300
687 Ga0157375_10025020
688 Ga0157375_10085536
689 Ga0157375_10324351
690 Ga0163163_10081932
691 Ga0163163_10299730
692 Ga0157380_11086082
693 Ga0157377_10006181
694 Ga0157377_10459803
695 Ga0157379_10062882
696 Ga0157379_10187369
697 Ga0157376_10028203
698 Ga0157376_10159203
699 Ga0157376_10194258
700 Ga0157376_10315944
701 Ga0157376_10335543
702 Ga0157376_10935746
703 Ga0163161_10134458
704 Ga0207666_1003249
705 Ga0207673_1001333
706 Ga0207697_10000633
707 Ga0207697_10067061
708 Ga0207653_10022027
709 Ga0207692_10372034
710 Ga0207710_10012030
711 Ga0207688_10144863
712 Ga0207680_10081209
713 Ga0207647_10259722
714 Ga0207647_10374088
715 Ga0207699_10094131
716 Ga0207645_10113949
717 Ga0207705_10332754
718 Ga0207705_10374398
719 Ga0207684_10063201
720 Ga0207707_10008771
721 Ga0207707_10659539
722 Ga0207693_10036553
723 Ga0207693_10055355
724 Ga0207693_10168746
725 Ga0207663_10492482
726 Ga0207660_10005771
727 Ga0207660_10030572
728 Ga0207662_10211909
729 Ga0207657_10065395
730 Ga0207657_10139055
731 Ga0207657_10242925
732 Ga0207649_10447348
733 Ga0207652_10000499
734 Ga0207652_10100162
735 Ga0207646_10006655
736 Ga0207646_10301944
737 Ga0207694_10001798
738 Ga0207650_10038426
739 Ga0207659_10011937
740 Ga0207687_10014735
741 Ga0207687_10055598
742 Ga0207700_10007425
743 Ga0207700_10350939
744 Ga0207664_10123367
745 Ga0207644_10093374
746 Ga0207644_10650781
747 Ga0207706_10299652
748 Ga0207709_10094445
749 Ga0207670_10005557
750 Ga0207670_10016925
751 Ga0207670_10067839
752 Ga0207704_10353415
753 Ga0207665_10023238
754 Ga0207665_10063826
755 Ga0207665_10775425
756 Ga0207691_10133586
757 Ga0207711_10001644
758 Ga0207711_10338767
759 Ga0207689_10435202
760 Ga0207661_10092820
761 Ga0207661_10186578
762 Ga0207661_10551956
763 Ga0207679_10105800
764 Ga0207667_10000415
765 Ga0207667_10723460
766 Ga0207651_10121111
767 Ga0207712_10034283
768 Ga0207658_10170082
769 Ga0207658_10250786
770 Ga0207677_10457656
771 Ga0207703_10012795
772 Ga0207639_10453569
773 Ga0207678_10003665
774 Ga0207678_10267249
775 Ga0207702_10000591
776 Ga0207702_10000965
777 Ga0207702_10761570
778 Ga0207641_10050381
779 Ga0207641_10150904
780 Ga0207641_10243197
781 Ga0207676_10114740
782 Ga0207674_10145832
783 Ga0207675_101485062
784 Ga0207683_10015753
785 Ga0207698_10090415
786 Ga0268266_10052384
787 Ga0268266_10112771
788 Ga0268265_10497835
789 Ga0268264_10085299
790 Ga0265334_10096746
791 Ga0265318_10015554
792 Ga0265323_10000295
793 Ga0265323_10039834
794 Ga0265336_10047479
795 Ga0265338_10004111
796 Ga0265338_10004516
797 Ga0265338_10047494
798 Ga0265338_10091891
799 Ga0265338_10266136
800 Ga0265338_10462504
801 Ga0265330_10000087
802 Ga0265330_10046215
803 Ga0265330_10217417
804 Ga0265320_10014868
805 Ga0265320_10017930
806 Ga0265320_10163012
807 Ga0265325_10000064
808 Ga0265325_10027533
809 Ga0265329_10023331
810 Ga0265329_10078973
811 Ga0265340_10000225
812 Ga0265340_10068314
813 Ga0265339_10000268
814 Ga0265339_10014051
815 Ga0265339_10039272
816 Ga0265339_10235646
817 Ga0265316_10006343
818 Ga0265316_10069346
819 Ga0265313_10015316
820 Ga0265313_10112273
821 Ga0265313_10222722
822 Ga0316579_10020608
823 Ga0265314_10000067
824 Ga0265314_10013653
825 Ga0265314_10082262
826 Ga0265342_10000067
827 Ga0265342_10023554
828 Ga0265342_10063274
829 Ga0265342_10322494
830 Ga0316578_10114072
831 Ga0316577_10230161
832 Ga0316583_10002049
833 Ga0373926_0167265
834 Ga0373923_0129574
835 Ga0373953_0182345
836 Ga0373954_0160880
837 Ga0373956_0036494
838 Ga0373943_0012890
839 Ga0373955_0523240
840 Ga0373931_0137233
841 Ga0373927_0764885
842 Ga0373933_0051354
843 Ga0373947_0060241
844 Ga0373937_0007554
845 Ga0373937_0176726
846 Ga0373937_0382563
847 Ga0316582_0102805
848 Ga0373925_0442292
849 Ga0395899_0127282
850 Ga0395899_0218642
851 Ga0395900_0002016
852 Ga0395900_0181668
853 Ga0395900_0256296
854 Ga0395898_0115799
855 Ga0395898_0198553
856 Ga0395898_0237474
857 Ga0395898_0302856
858 Ga0395905_0005024
859 Ga0395905_0226969
860 Ga0395901_0003034
861 Ga0395901_0058616
862 Ga0395901_0087741
863 Ga0395901_0564357
864 Ga0451789_0674246
865 Ga0451802_0026154
866 Ga0451839_0160265
867 Ga0439458_0026064
868 Ga0439458_0060388
869 Ga0466964_0063474
870 Ga0453684_0291861
871 Ga0451576_1334180
872 Ga0466967_0629874
873 Ga0466967_0821347
874 Ga0495592_0023819
875 Ga0495603_0013315
876 Ga0495629_0314049
877 Ga0495641_0309047
878 Ga0495641_0328730
879 Ga0495580_0000504
880 Ga0495580_0226185
881 Ga0495662_0154648
882 Ga0495583_0007134
883 Ga0495608_0128484
884 Ga0495628_0080022
885 Ga0495628_0557943
886 Ga0495630_0572449
887 Ga0495665_0297460
888 Ga0495640_0424937
889 Ga0495587_0202671
890 Ga0495645_0071118
891 Ga0495667_0242403
892 Ga0495635_0168710
893 Ga0495657_0253113
894 Ga0495599_0004467
895 Ga0495646_0014278
896 Ga0495669_0021855
897 Ga0495624_0412250
898 Ga0495674_0010027
899 Ga0495674_0031926
900 Ga0495680_0721589
901 Ga0495684_0014921
902 Ga0495602_0314141
903 Ga0496100_0288534
904 Ga0496102_0096286
905 Ga0496102_0119186
906 Ga0496102_0345415
907 Ga0496104_0006204
908 Ga0496104_0275102
909 Ga0496104_0591669
910 Ga0496104_0734040
911 Ga0496105_0042391
912 Ga0496105_0219430
913 Ga0496106_0095394
914 Ga0496106_0155157
915 Ga0496106_0187353
916 Ga0496106_0408932
917 Ga0496108_0016539
918 Ga0496108_0020345
919 Ga0496109_0018202
920 Ga0496109_0040706
921 Ga0496109_0089945
922 Ga0496110_0251991
923 Ga0496113_0003243
924 Ga0496114_0001027
925 Ga0496114_0058697
926 Ga0496114_0067633
927 Ga0496115_0009055
928 Ga0496115_0020928
929 Ga0496115_0351799
930 Ga0495682_0007389
931 Ga0501031_0000127
932 Ga0501032_0007725
933 Ga0501033_0000002
934 Ga0501033_0003955
935 Ga0501036_0572851
936 Ga0501035_0007703
937 Ga0501044_0000679
938 nmdc:mga05p37_100237_c1
939 nmdc:mga05p37_1140529_c1
940 nmdc:mga09592_73230_c1
941 nmdc:mga08y16_1247667_c1
942 nmdc:mga08y16_156199_c1
943 nmdc:mga0a205_254677_c1
944 Ga0495601_0093075
945 Ga0500650_0025187
946 Ga0500636_0246106
947 2512345878
948 2515683874
949 2885280093
950 2902685273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01184

Gpr1_Fun34_YaaH

GPR1/FUN34/yaaH family

30

225

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zug-assembly1.cif.gz_F structure of the bacterial acetate channel satp 0.8687 12 180
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.8668 12 184
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.8133 12 184
5zug-assembly1.cif.gz_F structure of the bacterial acetate channel satp 0.8095 12 180
6nsj-assembly1.cif.gz_A cryoem structure of helicobacter pylori urea channel in closed state 0.6171 17 167
ID Description Score Start End Superfamily
af_D4AAI6_118_239_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6201 102 179 1.20.58.390
6nsjA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;AmiS/UreI transporter 0.6171 17 167 1.25.40.600
6nsjA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;AmiS/UreI transporter 0.5302 17 167 1.25.40.600
1ug9A02 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5209 23 88 1.50.10.10
af_A0A1D6PN73_24_119_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.5159 104 166 1.20.120.290
ID Description Score Start End GO Terms
AF-W1Y286-F1-model_v4 Inner membrane protein yaaH 0.9599 22 125 GO:0005886
GO:0015360
GO:0071422
AF-A0A7H4M0C5-F1-model_v4 YaaH protein 0.9483 12 119 GO:0005886
GO:0015360
GO:0071422
AF-A0A1U9LHG9-F1-model_v4 Transcriptional regulator 0.9482 22 167 GO:0005886
GO:0015360
GO:0071422
AF-A0A139DRL5-F1-model_v4 deleted 0.9465 60 167
AF-A0A7X1EUF4-F1-model_v4 deleted 0.9465 73 167

Map