F451247

General Info

Members Datasets Scaffolds Average Seq Length
474 425 948 183

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0076826|Ga0495686_0076826_143_730
Length 195
Sequence MKASEADILFISGYGNSGPDHWQTRWQSKLASARRVEQHSWHEPVREHWEQSIAEAIKAAEKPVVLVAHSLGIGPALQAVQALPESKEKIAGAFLVSPPNLLQPPQLPLGLELDRMNSFGPYPRDPLPFPSITVASRDDPYGTYEHAGDIANAWGSLLVDAGNSGHINVDSGHGPWPEGTMVFAQFLSRLKHPTS

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
36 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
37 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
38 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
39 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
72 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
83 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
84 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
123 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
124 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
125 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
126 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
128 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
129 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
130 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
131 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
132 2509276019 Ensifer aridi TW10 Isolate Nodule
133 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
134 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
135 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
136 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
137 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
138 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
139 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
140 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
141 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
142 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
143 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
144 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
145 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
146 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
147 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
148 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
149 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
150 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
151 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
152 2516143018 Ensifer sp. BR816 Isolate Nodule
153 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
154 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
155 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
156 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
157 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
158 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
159 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
160 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
161 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
162 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
163 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
164 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
165 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
166 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
167 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
168 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
169 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
170 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
171 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
172 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
173 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
174 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
175 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
176 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
177 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
178 2643221568 Rhizobium sp. Root564 Isolate Unclassified
179 2643221580 Devosia sp. Root635 Isolate Unclassified
180 2643221591 Devosia sp. Root685 Isolate Unclassified
181 2643221599 Rhizobium sp. Root708 Isolate Unclassified
182 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
183 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
184 2643221674 Devosia sp. Root436 Isolate Unclassified
185 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
186 2643221719 Rhizobium sp. Root274 Isolate Unclassified
187 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
188 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
189 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
190 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
191 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
192 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
193 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
194 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
195 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
196 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
197 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
198 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
199 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
200 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
201 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
202 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
203 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
204 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
205 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
206 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
207 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
208 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
209 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
210 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
211 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
212 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
213 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
214 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
215 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
216 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
217 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
218 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
219 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
220 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
221 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
222 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
223 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
224 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
225 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
226 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
227 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
228 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
229 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
230 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
231 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
232 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
233 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
234 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
235 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
236 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
237 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
238 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
239 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
240 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
241 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
242 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
243 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
244 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
245 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
246 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
247 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
248 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
249 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
250 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
251 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
252 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
253 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
254 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
255 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
256 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
257 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
258 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
259 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
260 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
261 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
262 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
263 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
264 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
265 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
266 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
267 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
268 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
269 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
270 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
271 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
272 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
273 2932401849 Devosia sp. 2618 Isolate Rhizosphere
274 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
275 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
276 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
277 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
278 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
279 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
280 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
281 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
282 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
283 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
284 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
285 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
286 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
287 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
288 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
289 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
290 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
291 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
292 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
293 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
294 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
295 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
296 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
297 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
298 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
299 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
300 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
301 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
302 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
303 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
304 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
305 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
306 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
307 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
308 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
309 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
310 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
311 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
312 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
313 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
314 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
315 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
316 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
317 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
318 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
319 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
320 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
321 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
322 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
323 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
324 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
325 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
326 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
327 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
328 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
329 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
330 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
331 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
332 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
333 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
334 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
335 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
336 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
337 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
338 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
339 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
340 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
341 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
342 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
343 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
344 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
345 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
346 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
347 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
348 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
349 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
350 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
351 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
352 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
353 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
354 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
355 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
356 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
357 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
358 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
359 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
360 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
361 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
362 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
363 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
364 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
365 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
366 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
367 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
368 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
369 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
370 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
371 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
372 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
373 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
374 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
375 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
376 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
377 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
378 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
379 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
380 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
381 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
382 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
383 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
384 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
385 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
386 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
387 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
388 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
389 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
390 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
391 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
392 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
393 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
394 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
395 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
396 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
397 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
398 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
399 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
400 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
401 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
402 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
403 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
404 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
405 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
406 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
407 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
408 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
409 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
410 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
411 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
412 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
413 2996887358 Rhizobium sp. R711 Isolate Nodule
414 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
415 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
416 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
417 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
418 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
419 8005258706 Rhizobium sp. R693 Isolate Nodule
420 8005321885 Rhizobium sp. R72 Isolate Nodule
421 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
422 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
423 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
424 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
425 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.55
Metatranscriptomes 0.21
Isolates 62.24

Biome Distribution

Category Percentage (%)
Aerial Root 1.05
Bulb 0
Endosphere 10.55
Nodule 53.59
Rhizoplane 2.32
Rhizosphere 18.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0076826 3300047472 Bacteria 2046
2 JGI25152J39213_1001656 3300002773 Bacteria 9269
3 JGI25152J39213_1003532 3300002773 Bacteria 5295
4 JGI25151J46595_10005630 3300003187 Bacteria 6440
5 JGI25160J50197_1023363 3300003354 Bacteria 1784
6 Ga0006562J51391_1037506 3300003578 Bacteria 1872
7 Ga0055526_1030658 3300003771 Bacteria 1563
8 Ga0055536_1005375 3300003781 Bacteria 6275
9 Ga0055528_1023994 3300003790 Bacteria 1843
10 Ga0055530_10017460 3300003791 Bacteria 2250
11 Ga0055540_1001610 3300003792 Bacteria 13152
12 Ga0055540_1021890 3300003792 Bacteria 1648
13 Ga0055531_10003225 3300003794 Bacteria 10464
14 Ga0058692_1002284 3300003856 Bacteria 6488
15 Ga0058692_1002551 3300003856 Bacteria 6035
16 Ga0065165_1012974 3300005262 Bacteria 3347
17 Ga0070668_100074352 3300005347 Bacteria 2651
18 Ga0070668_100762512 3300005347 Bacteria 857
19 Ga0070674_100272484 3300005356 Bacteria 1338
20 Ga0070663_100211166 3300005455 Bacteria 1520
21 Ga0070662_100839024 3300005457 Bacteria 782
22 Ga0070685_10627032 3300005466 Bacteria 776
23 Ga0070665_101124056 3300005548 Bacteria 797
24 Ga0068861_101515921 3300005719 Bacteria 658
25 Ga0075365_10003630 3300006038 Bacteria 7996
26 Ga0075365_10055277 3300006038 Bacteria 2634
27 Ga0075365_10548076 3300006038 Bacteria 818
28 Ga0075364_10002635 3300006051 Bacteria 10077
29 Ga0075369_10004997 3300006186 Bacteria 4935
30 Ga0075369_10202832 3300006186 Bacteria 915
31 Ga0079104_1003268 3300006946 Bacteria 7745
32 Ga0099826_10103574 3300006948 Bacteria 1711
33 Ga0099826_10190827 3300006948 Bacteria 1131
34 Ga0105251_10022045 3300009011 Bacteria 3316
35 Ga0105249_11210348 3300009553 Bacteria 826
36 Ga0123342_1025113 3300009766 Bacteria 3636
37 Ga0105239_10451296 3300010375 Bacteria 1459
38 Ga0105246_10088529 3300011119 Bacteria 2225
39 Ga0105246_10133937 3300011119 Bacteria 1855
40 Ga0157373_10148237 3300013100 Bacteria 1651
41 Ga0157371_10018977 3300013102 Bacteria 5076
42 Ga0157369_11192392 3300013105 Bacteria 777
43 Ga0157372_10096971 3300013307 Bacteria 3361
44 Ga0214544_1010070 3300021320 Bacteria 14244
45 Ga0214542_1000245 3300021321 Bacteria 90699
46 Ga0214542_1018074 3300021321 Bacteria 6107
47 Ga0214543_1000010 3300021327 Bacteria 364844
48 Ga0214543_1000134 3300021327 Bacteria 102056
49 Ga0228711_1000007 3300022739 Bacteria 202413
50 Ga0228710_1000007 3300022740 Bacteria 189104
51 Ga0209129_1000069 3300025258 Bacteria 212790
52 Ga0209129_1001650 3300025258 Bacteria 12079
53 Ga0209673_1003229 3300025273 Bacteria 9863
54 Ga0209676_1007274 3300025292 Bacteria 5248
55 Ga0209025_1000445 3300025294 Bacteria 81092
56 Ga0209025_1003067 3300025294 Bacteria 16404
57 Ga0209025_1018451 3300025294 Bacteria 3951
58 Ga0209564_1025617 3300025295 Bacteria 1976
59 Ga0209758_1011266 3300025297 Bacteria 5205
60 Ga0209758_1011680 3300025297 Bacteria 5046
61 Ga0209050_1004324 3300025298 Bacteria 9694
62 Ga0207426_1001779 3300025302 Bacteria 16197
63 Ga0209051_1002402 3300025303 Bacteria 13472
64 Ga0209051_1007428 3300025303 Bacteria 5990
65 Ga0209051_1044802 3300025303 Bacteria 1538
66 Ga0209257_1002537 3300025304 Bacteria 17887
67 Ga0207713_1079393 3300025735 Bacteria 1185
68 Ga0207668_10377518 3300025972 Bacteria 1192
69 Ga0207658_10375105 3300025986 Bacteria 1245
70 Ga0209281_1000128 3300027111 Bacteria 199265
71 Ga0209281_1000647 3300027111 Bacteria 37601
72 Ga0209371_1000058 3300027312 Bacteria 237920
73 Ga0209371_1003414 3300027312 Bacteria 7765
74 Ga0209282_1000034 3300027666 Bacteria 140100
75 Ga0209282_1054798 3300027666 Bacteria 2261
76 Ga0268266_10007789 3300028379 Bacteria 9605
77 Ga0307515_10000198 3300028794 Bacteria 147738
78 Ga0307515_10150412 3300028794 Bacteria 2437
79 Ga0268256_1000056 3300030500 Bacteria 231684
80 Ga0268256_1005841 3300030500 Bacteria 4726
81 Ga0265328_10013867 3300031239 Bacteria 3181
82 Ga0265331_10007386 3300031250 Bacteria 6363
83 Ga0265327_10019212 3300031251 Bacteria 4209
84 Ga0265316_10035333 3300031344 Bacteria 4050
85 Ga0307513_10009296 3300031456 Bacteria 12447
86 Ga0307513_10398546 3300031456 Bacteria 1111
87 Ga0307408_100143420 3300031548 Bacteria 1877
88 Ga0307410_10047021 3300031852 Bacteria 2882
89 Ga0307410_11079395 3300031852 Bacteria 695
90 Ga0307412_10062559 3300031911 Bacteria 2507
91 Ga0315914_1000010 3300031967 Bacteria 171642
92 Ga0307416_101259942 3300032002 Bacteria 845
93 Ga0307414_10056587 3300032004 Bacteria 2752
94 Ga0307414_10155949 3300032004 Bacteria 1807
95 Ga0307414_10282733 3300032004 Bacteria 1395
96 Ga0307414_10834508 3300032004 Bacteria 842
97 Ga0307510_10123715 3300033180 Bacteria 2283
98 Ga0315913_1000005 3300033430 Bacteria 171651
99 Ga0315915_1000012 3300033464 Bacteria 199284
100 Ga0373927_0003766 3300035695 Bacteria 10769
101 Ga0373925_0012536 3300037068 Bacteria 6142
102 Ga0395899_0000059 3300037312 Bacteria 213004
103 Ga0395900_0000017 3300037418 Bacteria 369602
104 Ga0395898_0000030 3300037466 Bacteria 369577
105 Ga0395905_0000056 3300037471 Bacteria 209230
106 Ga0395901_0000015 3300038443 Bacteria 373388
107 Ga0439436_0058972 3300041404 Bacteria 1076
108 Ga0439465_0224688 3300041413 Bacteria 689
109 Ga0451843_1069798 3300041509 Bacteria 1171
110 Ga0439445_0041847 3300042004 Bacteria 1219
111 Ga0439462_0152555 3300042015 Bacteria 650
112 Ga0451577_0051832 3300042876 Bacteria 3664
113 Ga0453684_0001752 3300044712 Bacteria 58035
114 Ga0495627_033349 3300046453 Bacteria 1615
115 Ga0495607_0033627 3300046501 Bacteria 3119
116 Ga0495637_0124742 3300046520 Bacteria 988
117 Ga0495643_0167703 3300046522 Bacteria 1076
118 Ga0495687_066809 3300047443 Bacteria 1458
119 Ga0496102_0055523 3300048905 Bacteria 3611
120 Ga0496102_0584235 3300048905 Bacteria 1040
121 Ga0496104_0060321 3300048907 Bacteria 3594
122 Ga0496105_0046191 3300048908 Bacteria 3594
123 Ga0496108_0149077 3300048911 Bacteria 2018
124 Ga0496110_0565539 3300048913 Bacteria 1033
125 Ga0496111_0000912 3300048914 Bacteria 16096
126 Ga0496112_1147429 3300048915 Bacteria 695
127 Ga0496116_0013803 3300048919 Bacteria 6487
128 Ga0496116_0034073 3300048919 Bacteria 3601
129 Ga0496117_0013285 3300048920 Bacteria 7195
130 Ga0496118_0007978 3300048921 Bacteria 11065
131 Ga0496119_0049827 3300048922 Bacteria 2586
132 Ga0496119_0215764 3300048922 Bacteria 984
133 Ga0496120_0356482 3300048923 Bacteria 656
134 Ga0496121_0000751 3300048924 Bacteria 59594
135 Ga0496121_0095380 3300048924 Bacteria 2312
136 Ga0496122_0011065 3300048925 Bacteria 9205
137 Ga0496122_0011969 3300048925 Bacteria 8704
138 Ga0496122_0019563 3300048925 Bacteria 6176
139 Ga0496123_0024679 3300048926 Bacteria 4562
140 Ga0496123_0049976 3300048926 Bacteria 2798
141 Ga0496123_0070129 3300048926 Bacteria 2195
142 Ga0496123_0120383 3300048926 Bacteria 1478
143 Ga0496124_0003458 3300048927 Bacteria 19299
144 Ga0496124_0004380 3300048927 Bacteria 16510
145 Ga0496124_0035222 3300048927 Bacteria 4382
146 Ga0496124_0039486 3300048927 Bacteria 4092
147 Ga0496124_0302446 3300048927 Bacteria 1154
148 Ga0496124_0311533 3300048927 Bacteria 1131
149 Ga0496125_0200860 3300048928 Bacteria 1305
150 Ga0496125_0206445 3300048928 Bacteria 1280
151 Ga0496126_0000397 3300048929 Bacteria 89305
152 Ga0496126_0001855 3300048929 Bacteria 30802
153 Ga0496126_0328575 3300048929 Bacteria 1255
154 Ga0501033_0122295 3300049570 Bacteria 1888
155 Ga0501034_0379587 3300049571 Bacteria 1338
156 Ga0501037_0529942 3300049573 Bacteria 797
157 Ga0501038_0079432 3300049574 Bacteria 2766
158 Ga0501047_0510823 3300049581 Bacteria 1028
159 Ga0501070_0159400 3300049586 Bacteria 1861
160 Ga0501280_001372 3300049776 Bacteria 4568
161 Ga0501280_006563 3300049776 Bacteria 1639
162 Ga0501035_0091973 3300049822 Bacteria 2669
163 Ga0501044_0285490 3300049823 Bacteria 1583
164 nmdc:mga00v17_391_c1 3300050491 Bacteria 12474
165 nmdc:mga0yw44_12077_c1 3300050492 Bacteria 4159
166 nmdc:mga0sz30_13326_c1 3300050516 Bacteria 2878
167 nmdc:mga0sz30_49348_c1 3300050516 Bacteria 1783
168 Ga0500560_018977 3300053107 Bacteria 1927
169 Ga0500572_001603 3300053111 Bacteria 5974
170 Ga0500618_028940 3300053125 Bacteria 1309
171 Ga0500573_0353462 3300053140 Bacteria 713
172 Ga0500604_0016763 3300053151 Bacteria 2021
173 Ga0500616_0000805 3300053153 Bacteria 35836
174 Ga0500616_0050242 3300053153 Bacteria 2203
175 Ga0500624_001974 3300053157 Bacteria 2924
176 Ga0500634_0063593 3300053161 Bacteria 1951
177 Ga0500634_0166313 3300053161 Bacteria 1011
178 Ga0500636_0000015 3300053177 Bacteria 123980
179 Ga0500636_0001080 3300053177 Bacteria 14590
180 2509107576 2508501122 Bacteria 6292184
181 2509375908 2509276019 Bacteria 6802256
182 2510306373 2510065057 Bacteria 6649661
183 2510841624 2510461069 Bacteria 5505000
184 2511174039 2510917026 Bacteria 7046020
185 2511182317 2510917028 Bacteria 6185411
186 2511501728 2511231052 Bacteria 6974333
187 2512533179 2512047086 Bacteria 6850303
188 2512971317 2512875026 Bacteria 6861065
189 2513585311 2513237086 Bacteria 7265287
190 2513594541 2513237088 Bacteria 6927906
191 2513604027 2513237089 Bacteria 6553624
192 2513619716 2513237091 Bacteria 6900273
193 2513708782 2513237103 Bacteria 7647401
194 2513864599 2513237138 Bacteria 7368160
195 2513883707 2513237140 Bacteria 7076289
196 2513905411 2513237143 Bacteria 6664116
197 2513926290 2513237146 Bacteria 7166346
198 2513988004 2513237156 Bacteria 6402557
199 2514006253 2513237160 Bacteria 6650282
200 2515608599 2515154107 Bacteria 6795637
201 2516209443 2516143018 Bacteria 6951533
202 2516893028 2516653046 Bacteria 6989037
203 2517569800 2517487022 Bacteria 7227575
204 2524453008 2524023207 Bacteria 6813453
205 2535516454 2534681796 Bacteria 7146037
206 2537873763 2537561587 Bacteria 5425293
207 2551677776 2551306084 Bacteria 8942552
208 2551686329 2551306085 Bacteria 7347181
209 2551694798 2551306086 Bacteria 6843938
210 2551697988 2551306087 Bacteria 7351905
211 2551709463 2551306089 Bacteria 7162724
212 2551717130 2551306090 Bacteria 7953713
213 2551730450 2551306091 Bacteria 7086830
214 2551738163 2551306092 Bacteria 6992595
215 2551743015 2551306093 Bacteria 7064773
216 2558868182 2558860100 Bacteria 8458965
217 2585165944 2582581283 Bacteria 6030556
218 2585200120 2582581294 Bacteria 6626667
219 2585323831 2582581315 Bacteria 7318924
220 2585331809 2582581316 Bacteria 7774528
221 2585401967 2582581867 Bacteria 7184437
222 2585821752 2585427590 Bacteria 6824633
223 2599417768 2599185170 Bacteria 7295545
224 2599601433 2599185210 Bacteria 5624189
225 2599721048 2599185236 Bacteria 6875203
226 2616557159 2615840698 Bacteria 7319877
227 2643854446 2643221568 Bacteria 5187270
228 2643911435 2643221580 Bacteria 3816678
229 2643963139 2643221591 Bacteria 4397626
230 2644003725 2643221599 Bacteria 6292121
231 2644239537 2643221643 Bacteria 5749658
232 2644298455 2643221653 Bacteria 4569637
233 2644413978 2643221674 Bacteria 3919126
234 2644501901 2643221689 Bacteria 6042950
235 2644656684 2643221719 Bacteria 4568197
236 2671111758 2667528174 Bacteria 6435400
237 2757570002 2757320392 Bacteria 3737298
238 2776913648 2775507049 Bacteria 6284736
239 2802719075 2802428858 Bacteria 6636079
240 2802727306 2802428859 Bacteria 6667919
241 2802732088 2802428860 Bacteria 6525526
242 2802739018 2802428861 Bacteria 6534206
243 2802744917 2802428862 Bacteria 6633353
244 2802752193 2802428863 Bacteria 6410669
245 2819241684 2818991272 Bacteria 4622173
246 2819559597 2818991439 Bacteria 6907412
247 2819612838 2818991448 Bacteria 6772224
248 2819687267 2818991461 Bacteria 7026071
249 2838030136 2838029111 Bacteria 6603031
250 2838078833 2838074704 Bacteria 6785777
251 2838676026 2838675328 Bacteria 4909118
252 2838714908 2838714209 Bacteria 5525906
253 2838721291 2838719591 Bacteria 5523910
254 2838725668 2838724970 Bacteria 4908691
255 2841848258 2841846520 Bacteria 5345850
256 2841859197 2841859092 Bacteria 5436171
257 2842125712 2842124991 Bacteria 5346824
258 2842130921 2842130223 Bacteria 4909145
259 2842153909 2842152218 Bacteria 4908957
260 2842171152 2842170452 Bacteria 5525737
261 2842177529 2842175837 Bacteria 4908771
262 2842188017 2842187318 Bacteria 5524014
263 2842212328 2842211629 Bacteria 5523832
264 2842226053 2842224351 Bacteria 5524473
265 2842476579 2842475841 Bacteria 6603183
266 2842503664 2842502639 Bacteria 6604161
267 2842515981 2842515876 Bacteria 5436280
268 2850081977 2850079185 Bacteria 6848280
269 2852389852 2852387548 Bacteria 8025568
270 2855825824 2855825444 Bacteria 6785811
271 2855841182 2855839649 Bacteria 7135830
272 2858801823 2858800743 Bacteria 6603254
273 2891051900 2891048133 Bacteria 4447501
274 2896390704 2896384573 Bacteria 7700774
275 2899794019 2899792073 Bacteria 4926588
276 2913301011 2913295892 Bacteria 6333755
277 2915981557 2915980308 Bacteria 6624279
278 2915989449 2915986958 Bacteria 6739310
279 2915997509 2915993759 Bacteria 7016183
280 2916001844 2916000859 Bacteria 6865702
281 2916009632 2916007675 Bacteria 6898660
282 2916018023 2916014648 Bacteria 6946486
283 2916027376 2916021584 Bacteria 6854472
284 2916034997 2916028427 Bacteria 6748433
285 2916038046 2916035215 Bacteria 6755766
286 2916048109 2916041962 Bacteria 6820487
287 2916050939 2916048683 Bacteria 6543552
288 2916055428 2916055098 Bacteria 6758838
289 2916066048 2916061851 Bacteria 6737736
290 2916070146 2916068649 Bacteria 6943657
291 2916080456 2916076590 Bacteria 6596108
292 2919114997 2919114240 Bacteria 5700270
293 2919168781 2919166419 Bacteria 4952238
294 2919175193 2919171160 Bacteria 6499771
295 2919411731 2919408235 Bacteria 6149349
296 2920766249 2920760137 Bacteria 7427611
297 2921204550 2921201388 Bacteria 6926299
298 2921214941 2921208531 Bacteria 6745326
299 2921240265 2921237296 Bacteria 6876710
300 2921247214 2921244191 Bacteria 6568419
301 2921255085 2921250672 Bacteria 6677771
302 2921261258 2921257292 Bacteria 6808382
303 2921267560 2921263974 Bacteria 6864552
304 2921289287 2921282425 Bacteria 6826397
305 2921293605 2921289301 Bacteria 7316391
306 2921297175 2921296804 Bacteria 7176999
307 2923557885 2923556063 Bacteria 6793593
308 2924146378 2924144063 Bacteria 6883928
309 2924154654 2924150972 Bacteria 7169444
310 2924159735 2924158325 Bacteria 7188855
311 2924168780 2924165586 Bacteria 7260590
312 2924177416 2924172951 Bacteria 6749356
313 2924180018 2924179722 Bacteria 6843264
314 2924189730 2924186466 Bacteria 6876637
315 2924196384 2924193448 Bacteria 6955718
316 2924205719 2924200457 Bacteria 6757188
317 2924211329 2924207177 Bacteria 6917007
318 2924217670 2924214083 Bacteria 7080103
319 2924228607 2924221636 Bacteria 7113495
320 2924232292 2924228884 Bacteria 6633132
321 2926755963 2926754445 Bacteria 5964435
322 2932402920 2932401849 Bacteria 4262978
323 2933008555 2933006813 Bacteria 4912075
324 2933011644 2933011516 Bacteria 5439334
325 2937002602 2936996657 Bacteria 6298727
326 2937006091 2937002841 Bacteria 6934057
327 2937010168 2937009748 Bacteria 6746052
328 2937022929 2937016420 Bacteria 6782579
329 2937025878 2937023124 Bacteria 6815156
330 2937032604 2937029754 Bacteria 6424026
331 2937041185 2937036028 Bacteria 6846469
332 2937044730 2937042894 Bacteria 6741576
333 2937051895 2937049772 Bacteria 6757901
334 2937057176 2937056579 Bacteria 7107896
335 2937066367 2937063883 Bacteria 7199456
336 2937073672 2937071275 Bacteria 6984483
337 2937079228 2937078374 Bacteria 6610289
338 2937085754 2937084907 Bacteria 6618516
339 2937098481 2937091812 Bacteria 6979387
340 2937099192 2937098957 Bacteria 7249374
341 2937112835 2937106411 Bacteria 6947143
342 2937116303 2937113482 Bacteria 6505872
343 2937120362 2937119839 Bacteria 6597547
344 2937127416 2937126314 Bacteria 6771275
345 2941503734 2941499720 Bacteria 7599444
346 2957381566 2957375807 Bacteria 6425588
347 2957387403 2957382221 Bacteria 6737050
348 2957391880 2957388812 Bacteria 6778072
349 2957399208 2957395598 Bacteria 6822399
350 2957403270 2957402308 Bacteria 6741770
351 2957410378 2957408893 Bacteria 6558585
352 2957419512 2957415311 Bacteria 6991633
353 2957426869 2957422303 Bacteria 7172205
354 2957434825 2957430029 Bacteria 7022557
355 2957443350 2957437181 Bacteria 6568994
356 2957447492 2957443900 Bacteria 6869977
357 2957456921 2957450854 Bacteria 6765715
358 2957462703 2957457609 Bacteria 6967680
359 2957467858 2957464669 Bacteria 6568877
360 2957477342 2957471148 Bacteria 6797643
361 2957481522 2957478035 Bacteria 6756658
362 2957488952 2957484790 Bacteria 6703082
363 2957496069 2957491536 Bacteria 6695180
364 2957499135 2957498199 Bacteria 7126688
365 2957509391 2957505466 Bacteria 7253085
366 2960584660 2960584000 Bacteria 6864594
367 2960597226 2960591022 Bacteria 6622873
368 2960598147 2960597568 Bacteria 6550735
369 2960610675 2960603979 Bacteria 6898737
370 2960614202 2960610863 Bacteria 6691244
371 2960618910 2960617483 Bacteria 6727748
372 2960625518 2960624210 Bacteria 6875384
373 2960631806 2960631154 Bacteria 6732508
374 2960642160 2960637947 Bacteria 7296468
375 2960651999 2960645483 Bacteria 7211087
376 2960656643 2960652885 Bacteria 7083688
377 2960664014 2960660292 Bacteria 7041660
378 2960672825 2960667422 Bacteria 6763020
379 2960675221 2960674078 Bacteria 6609048
380 2960687178 2960680706 Bacteria 6624464
381 2960691436 2960687367 Bacteria 6535474
382 2960697873 2960693952 Bacteria 6749742
383 2964612281 2964607997 Bacteria 7101408
384 2964616017 2964615318 Bacteria 6809089
385 2964628732 2964621998 Bacteria 6834995
386 2964632284 2964628898 Bacteria 7083044
387 2964638979 2964636051 Bacteria 7091832
388 2964646787 2964643177 Bacteria 6820887
389 2964654825 2964649959 Bacteria 6675118
390 2964659348 2964656573 Bacteria 7100150
391 2964669783 2964663802 Bacteria 7019362
392 2964673488 2964670856 Bacteria 6851364
393 2964679037 2964678106 Bacteria 6792020
394 2964685943 2964685014 Bacteria 6839111
395 2964695424 2964691889 Bacteria 6802758
396 2964701760 2964698721 Bacteria 6765331
397 2964711491 2964705432 Bacteria 7114648
398 2964715377 2964712639 Bacteria 6695970
399 2964720460 2964719344 Bacteria 7286602
400 2967666276 2967664464 Bacteria 6948836
401 2967675313 2967671571 Bacteria 7021409
402 2967682680 2967678726 Bacteria 7264382
403 2967687458 2967686174 Bacteria 6678622
404 2967699656 2967693043 Bacteria 6804451
405 2967704388 2967699805 Bacteria 6854538
406 2967708329 2967706974 Bacteria 7186053
407 2967715288 2967714385 Bacteria 7000047
408 2967726477 2967721400 Bacteria 7073753
409 2967729210 2967728569 Bacteria 6641507
410 2967741431 2967735183 Bacteria 6827012
411 2967745495 2967742019 Bacteria 6794534
412 2967753855 2967748971 Bacteria 6733771
413 2967757174 2967755722 Bacteria 6814706
414 2967763673 2967762386 Bacteria 6923502
415 2967771462 2967769361 Bacteria 6587838
416 2967781135 2967775926 Bacteria 6738189
417 2970022448 2970019648 Bacteria 7072033
418 2970031467 2970026789 Bacteria 6785236
419 2970038640 2970033650 Bacteria 7118744
420 2970045723 2970040964 Bacteria 6731123
421 2970052348 2970047711 Bacteria 7088379
422 2970058213 2970054988 Bacteria 6611507
423 2970068517 2970061556 Bacteria 7099761
424 2970073706 2970068827 Bacteria 7123112
425 2970078472 2970076120 Bacteria 6697332
426 2970087307 2970082768 Bacteria 6183754
427 2970092524 2970088815 Bacteria 6933825
428 2970099695 2970095765 Bacteria 6936963
429 2970105155 2970102677 Bacteria 6812532
430 2970110462 2970109326 Bacteria 6863976
431 2970117779 2970116247 Bacteria 6501857
432 2970126207 2970122695 Bacteria 6625855
433 2970130423 2970129317 Bacteria 6806560
434 2970137386 2970136068 Bacteria 7207982
435 2970146923 2970143518 Bacteria 6446480
436 2970150401 2970149975 Bacteria 6779706
437 2970159322 2970156795 Bacteria 7168044
438 2970166487 2970164137 Bacteria 6861252
439 2970172346 2970170962 Bacteria 6876229
440 2970182438 2970177841 Bacteria 6768001
441 2970185722 2970184632 Bacteria 7054431
442 2970192771 2970191845 Bacteria 7032787
443 2977517217 2977516862 Bacteria 6940108
444 2977527928 2977523885 Bacteria 6960446
445 2977532841 2977530762 Bacteria 6951399
446 2977542681 2977537788 Bacteria 6929320
447 2977549187 2977544691 Bacteria 6875412
448 2977552744 2977551784 Bacteria 7125765
449 2977562201 2977558990 Bacteria 6863948
450 2977569523 2977565890 Bacteria 6901543
451 2977574975 2977572785 Bacteria 6763888
452 2977586175 2977579622 Bacteria 6772100
453 2978971466 2978969890 Bacteria 5400756
454 2979103687 2979100975 Bacteria 5423623
455 2984511749 2984509177 Bacteria 5274802
456 2984521890 2984518228 Bacteria 5277463
457 2984541188 2984537506 Bacteria 5277481
458 2984588612 2984587000 Bacteria 5263363
459 2984603469 2984601300 Bacteria 5455244
460 2989778983 2989776772 Bacteria 4843317
461 2995395044 2995392953 Bacteria 4539380
462 2996891656 2996887358 Bacteria 5795980
463 648737398 648276728 Bacteria 6968865
464 8003571374 8003570095 Bacteria 5747666
465 8003993678 8003992118 Bacteria 7266902
466 8004001164 8003999396 Bacteria 7063185
467 8005248536 8005246636 Bacteria 4933972
468 8005262986 8005258706 Bacteria 6184835
469 8005326183 8005321885 Bacteria 5795980
470 8005485104 8005484373 Bacteria 6297373
471 8005545102 8005542996 Bacteria 7077758
472 8005645268 8005645114 Bacteria 6950293
473 8054462677 8054460903 Bacteria 4872905
474 8054562838 8054558443 Bacteria 5204801
475 Ga0495686_0076826
476 JGI25152J39213_1001656
477 JGI25152J39213_1003532
478 JGI25151J46595_10005630
479 JGI25160J50197_1023363
480 Ga0006562J51391_1037506
481 Ga0055526_1030658
482 Ga0055536_1005375
483 Ga0055528_1023994
484 Ga0055530_10017460
485 Ga0055540_1001610
486 Ga0055540_1021890
487 Ga0055531_10003225
488 Ga0058692_1002284
489 Ga0058692_1002551
490 Ga0065165_1012974
491 Ga0070668_100074352
492 Ga0070668_100762512
493 Ga0070674_100272484
494 Ga0070663_100211166
495 Ga0070662_100839024
496 Ga0070685_10627032
497 Ga0070665_101124056
498 Ga0068861_101515921
499 Ga0075365_10003630
500 Ga0075365_10055277
501 Ga0075365_10548076
502 Ga0075364_10002635
503 Ga0075369_10004997
504 Ga0075369_10202832
505 Ga0079104_1003268
506 Ga0099826_10103574
507 Ga0099826_10190827
508 Ga0105251_10022045
509 Ga0105249_11210348
510 Ga0123342_1025113
511 Ga0105239_10451296
512 Ga0105246_10088529
513 Ga0105246_10133937
514 Ga0157373_10148237
515 Ga0157371_10018977
516 Ga0157369_11192392
517 Ga0157372_10096971
518 Ga0214544_1010070
519 Ga0214542_1000245
520 Ga0214542_1018074
521 Ga0214543_1000010
522 Ga0214543_1000134
523 Ga0228711_1000007
524 Ga0228710_1000007
525 Ga0209129_1000069
526 Ga0209129_1001650
527 Ga0209673_1003229
528 Ga0209676_1007274
529 Ga0209025_1000445
530 Ga0209025_1003067
531 Ga0209025_1018451
532 Ga0209564_1025617
533 Ga0209758_1011266
534 Ga0209758_1011680
535 Ga0209050_1004324
536 Ga0207426_1001779
537 Ga0209051_1002402
538 Ga0209051_1007428
539 Ga0209051_1044802
540 Ga0209257_1002537
541 Ga0207713_1079393
542 Ga0207668_10377518
543 Ga0207658_10375105
544 Ga0209281_1000128
545 Ga0209281_1000647
546 Ga0209371_1000058
547 Ga0209371_1003414
548 Ga0209282_1000034
549 Ga0209282_1054798
550 Ga0268266_10007789
551 Ga0307515_10000198
552 Ga0307515_10150412
553 Ga0268256_1000056
554 Ga0268256_1005841
555 Ga0265328_10013867
556 Ga0265331_10007386
557 Ga0265327_10019212
558 Ga0265316_10035333
559 Ga0307513_10009296
560 Ga0307513_10398546
561 Ga0307408_100143420
562 Ga0307410_10047021
563 Ga0307410_11079395
564 Ga0307412_10062559
565 Ga0315914_1000010
566 Ga0307416_101259942
567 Ga0307414_10056587
568 Ga0307414_10155949
569 Ga0307414_10282733
570 Ga0307414_10834508
571 Ga0307510_10123715
572 Ga0315913_1000005
573 Ga0315915_1000012
574 Ga0373927_0003766
575 Ga0373925_0012536
576 Ga0395899_0000059
577 Ga0395900_0000017
578 Ga0395898_0000030
579 Ga0395905_0000056
580 Ga0395901_0000015
581 Ga0439436_0058972
582 Ga0439465_0224688
583 Ga0451843_1069798
584 Ga0439445_0041847
585 Ga0439462_0152555
586 Ga0451577_0051832
587 Ga0453684_0001752
588 Ga0495627_033349
589 Ga0495607_0033627
590 Ga0495637_0124742
591 Ga0495643_0167703
592 Ga0495687_066809
593 Ga0496102_0055523
594 Ga0496102_0584235
595 Ga0496104_0060321
596 Ga0496105_0046191
597 Ga0496108_0149077
598 Ga0496110_0565539
599 Ga0496111_0000912
600 Ga0496112_1147429
601 Ga0496116_0013803
602 Ga0496116_0034073
603 Ga0496117_0013285
604 Ga0496118_0007978
605 Ga0496119_0049827
606 Ga0496119_0215764
607 Ga0496120_0356482
608 Ga0496121_0000751
609 Ga0496121_0095380
610 Ga0496122_0011065
611 Ga0496122_0011969
612 Ga0496122_0019563
613 Ga0496123_0024679
614 Ga0496123_0049976
615 Ga0496123_0070129
616 Ga0496123_0120383
617 Ga0496124_0003458
618 Ga0496124_0004380
619 Ga0496124_0035222
620 Ga0496124_0039486
621 Ga0496124_0302446
622 Ga0496124_0311533
623 Ga0496125_0200860
624 Ga0496125_0206445
625 Ga0496126_0000397
626 Ga0496126_0001855
627 Ga0496126_0328575
628 Ga0501033_0122295
629 Ga0501034_0379587
630 Ga0501037_0529942
631 Ga0501038_0079432
632 Ga0501047_0510823
633 Ga0501070_0159400
634 Ga0501280_001372
635 Ga0501280_006563
636 Ga0501035_0091973
637 Ga0501044_0285490
638 nmdc:mga00v17_391_c1
639 nmdc:mga0yw44_12077_c1
640 nmdc:mga0sz30_13326_c1
641 nmdc:mga0sz30_49348_c1
642 Ga0500560_018977
643 Ga0500572_001603
644 Ga0500618_028940
645 Ga0500573_0353462
646 Ga0500604_0016763
647 Ga0500616_0000805
648 Ga0500616_0050242
649 Ga0500624_001974
650 Ga0500634_0063593
651 Ga0500634_0166313
652 Ga0500636_0000015
653 Ga0500636_0001080
654 2509107576
655 2509375908
656 2510306373
657 2510841624
658 2511174039
659 2511182317
660 2511501728
661 2512533179
662 2512971317
663 2513585311
664 2513594541
665 2513604027
666 2513619716
667 2513708782
668 2513864599
669 2513883707
670 2513905411
671 2513926290
672 2513988004
673 2514006253
674 2515608599
675 2516209443
676 2516893028
677 2517569800
678 2524453008
679 2535516454
680 2537873763
681 2551677776
682 2551686329
683 2551694798
684 2551697988
685 2551709463
686 2551717130
687 2551730450
688 2551738163
689 2551743015
690 2558868182
691 2585165944
692 2585200120
693 2585323831
694 2585331809
695 2585401967
696 2585821752
697 2599417768
698 2599601433
699 2599721048
700 2616557159
701 2643854446
702 2643911435
703 2643963139
704 2644003725
705 2644239537
706 2644298455
707 2644413978
708 2644501901
709 2644656684
710 2671111758
711 2757570002
712 2776913648
713 2802719075
714 2802727306
715 2802732088
716 2802739018
717 2802744917
718 2802752193
719 2819241684
720 2819559597
721 2819612838
722 2819687267
723 2838030136
724 2838078833
725 2838676026
726 2838714908
727 2838721291
728 2838725668
729 2841848258
730 2841859197
731 2842125712
732 2842130921
733 2842153909
734 2842171152
735 2842177529
736 2842188017
737 2842212328
738 2842226053
739 2842476579
740 2842503664
741 2842515981
742 2850081977
743 2852389852
744 2855825824
745 2855841182
746 2858801823
747 2891051900
748 2896390704
749 2899794019
750 2913301011
751 2915981557
752 2915989449
753 2915997509
754 2916001844
755 2916009632
756 2916018023
757 2916027376
758 2916034997
759 2916038046
760 2916048109
761 2916050939
762 2916055428
763 2916066048
764 2916070146
765 2916080456
766 2919114997
767 2919168781
768 2919175193
769 2919411731
770 2920766249
771 2921204550
772 2921214941
773 2921240265
774 2921247214
775 2921255085
776 2921261258
777 2921267560
778 2921289287
779 2921293605
780 2921297175
781 2923557885
782 2924146378
783 2924154654
784 2924159735
785 2924168780
786 2924177416
787 2924180018
788 2924189730
789 2924196384
790 2924205719
791 2924211329
792 2924217670
793 2924228607
794 2924232292
795 2926755963
796 2932402920
797 2933008555
798 2933011644
799 2937002602
800 2937006091
801 2937010168
802 2937022929
803 2937025878
804 2937032604
805 2937041185
806 2937044730
807 2937051895
808 2937057176
809 2937066367
810 2937073672
811 2937079228
812 2937085754
813 2937098481
814 2937099192
815 2937112835
816 2937116303
817 2937120362
818 2937127416
819 2941503734
820 2957381566
821 2957387403
822 2957391880
823 2957399208
824 2957403270
825 2957410378
826 2957419512
827 2957426869
828 2957434825
829 2957443350
830 2957447492
831 2957456921
832 2957462703
833 2957467858
834 2957477342
835 2957481522
836 2957488952
837 2957496069
838 2957499135
839 2957509391
840 2960584660
841 2960597226
842 2960598147
843 2960610675
844 2960614202
845 2960618910
846 2960625518
847 2960631806
848 2960642160
849 2960651999
850 2960656643
851 2960664014
852 2960672825
853 2960675221
854 2960687178
855 2960691436
856 2960697873
857 2964612281
858 2964616017
859 2964628732
860 2964632284
861 2964638979
862 2964646787
863 2964654825
864 2964659348
865 2964669783
866 2964673488
867 2964679037
868 2964685943
869 2964695424
870 2964701760
871 2964711491
872 2964715377
873 2964720460
874 2967666276
875 2967675313
876 2967682680
877 2967687458
878 2967699656
879 2967704388
880 2967708329
881 2967715288
882 2967726477
883 2967729210
884 2967741431
885 2967745495
886 2967753855
887 2967757174
888 2967763673
889 2967771462
890 2967781135
891 2970022448
892 2970031467
893 2970038640
894 2970045723
895 2970052348
896 2970058213
897 2970068517
898 2970073706
899 2970078472
900 2970087307
901 2970092524
902 2970099695
903 2970105155
904 2970110462
905 2970117779
906 2970126207
907 2970130423
908 2970137386
909 2970146923
910 2970150401
911 2970159322
912 2970166487
913 2970172346
914 2970182438
915 2970185722
916 2970192771
917 2977517217
918 2977527928
919 2977532841
920 2977542681
921 2977549187
922 2977552744
923 2977562201
924 2977569523
925 2977574975
926 2977586175
927 2978971466
928 2979103687
929 2984511749
930 2984521890
931 2984541188
932 2984588612
933 2984603469
934 2989778983
935 2995395044
936 2996891656
937 648737398
938 8003571374
939 8003993678
940 8004001164
941 8005248536
942 8005262986
943 8005326183
944 8005485104
945 8005545102
946 8005645268
947 8054462677
948 8054562838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06821

Ser_hydrolase

Serine hydrolase

8

185

0.94

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

8

180

0.56

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bdv-assembly2.cif.gz_B crystal structure of a putative yden-like hydrolase (eca3091) from pectobacterium atrosepticum scri1043 at 1.66 a resolution 0.9132 3 184
7m7c-assembly1.cif.gz_A crystal structure of hip1 (rv2224c) mutant - t466a/s228dha (dehydroalanine) 0.8981 122 158
5bkm-assembly1.cif.gz_A crystal structure of hip1 (rv2224c) mutant - s228dha (dehydroalanine) 0.8924 122 158
3bdv-assembly2.cif.gz_B crystal structure of a putative yden-like hydrolase (eca3091) from pectobacterium atrosepticum scri1043 at 1.66 a resolution 0.866 3 184
1uxo-assembly1.cif.gz_A the crystal structure of the yden gene product from b. subtilis 0.8128 8 181
ID Description Score Start End Superfamily
3bdvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9185 3 184 3.40.50.1820
af_P9WHR5_49_509_2.60.200.30 Mainly Beta;Sandwich;Tumour Suppressor Smad4;Probable inorganic polyphosphate/atp-NAD kinase; domain 2 0.8986 123 158 2.60.200.30
3bdvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8705 3 184 3.40.50.1820
af_Q0IY30_3_145_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8561 124 158 3.40.50.1820
af_Q2FXA7_2_184_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8386 8 181 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A829XTA9-F1-model_v4 deleted 1 1 184
AF-A0A436F5L9-F1-model_v4 Serine hydrolase family protein 1 1 79 GO:0016787
AF-A0A249NS49-F1-model_v4 Putative esterase of the alpha/beta hydrolase fold 0.9995 1 184 GO:0016787
AF-A0A559SN96-F1-model_v4 Alpha/beta hydrolase family protein 0.9992 1 184 GO:0016787
AF-A0A7C1PB86-F1-model_v4 Serine hydrolase family protein 0.9991 1 155 GO:0016787

Map