F451204

General Info

Members Datasets Scaffolds Average Seq Length
474 246 948 222

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100024393|Ga0307409_1000243932
Length 256
Sequence MRLETAPTGSPIAKGTPMHPTSTPRFRLLVPGVAIAALLATLALALPRASADAAAPASLARHDGHGGAVATTHLPHTAAQLALHDQMRRLWEDHITWTRLAIVTFADGSAGFSPTAGRLLENQDDIGDAIKPYYGDAAGERLTALLRDHITIAVDVLKAAKAGDTGAFASAKARWYANADDITDLLASANPRFWPQSMMRADMREHLDQTLAEAAHELGGDYAASIADYEQVHTHILAMADLLSSGIIRQLPGRVG

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
166 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
245 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
246 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.83
Metatranscriptomes 6.54
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.21
Rhizoplane 8.02
Rhizosphere 91.56
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100024393 3300031995 Bacteria 4217
2 JGI24738J21930_10018977 3300002075 Unclassified 1436
3 JGI24744J21845_10033125 3300002077 Bacteria 984
4 JGI24033J26618_1010670 3300002155 Bacteria 1086
5 JGI24751J29686_10015153 3300002459 Bacteria 1591
6 Ga0070658_10000175 3300005327 Bacteria 56109
7 Ga0070658_10009443 3300005327 Bacteria 7840
8 Ga0070683_100039833 3300005329 Bacteria 4316
9 Ga0070683_100180120 3300005329 Unclassified 2006
10 Ga0070670_100035568 3300005331 Bacteria 4287
11 Ga0068869_100020693 3300005334 Bacteria 4516
12 Ga0070680_100017758 3300005336 Bacteria 5612
13 Ga0070680_100041299 3300005336 Bacteria 3740
14 Ga0070680_100087020 3300005336 Bacteria 2584
15 Ga0070680_100120713 3300005336 Bacteria 2188
16 Ga0070680_100582558 3300005336 Bacteria 960
17 Ga0070682_100166038 3300005337 Bacteria 1529
18 Ga0070682_100249187 3300005337 Bacteria 1279
19 Ga0068868_100332384 3300005338 Bacteria 1297
20 Ga0068868_100383494 3300005338 Unclassified 1210
21 Ga0070660_100042213 3300005339 Bacteria 3480
22 Ga0070660_100382432 3300005339 Bacteria 1162
23 Ga0070689_100039856 3300005340 Bacteria 3598
24 Ga0070689_100050109 3300005340 Unclassified 3225
25 Ga0070691_10001623 3300005341 Bacteria 9741
26 Ga0070687_100049989 3300005343 Unclassified 2158
27 Ga0070661_100052159 3300005344 Bacteria 2993
28 Ga0070692_10002197 3300005345 Bacteria 7469
29 Ga0070692_10004337 3300005345 Bacteria 5905
30 Ga0070675_100027066 3300005354 Bacteria 4605
31 Ga0070675_100071799 3300005354 Bacteria 2873
32 Ga0070671_100019699 3300005355 Bacteria 5493
33 Ga0070673_100169071 3300005364 Unclassified 1865
34 Ga0070688_100604471 3300005365 Bacteria 840
35 Ga0070659_100004944 3300005366 Bacteria 9534
36 Ga0070713_100472367 3300005436 Bacteria 1180
37 Ga0070710_10104919 3300005437 Bacteria 1689
38 Ga0070701_10172276 3300005438 Bacteria 1261
39 Ga0070711_100020267 3300005439 Bacteria 4283
40 Ga0070700_100003366 3300005441 Bacteria 8244
41 Ga0070708_100065719 3300005445 Bacteria 3253
42 Ga0070663_100019246 3300005455 Bacteria 4495
43 Ga0070663_100278886 3300005455 Unclassified 1331
44 Ga0070678_100004151 3300005456 Bacteria 8163
45 Ga0070681_10043856 3300005458 Bacteria 4477
46 Ga0070681_10119518 3300005458 Bacteria 2571
47 Ga0070681_10252225 3300005458 Bacteria 1677
48 Ga0070681_10360122 3300005458 Bacteria 1365
49 Ga0068867_100220115 3300005459 Unclassified 1529
50 Ga0070685_10058202 3300005466 Bacteria 2252
51 Ga0070679_100033139 3300005530 Bacteria 5114
52 Ga0070679_100068627 3300005530 Bacteria 3536
53 Ga0070679_100118790 3300005530 Bacteria 2629
54 Ga0070679_100312463 3300005530 Bacteria 1521
55 Ga0070679_100446746 3300005530 Bacteria 1238
56 Ga0070679_100470680 3300005530 Bacteria 1201
57 Ga0070684_100005296 3300005535 Bacteria 9874
58 Ga0070684_100024355 3300005535 Bacteria 5077
59 Ga0070684_100040346 3300005535 Bacteria 4019
60 Ga0070684_100083620 3300005535 Bacteria 2828
61 Ga0070684_100116400 3300005535 Bacteria 2401
62 Ga0070684_100632652 3300005535 Bacteria 996
63 Ga0070672_100006745 3300005543 Bacteria 7743
64 Ga0070672_100030286 3300005543 Bacteria 4065
65 Ga0070686_100212616 3300005544 Unclassified 1393
66 Ga0070695_100256083 3300005545 Bacteria 1276
67 Ga0070693_100020101 3300005547 Bacteria 3515
68 Ga0070665_100014428 3300005548 Bacteria 7929
69 Ga0068855_100158899 3300005563 Bacteria 2566
70 Ga0068855_100263801 3300005563 Bacteria 1918
71 Ga0068857_100120803 3300005577 Bacteria 2359
72 Ga0068857_100283210 3300005577 Bacteria 1525
73 Ga0068857_100305518 3300005577 Bacteria 1467
74 Ga0068854_100028653 3300005578 Bacteria 3850
75 Ga0068854_100041055 3300005578 Bacteria 3268
76 Ga0068856_100020243 3300005614 Bacteria 6462
77 Ga0068856_100253851 3300005614 Bacteria 1773
78 Ga0070702_100005397 3300005615 Bacteria 5948
79 Ga0070702_100040776 3300005615 Bacteria 2599
80 Ga0068852_100362711 3300005616 Unclassified 1417
81 Ga0068861_100018999 3300005719 Bacteria 4903
82 Ga0068851_10002983 3300005834 Bacteria 7477
83 Ga0068870_10000481 3300005840 Bacteria 15114
84 Ga0068870_10001067 3300005840 Bacteria 10886
85 Ga0068863_100007096 3300005841 Bacteria 10984
86 Ga0068858_100033214 3300005842 Bacteria 4790
87 Ga0068860_100132430 3300005843 Bacteria 2393
88 Ga0081455_10000632 3300005937 Bacteria 45622
89 Ga0081455_10178100 3300005937 Bacteria 1612
90 Ga0081538_10015389 3300005981 Bacteria 5924
91 Ga0081538_10032053 3300005981 Bacteria 3531
92 Ga0081538_10032076 3300005981 Bacteria 3529
93 Ga0081538_10068432 3300005981 Bacteria 1974
94 Ga0097621_100038006 3300006237 Bacteria 3861
95 Ga0068871_100089823 3300006358 Bacteria 2558
96 Ga0075428_100000504 3300006844 Bacteria 39650
97 Ga0075428_100060681 3300006844 Bacteria 4141
98 Ga0075428_100146138 3300006844 Bacteria 2569
99 Ga0075428_100262095 3300006844 Bacteria 1861
100 Ga0075428_100307611 3300006844 Bacteria 1704
101 Ga0075428_100469568 3300006844 Bacteria 1347
102 Ga0075430_100038569 3300006846 Bacteria 4046
103 Ga0075430_100244791 3300006846 Bacteria 1486
104 Ga0075431_100001466 3300006847 Bacteria 21767
105 Ga0075431_100018794 3300006847 Bacteria 7041
106 Ga0075431_100046325 3300006847 Bacteria 4484
107 Ga0075433_10019519 3300006852 Bacteria 5650
108 Ga0075434_100011974 3300006871 Bacteria 8207
109 Ga0075429_100003942 3300006880 Bacteria 12692
110 Ga0075429_100026484 3300006880 Bacteria 5035
111 Ga0068865_100047846 3300006881 Bacteria 2941
112 Ga0075436_100006932 3300006914 Bacteria 7754
113 Ga0075435_100000902 3300007076 Bacteria 18701
114 Ga0105251_10014491 3300009011 Bacteria 4353
115 Ga0105240_10172803 3300009093 Bacteria 2557
116 Ga0111539_10011641 3300009094 Bacteria 11036
117 Ga0111539_10020896 3300009094 Bacteria 8061
118 Ga0111539_10826256 3300009094 Bacteria 1078
119 Ga0111539_11360703 3300009094 Bacteria 824
120 Ga0105245_10146252 3300009098 Bacteria 2230
121 Ga0105247_10015306 3300009101 Bacteria 4596
122 Ga0114129_10097412 3300009147 Bacteria 4072
123 Ga0114129_10144211 3300009147 Bacteria 3263
124 Ga0114129_10144890 3300009147 Bacteria 3254
125 Ga0114129_10147698 3300009147 Bacteria 3219
126 Ga0114129_10530189 3300009147 Bacteria 1534
127 Ga0114129_10808362 3300009147 Bacteria 1195
128 Ga0105243_10001281 3300009148 Bacteria 22570
129 Ga0105243_10262457 3300009148 Bacteria 1547
130 Ga0105241_10066774 3300009174 Bacteria 2782
131 Ga0105248_10033522 3300009177 Bacteria 5737
132 Ga0105248_10187963 3300009177 Unclassified 2327
133 Ga0105237_10356010 3300009545 Bacteria 1468
134 Ga0105249_10007165 3300009553 Bacteria 9738
135 Ga0105239_10287420 3300010375 Bacteria 1852
136 Ga0105246_10012787 3300011119 Bacteria 5247
137 Ga0105246_10093372 3300011119 Bacteria 2173
138 Ga0154010_180419 3300013062 Unclassified 1181
139 Ga0157371_10031783 3300013102 Bacteria 3801
140 Ga0157370_10195610 3300013104 Bacteria 1877
141 Ga0157369_10072089 3300013105 Bacteria 3707
142 Ga0157369_10119277 3300013105 Bacteria 2800
143 Ga0157369_10226850 3300013105 Bacteria 1954
144 Ga0157369_10346977 3300013105 Bacteria 1542
145 Ga0157369_10598164 3300013105 Bacteria 1138
146 Ga0157369_10745869 3300013105 Unclassified 1007
147 Ga0157374_10129588 3300013296 Bacteria 2440
148 Ga0157372_10031361 3300013307 Bacteria 5821
149 Ga0157372_10075650 3300013307 Bacteria 3800
150 Ga0157372_10159737 3300013307 Unclassified 2604
151 Ga0157372_10450889 3300013307 Bacteria 1499
152 Ga0157372_10847685 3300013307 Bacteria 1061
153 Ga0157375_10220903 3300013308 Bacteria 2053
154 Ga0163163_10047519 3300014325 Bacteria 4219
155 Ga0157380_10539950 3300014326 Unclassified 1141
156 Ga0182008_10084637 3300014497 Bacteria 1562
157 Ga0157377_10050158 3300014745 Unclassified 2349
158 Ga0157377_10054383 3300014745 Bacteria 2266
159 Ga0157377_10140197 3300014745 Bacteria 1485
160 Ga0157379_10328102 3300014968 Bacteria 1398
161 Ga0157376_10308601 3300014969 Bacteria 1500
162 Ga0157376_10326906 3300014969 Bacteria 1460
163 Ga0197907_10343764 3300020069 Bacteria 2230
164 Ga0197907_10979995 3300020069 Bacteria 1545
165 Ga0197907_11366458 3300020069 Bacteria 2232
166 Ga0206356_10196964 3300020070 Bacteria 2564
167 Ga0206356_10538261 3300020070 Bacteria 1352
168 Ga0206356_10591037 3300020070 Bacteria 2596
169 Ga0206349_1334040 3300020075 Bacteria 947
170 Ga0206355_1607626 3300020076 Bacteria 1658
171 Ga0206352_10562388 3300020078 Bacteria 1115
172 Ga0206352_11194189 3300020078 Bacteria 1649
173 Ga0206350_10242692 3300020080 Bacteria 1193
174 Ga0206350_10329115 3300020080 Bacteria 2264
175 Ga0206350_10779811 3300020080 Unclassified 1206
176 Ga0206350_11063741 3300020080 Bacteria 947
177 Ga0206354_10249682 3300020081 Bacteria 983
178 Ga0206354_10266802 3300020081 Bacteria 2023
179 Ga0206354_10774265 3300020081 Bacteria 1861
180 Ga0206354_10878991 3300020081 Bacteria 1547
181 Ga0206353_10176036 3300020082 Bacteria 1700
182 Ga0206353_10563077 3300020082 Bacteria 2212
183 Ga0206353_11457390 3300020082 Bacteria 1406
184 Ga0206353_11485895 3300020082 Bacteria 1504
185 Ga0206353_11528325 3300020082 Bacteria 1041
186 Ga0206353_11669309 3300020082 Bacteria 2415
187 Ga0224712_10005691 3300022467 Unclassified 3498
188 Ga0224712_10052754 3300022467 Bacteria 1589
189 Ga0224712_10097582 3300022467 Bacteria 1241
190 Ga0224712_10102615 3300022467 Bacteria 1215
191 Ga0224712_10149995 3300022467 Bacteria 1032
192 Ga0207656_10119400 3300025321 Bacteria 1226
193 Ga0207713_1089845 3300025735 Bacteria 1082
194 Ga0207692_10074779 3300025898 Bacteria 1796
195 Ga0207710_10016715 3300025900 Bacteria 3106
196 Ga0207688_10029496 3300025901 Bacteria 3020
197 Ga0207688_10132323 3300025901 Bacteria 1463
198 Ga0207643_10000733 3300025908 Bacteria 20134
199 Ga0207643_10001879 3300025908 Bacteria 11602
200 Ga0207705_10005177 3300025909 Bacteria 9777
201 Ga0207705_10008167 3300025909 Bacteria 7664
202 Ga0207705_10010523 3300025909 Bacteria 6726
203 Ga0207705_10050425 3300025909 Bacteria 2996
204 Ga0207654_10156839 3300025911 Bacteria 1467
205 Ga0207707_10108351 3300025912 Bacteria 2428
206 Ga0207707_10115867 3300025912 Bacteria 2341
207 Ga0207707_10285762 3300025912 Bacteria 1428
208 Ga0207695_10137277 3300025913 Bacteria 2397
209 Ga0207693_10046184 3300025915 Bacteria 3421
210 Ga0207660_10055583 3300025917 Bacteria 2829
211 Ga0207660_10103371 3300025917 Bacteria 2131
212 Ga0207662_10073815 3300025918 Unclassified 2070
213 Ga0207657_10047689 3300025919 Bacteria 3744
214 Ga0207657_10106060 3300025919 Bacteria 2325
215 Ga0207657_10245586 3300025919 Unclassified 1428
216 Ga0207649_10008706 3300025920 Bacteria 5539
217 Ga0207649_10028796 3300025920 Bacteria 3274
218 Ga0207652_10016282 3300025921 Bacteria 6068
219 Ga0207652_10017607 3300025921 Bacteria 5848
220 Ga0207652_10053622 3300025921 Bacteria 3464
221 Ga0207652_10104127 3300025921 Unclassified 2510
222 Ga0207694_10358203 3300025924 Bacteria 1208
223 Ga0207650_10008802 3300025925 Bacteria 6897
224 Ga0207659_10019892 3300025926 Bacteria 4428
225 Ga0207687_10012639 3300025927 Bacteria 5515
226 Ga0207687_10377525 3300025927 Bacteria 1161
227 Ga0207690_10019646 3300025932 Bacteria 4164
228 Ga0207690_10021576 3300025932 Bacteria 3996
229 Ga0207690_10060049 3300025932 Bacteria 2578
230 Ga0207709_10217064 3300025935 Unclassified 1377
231 Ga0207709_10811039 3300025935 Bacteria 756
232 Ga0207704_10006737 3300025938 Bacteria 5385
233 Ga0207704_10078579 3300025938 Bacteria 2123
234 Ga0207691_10008253 3300025940 Bacteria 9998
235 Ga0207691_10017997 3300025940 Bacteria 6691
236 Ga0207689_10002897 3300025942 Bacteria 15834
237 Ga0207661_10001349 3300025944 Bacteria 16464
238 Ga0207661_10080277 3300025944 Bacteria 2691
239 Ga0207661_10235257 3300025944 Bacteria 1624
240 Ga0207679_10004173 3300025945 Bacteria 8979
241 Ga0207679_10064199 3300025945 Bacteria 2743
242 Ga0207667_10486324 3300025949 Bacteria 1253
243 Ga0207667_10626616 3300025949 Bacteria 1083
244 Ga0207712_10096596 3300025961 Bacteria 2187
245 Ga0207668_10477404 3300025972 Bacteria 1069
246 Ga0207640_10152936 3300025981 Unclassified 1697
247 Ga0207640_10207039 3300025981 Bacteria 1491
248 Ga0207677_10005888 3300026023 Bacteria 6671
249 Ga0207677_10165249 3300026023 Unclassified 1724
250 Ga0207703_10022714 3300026035 Bacteria 4926
251 Ga0207678_10002543 3300026067 Bacteria 16625
252 Ga0207678_10449217 3300026067 Bacteria 1120
253 Ga0207708_10000445 3300026075 Bacteria 32158
254 Ga0207708_10047623 3300026075 Bacteria 3263
255 Ga0207702_10010541 3300026078 Bacteria 7728
256 Ga0207702_10041061 3300026078 Bacteria 3878
257 Ga0207641_10006365 3300026088 Bacteria 9969
258 Ga0207648_10009429 3300026089 Bacteria 9353
259 Ga0207676_10007334 3300026095 Bacteria 7821
260 Ga0207674_10032528 3300026116 Bacteria 5470
261 Ga0207674_10130363 3300026116 Unclassified 2478
262 Ga0207675_100038534 3300026118 Bacteria 4461
263 Ga0207683_10000342 3300026121 Bacteria 42329
264 Ga0207698_10020662 3300026142 Bacteria 4537
265 Ga0207698_10044669 3300026142 Bacteria 3331
266 Ga0207428_10021616 3300027907 Bacteria 5445
267 Ga0207428_10023658 3300027907 Bacteria 5163
268 Ga0307408_100599277 3300031548 Bacteria 979
269 Ga0307405_10674631 3300031731 Bacteria 853
270 Ga0307410_10064657 3300031852 Bacteria 2514
271 Ga0307410_10093365 3300031852 Bacteria 2141
272 Ga0307410_10215834 3300031852 Bacteria 1473
273 Ga0307406_10067968 3300031901 Bacteria 2325
274 Ga0307406_10296553 3300031901 Bacteria 1240
275 Ga0307407_10062211 3300031903 Bacteria 2185
276 Ga0307407_10410931 3300031903 Unclassified 973
277 Ga0307409_100156740 3300031995 Bacteria 1985
278 Ga0307409_100265634 3300031995 Bacteria 1577
279 Ga0307409_100358062 3300031995 Bacteria 1379
280 Ga0307409_101122129 3300031995 Bacteria 808
281 Ga0307416_100023718 3300032002 Bacteria 4460
282 Ga0307416_100042247 3300032002 Bacteria 3558
283 Ga0307416_100109942 3300032002 Bacteria 2426
284 Ga0307416_100396969 3300032002 Bacteria 1415
285 Ga0307416_100548552 3300032002 Bacteria 1229
286 Ga0307416_100905679 3300032002 Bacteria 982
287 Ga0307416_101149720 3300032002 Bacteria 881
288 Ga0307414_10274035 3300032004 Bacteria 1415
289 Ga0307414_10473822 3300032004 Bacteria 1103
290 Ga0307414_10615319 3300032004 Unclassified 976
291 Ga0307415_100030065 3300032126 Bacteria 3480
292 Ga0307415_100064329 3300032126 Bacteria 2552
293 Ga0307415_100327980 3300032126 Bacteria 1279
294 Ga0373936_0002379 3300035113 Bacteria 7039
295 Ga0373946_0009333 3300035171 Bacteria 3611
296 Ga0373955_0175670 3300035172 Bacteria 1269
297 Ga0373935_0015106 3300035692 Bacteria 4662
298 Ga0373933_0084889 3300035724 Bacteria 1946
299 Ga0373947_0000027 3300035725 Bacteria 81186
300 Ga0373937_0107685 3300036401 Bacteria 2591
301 Ga0373925_0725694 3300037068 Bacteria 819
302 Ga0395905_0271058 3300037471 Bacteria 1583
303 Ga0395901_0063175 3300038443 Bacteria 3853
304 Ga0395901_0091595 3300038443 Bacteria 3182
305 Ga0395901_0280770 3300038443 Bacteria 1730
306 Ga0395901_0358023 3300038443 Bacteria 1505
307 Ga0439448_0002049 3300042005 Bacteria 5403
308 Ga0439463_043424 3300042016 Bacteria 1144
309 Ga0439459_0001024 3300042438 Bacteria 3983
310 Ga0466963_0017509 3300044694 Bacteria 4467
311 Ga0466963_0028439 3300044694 Bacteria 3589
312 Ga0466963_0035776 3300044694 Bacteria 3235
313 Ga0466963_0167250 3300044694 Bacteria 1532
314 Ga0466963_0300254 3300044694 Bacteria 1129
315 Ga0466960_0092596 3300044901 Bacteria 1543
316 Ga0466958_0074349 3300045836 Bacteria 2083
317 Ga0466967_0067246 3300045976 Bacteria 3196
318 Ga0466967_0130164 3300045976 Bacteria 2335
319 Ga0466967_0261097 3300045976 Unclassified 1657
320 Ga0466967_0314346 3300045976 Bacteria 1509
321 Ga0466967_0347053 3300045976 Bacteria 1436
322 Ga0466967_1058928 3300045976 Bacteria 808
323 Ga0495653_0019442 3300046463 Bacteria 5509
324 Ga0495664_0064145 3300046477 Bacteria 2190
325 Ga0495596_0058728 3300046500 Unclassified 1500
326 Ga0495608_0009885 3300046511 Bacteria 6659
327 Ga0495618_0362077 3300046514 Bacteria 892
328 Ga0495652_0053456 3300046529 Bacteria 3442
329 Ga0495667_0018473 3300046559 Bacteria 4710
330 Ga0495656_0008613 3300046615 Bacteria 3647
331 Ga0495657_0031728 3300046675 Bacteria 3690
332 Ga0495599_0068309 3300046678 Bacteria 2219
333 Ga0495646_0113466 3300046680 Bacteria 1541
334 Ga0495600_0286612 3300046809 Bacteria 1041
335 Ga0495674_0279824 3300047319 Bacteria 1367
336 Ga0495680_0003994 3300047322 Bacteria 14252
337 Ga0495683_0148374 3300047323 Unclassified 1094
338 Ga0495593_0138416 3300047673 Bacteria 1234
339 Ga0495602_0067309 3300048088 Bacteria 3082
340 Ga0496101_0196792 3300048904 Bacteria 1557
341 Ga0496101_0575779 3300048904 Bacteria 890
342 Ga0496102_0021484 3300048905 Bacteria 5708
343 Ga0496102_0069608 3300048905 Bacteria 3230
344 Ga0496102_0216696 3300048905 Bacteria 1804
345 Ga0496103_0261741 3300048906 Bacteria 1113
346 Ga0496104_0007898 3300048907 Bacteria 9432
347 Ga0496104_0024667 3300048907 Bacteria 5533
348 Ga0496105_0131053 3300048908 Bacteria 2067
349 Ga0496106_0018989 3300048909 Bacteria 5095
350 Ga0496106_0031915 3300048909 Bacteria 3925
351 Ga0496107_0046504 3300048910 Bacteria 3123
352 Ga0496107_0077710 3300048910 Unclassified 2418
353 Ga0496107_0263946 3300048910 Bacteria 1281
354 Ga0496108_0008492 3300048911 Bacteria 8333
355 Ga0496108_0027078 3300048911 Bacteria 4729
356 Ga0496108_0678532 3300048911 Bacteria 894
357 Ga0496109_0002862 3300048912 Bacteria 14436
358 Ga0496109_0039904 3300048912 Bacteria 4250
359 Ga0496109_0066483 3300048912 Bacteria 3301
360 Ga0496110_0002304 3300048913 Bacteria 14273
361 Ga0496110_0006257 3300048913 Bacteria 9391
362 Ga0496110_0018325 3300048913 Bacteria 5870
363 Ga0496110_0470390 3300048913 Unclassified 1145
364 Ga0496111_0008052 3300048914 Bacteria 6956
365 Ga0496111_0028281 3300048914 Bacteria 3972
366 Ga0496112_0012086 3300048915 Bacteria 7923
367 Ga0496112_0068076 3300048915 Bacteria 3516
368 Ga0496112_0088767 3300048915 Bacteria 3059
369 Ga0496113_0006792 3300048916 Bacteria 7292
370 Ga0496113_0039669 3300048916 Bacteria 3467
371 Ga0496113_0197055 3300048916 Bacteria 1600
372 Ga0496114_0077263 3300048917 Bacteria 2807
373 Ga0496114_0166312 3300048917 Bacteria 1920
374 Ga0496114_0361879 3300048917 Unclassified 1283
375 Ga0496114_0362177 3300048917 Bacteria 1283
376 Ga0496115_0229700 3300048918 Bacteria 1530
377 Ga0496115_0725667 3300048918 Bacteria 779
378 Ga0501034_0034347 3300049571 Bacteria 5140
379 Ga0501036_0008692 3300049572 Bacteria 8332
380 Ga0501036_0063343 3300049572 Bacteria 3131
381 Ga0501036_0377668 3300049572 Bacteria 1183
382 Ga0501038_0014278 3300049574 Bacteria 7236
383 Ga0501039_0008757 3300049575 Bacteria 7709
384 Ga0501039_0053853 3300049575 Bacteria 3114
385 Ga0501039_0254309 3300049575 Bacteria 1381
386 Ga0501040_0002774 3300049576 Bacteria 11293
387 Ga0501040_0016521 3300049576 Bacteria 4887
388 Ga0501041_0041486 3300049577 Bacteria 2796
389 Ga0501041_0054874 3300049577 Bacteria 2431
390 Ga0501042_0020125 3300049578 Bacteria 4641
391 Ga0501042_0026150 3300049578 Bacteria 4102
392 Ga0501042_0531187 3300049578 Bacteria 855
393 Ga0501046_0040065 3300049580 Bacteria 3746
394 Ga0501046_0042893 3300049580 Bacteria 3605
395 Ga0501048_0010816 3300049582 Bacteria 6804
396 Ga0501048_0024111 3300049582 Bacteria 4443
397 Ga0501048_0167691 3300049582 Bacteria 1555
398 Ga0501048_0376713 3300049582 Bacteria 1013
399 Ga0501067_0034385 3300049583 Bacteria 2812
400 Ga0501068_0010707 3300049584 Bacteria 5156
401 Ga0501069_0006211 3300049585 Bacteria 6243
402 Ga0501070_0012611 3300049586 Bacteria 7129
403 Ga0501070_0082775 3300049586 Bacteria 2656
404 Ga0501071_0008329 3300049587 Bacteria 6849
405 Ga0501071_0124679 3300049587 Bacteria 1911
406 Ga0501071_0166692 3300049587 Bacteria 1648
407 Ga0501071_0230507 3300049587 Bacteria 1395
408 Ga0501072_0008682 3300049588 Bacteria 7714
409 Ga0501072_0022591 3300049588 Bacteria 4878
410 Ga0501072_0071252 3300049588 Bacteria 2746
411 Ga0501072_0196202 3300049588 Bacteria 1610
412 Ga0501073_0032609 3300049589 Bacteria 3714
413 Ga0501073_0231271 3300049589 Unclassified 1277
414 Ga0501074_0017302 3300049590 Bacteria 5229
415 Ga0501074_0019215 3300049590 Bacteria 4962
416 Ga0501075_0007043 3300049591 Bacteria 7770
417 Ga0501076_0008605 3300049592 Bacteria 7485
418 Ga0501076_0034606 3300049592 Bacteria 3949
419 Ga0501076_0352086 3300049592 Bacteria 1209
420 Ga0501077_0001469 3300049593 Bacteria 14187
421 Ga0501077_0037799 3300049593 Bacteria 3074
422 Ga0501079_0676676 3300049741 Bacteria 812
423 Ga0501080_0043996 3300049742 Bacteria 4157
424 Ga0501081_0033838 3300049743 Bacteria 3474
425 Ga0501081_0083876 3300049743 Bacteria 2234
426 Ga0501083_0015092 3300049744 Bacteria 5408
427 Ga0501083_0112628 3300049744 Bacteria 1788
428 Ga0501035_0057130 3300049822 Bacteria 3480
429 Ga0501035_0502621 3300049822 Bacteria 998
430 Ga0501045_0007937 3300049824 Bacteria 7391
431 nmdc:mga05p37_164919_c1 3300050507 Bacteria 2704
432 nmdc:mga05p37_226619_c1 3300050507 Bacteria 2253
433 nmdc:mga05p37_2610_c1 3300050507 Bacteria 20978
434 nmdc:mga05p37_538233_c1 3300050507 Bacteria 1332
435 nmdc:mga05p37_608265_c1 3300050507 Bacteria 1232
436 nmdc:mga05p37_691439_c1 3300050507 Bacteria 1135
437 nmdc:mga09592_4107_c1 3300050508 Bacteria 11762
438 nmdc:mga09592_55883_c1 3300050508 Bacteria 3335
439 nmdc:mga0qj67_133203_c1 3300050509 Bacteria 2013
440 nmdc:mga0qj67_157937_c1 3300050509 Bacteria 1841
441 nmdc:mga06r32_16659_c1 3300050510 Bacteria 6697
442 nmdc:mga06r32_188457_c1 3300050510 Bacteria 2050
443 nmdc:mga06r32_2726_c1 3300050510 Bacteria 15807
444 nmdc:mga06r32_395630_c1 3300050510 Bacteria 1364
445 nmdc:mga06r32_573227_c1 3300050510 Bacteria 1101
446 nmdc:mga06r32_6835_c1 3300050510 Bacteria 10253
447 nmdc:mga08y16_116766_c1 3300050511 Bacteria 2778
448 nmdc:mga08y16_41122_c1 3300050511 Bacteria 4843
449 nmdc:mga08y16_443440_c1 3300050511 Bacteria 1325
450 nmdc:mga08y16_777473_c1 3300050511 Bacteria 952
451 nmdc:mga0n895_45857_c1 3300050512 Bacteria 4268
452 nmdc:mga0rr50_167837_c1 3300050513 Bacteria 1786
453 nmdc:mga0rr50_309088_c1 3300050513 Bacteria 1324
454 nmdc:mga08x19_2845_c1 3300050514 Bacteria 10439
455 nmdc:mga0a205_10406_c1 3300050515 Bacteria 8548
456 nmdc:mga0a205_146184_c1 3300050515 Bacteria 2264
457 nmdc:mga0a205_57823_c1 3300050515 Bacteria 3745
458 Ga0501084_0023437 3300054114 Bacteria 5150
459 Ga0501084_0050069 3300054114 Bacteria 3497
460 Ga0501084_0120954 3300054114 Bacteria 2201
461 Ga0501084_0859401 3300054114 Bacteria 763
462 Ga0590075_014613 3300059424 Bacteria 1921
463 Ga0587079_058826 3300059647 Bacteria 827
464 Ga0501082_0025931 3300060353 Bacteria 5052
465 Ga0501082_0030460 3300060353 Bacteria 4650
466 Ga0501082_0333634 3300060353 Bacteria 1321
467 Ga0466962_0016137 3300061719 Bacteria 3603
468 Ga0530510_0009589 3300061734 Bacteria 6789
469 Ga0530510_0010710 3300061734 Bacteria 6432
470 Ga0530510_0127271 3300061734 Bacteria 1873
471 Ga0530510_0218857 3300061734 Bacteria 1415
472 2808873630 2808606365 Bacteria 4301966
473 2819728605 2818991469 Bacteria 4644110
474 8054611397 8054609563 Bacteria 5170090
475 Ga0307409_100024393
476 JGI24738J21930_10018977
477 JGI24744J21845_10033125
478 JGI24033J26618_1010670
479 JGI24751J29686_10015153
480 Ga0070658_10000175
481 Ga0070658_10009443
482 Ga0070683_100039833
483 Ga0070683_100180120
484 Ga0070670_100035568
485 Ga0068869_100020693
486 Ga0070680_100017758
487 Ga0070680_100041299
488 Ga0070680_100087020
489 Ga0070680_100120713
490 Ga0070680_100582558
491 Ga0070682_100166038
492 Ga0070682_100249187
493 Ga0068868_100332384
494 Ga0068868_100383494
495 Ga0070660_100042213
496 Ga0070660_100382432
497 Ga0070689_100039856
498 Ga0070689_100050109
499 Ga0070691_10001623
500 Ga0070687_100049989
501 Ga0070661_100052159
502 Ga0070692_10002197
503 Ga0070692_10004337
504 Ga0070675_100027066
505 Ga0070675_100071799
506 Ga0070671_100019699
507 Ga0070673_100169071
508 Ga0070688_100604471
509 Ga0070659_100004944
510 Ga0070713_100472367
511 Ga0070710_10104919
512 Ga0070701_10172276
513 Ga0070711_100020267
514 Ga0070700_100003366
515 Ga0070708_100065719
516 Ga0070663_100019246
517 Ga0070663_100278886
518 Ga0070678_100004151
519 Ga0070681_10043856
520 Ga0070681_10119518
521 Ga0070681_10252225
522 Ga0070681_10360122
523 Ga0068867_100220115
524 Ga0070685_10058202
525 Ga0070679_100033139
526 Ga0070679_100068627
527 Ga0070679_100118790
528 Ga0070679_100312463
529 Ga0070679_100446746
530 Ga0070679_100470680
531 Ga0070684_100005296
532 Ga0070684_100024355
533 Ga0070684_100040346
534 Ga0070684_100083620
535 Ga0070684_100116400
536 Ga0070684_100632652
537 Ga0070672_100006745
538 Ga0070672_100030286
539 Ga0070686_100212616
540 Ga0070695_100256083
541 Ga0070693_100020101
542 Ga0070665_100014428
543 Ga0068855_100158899
544 Ga0068855_100263801
545 Ga0068857_100120803
546 Ga0068857_100283210
547 Ga0068857_100305518
548 Ga0068854_100028653
549 Ga0068854_100041055
550 Ga0068856_100020243
551 Ga0068856_100253851
552 Ga0070702_100005397
553 Ga0070702_100040776
554 Ga0068852_100362711
555 Ga0068861_100018999
556 Ga0068851_10002983
557 Ga0068870_10000481
558 Ga0068870_10001067
559 Ga0068863_100007096
560 Ga0068858_100033214
561 Ga0068860_100132430
562 Ga0081455_10000632
563 Ga0081455_10178100
564 Ga0081538_10015389
565 Ga0081538_10032053
566 Ga0081538_10032076
567 Ga0081538_10068432
568 Ga0097621_100038006
569 Ga0068871_100089823
570 Ga0075428_100000504
571 Ga0075428_100060681
572 Ga0075428_100146138
573 Ga0075428_100262095
574 Ga0075428_100307611
575 Ga0075428_100469568
576 Ga0075430_100038569
577 Ga0075430_100244791
578 Ga0075431_100001466
579 Ga0075431_100018794
580 Ga0075431_100046325
581 Ga0075433_10019519
582 Ga0075434_100011974
583 Ga0075429_100003942
584 Ga0075429_100026484
585 Ga0068865_100047846
586 Ga0075436_100006932
587 Ga0075435_100000902
588 Ga0105251_10014491
589 Ga0105240_10172803
590 Ga0111539_10011641
591 Ga0111539_10020896
592 Ga0111539_10826256
593 Ga0111539_11360703
594 Ga0105245_10146252
595 Ga0105247_10015306
596 Ga0114129_10097412
597 Ga0114129_10144211
598 Ga0114129_10144890
599 Ga0114129_10147698
600 Ga0114129_10530189
601 Ga0114129_10808362
602 Ga0105243_10001281
603 Ga0105243_10262457
604 Ga0105241_10066774
605 Ga0105248_10033522
606 Ga0105248_10187963
607 Ga0105237_10356010
608 Ga0105249_10007165
609 Ga0105239_10287420
610 Ga0105246_10012787
611 Ga0105246_10093372
612 Ga0154010_180419
613 Ga0157371_10031783
614 Ga0157370_10195610
615 Ga0157369_10072089
616 Ga0157369_10119277
617 Ga0157369_10226850
618 Ga0157369_10346977
619 Ga0157369_10598164
620 Ga0157369_10745869
621 Ga0157374_10129588
622 Ga0157372_10031361
623 Ga0157372_10075650
624 Ga0157372_10159737
625 Ga0157372_10450889
626 Ga0157372_10847685
627 Ga0157375_10220903
628 Ga0163163_10047519
629 Ga0157380_10539950
630 Ga0182008_10084637
631 Ga0157377_10050158
632 Ga0157377_10054383
633 Ga0157377_10140197
634 Ga0157379_10328102
635 Ga0157376_10308601
636 Ga0157376_10326906
637 Ga0197907_10343764
638 Ga0197907_10979995
639 Ga0197907_11366458
640 Ga0206356_10196964
641 Ga0206356_10538261
642 Ga0206356_10591037
643 Ga0206349_1334040
644 Ga0206355_1607626
645 Ga0206352_10562388
646 Ga0206352_11194189
647 Ga0206350_10242692
648 Ga0206350_10329115
649 Ga0206350_10779811
650 Ga0206350_11063741
651 Ga0206354_10249682
652 Ga0206354_10266802
653 Ga0206354_10774265
654 Ga0206354_10878991
655 Ga0206353_10176036
656 Ga0206353_10563077
657 Ga0206353_11457390
658 Ga0206353_11485895
659 Ga0206353_11528325
660 Ga0206353_11669309
661 Ga0224712_10005691
662 Ga0224712_10052754
663 Ga0224712_10097582
664 Ga0224712_10102615
665 Ga0224712_10149995
666 Ga0207656_10119400
667 Ga0207713_1089845
668 Ga0207692_10074779
669 Ga0207710_10016715
670 Ga0207688_10029496
671 Ga0207688_10132323
672 Ga0207643_10000733
673 Ga0207643_10001879
674 Ga0207705_10005177
675 Ga0207705_10008167
676 Ga0207705_10010523
677 Ga0207705_10050425
678 Ga0207654_10156839
679 Ga0207707_10108351
680 Ga0207707_10115867
681 Ga0207707_10285762
682 Ga0207695_10137277
683 Ga0207693_10046184
684 Ga0207660_10055583
685 Ga0207660_10103371
686 Ga0207662_10073815
687 Ga0207657_10047689
688 Ga0207657_10106060
689 Ga0207657_10245586
690 Ga0207649_10008706
691 Ga0207649_10028796
692 Ga0207652_10016282
693 Ga0207652_10017607
694 Ga0207652_10053622
695 Ga0207652_10104127
696 Ga0207694_10358203
697 Ga0207650_10008802
698 Ga0207659_10019892
699 Ga0207687_10012639
700 Ga0207687_10377525
701 Ga0207690_10019646
702 Ga0207690_10021576
703 Ga0207690_10060049
704 Ga0207709_10217064
705 Ga0207709_10811039
706 Ga0207704_10006737
707 Ga0207704_10078579
708 Ga0207691_10008253
709 Ga0207691_10017997
710 Ga0207689_10002897
711 Ga0207661_10001349
712 Ga0207661_10080277
713 Ga0207661_10235257
714 Ga0207679_10004173
715 Ga0207679_10064199
716 Ga0207667_10486324
717 Ga0207667_10626616
718 Ga0207712_10096596
719 Ga0207668_10477404
720 Ga0207640_10152936
721 Ga0207640_10207039
722 Ga0207677_10005888
723 Ga0207677_10165249
724 Ga0207703_10022714
725 Ga0207678_10002543
726 Ga0207678_10449217
727 Ga0207708_10000445
728 Ga0207708_10047623
729 Ga0207702_10010541
730 Ga0207702_10041061
731 Ga0207641_10006365
732 Ga0207648_10009429
733 Ga0207676_10007334
734 Ga0207674_10032528
735 Ga0207674_10130363
736 Ga0207675_100038534
737 Ga0207683_10000342
738 Ga0207698_10020662
739 Ga0207698_10044669
740 Ga0207428_10021616
741 Ga0207428_10023658
742 Ga0307408_100599277
743 Ga0307405_10674631
744 Ga0307410_10064657
745 Ga0307410_10093365
746 Ga0307410_10215834
747 Ga0307406_10067968
748 Ga0307406_10296553
749 Ga0307407_10062211
750 Ga0307407_10410931
751 Ga0307409_100156740
752 Ga0307409_100265634
753 Ga0307409_100358062
754 Ga0307409_101122129
755 Ga0307416_100023718
756 Ga0307416_100042247
757 Ga0307416_100109942
758 Ga0307416_100396969
759 Ga0307416_100548552
760 Ga0307416_100905679
761 Ga0307416_101149720
762 Ga0307414_10274035
763 Ga0307414_10473822
764 Ga0307414_10615319
765 Ga0307415_100030065
766 Ga0307415_100064329
767 Ga0307415_100327980
768 Ga0373936_0002379
769 Ga0373946_0009333
770 Ga0373955_0175670
771 Ga0373935_0015106
772 Ga0373933_0084889
773 Ga0373947_0000027
774 Ga0373937_0107685
775 Ga0373925_0725694
776 Ga0395905_0271058
777 Ga0395901_0063175
778 Ga0395901_0091595
779 Ga0395901_0280770
780 Ga0395901_0358023
781 Ga0439448_0002049
782 Ga0439463_043424
783 Ga0439459_0001024
784 Ga0466963_0017509
785 Ga0466963_0028439
786 Ga0466963_0035776
787 Ga0466963_0167250
788 Ga0466963_0300254
789 Ga0466960_0092596
790 Ga0466958_0074349
791 Ga0466967_0067246
792 Ga0466967_0130164
793 Ga0466967_0261097
794 Ga0466967_0314346
795 Ga0466967_0347053
796 Ga0466967_1058928
797 Ga0495653_0019442
798 Ga0495664_0064145
799 Ga0495596_0058728
800 Ga0495608_0009885
801 Ga0495618_0362077
802 Ga0495652_0053456
803 Ga0495667_0018473
804 Ga0495656_0008613
805 Ga0495657_0031728
806 Ga0495599_0068309
807 Ga0495646_0113466
808 Ga0495600_0286612
809 Ga0495674_0279824
810 Ga0495680_0003994
811 Ga0495683_0148374
812 Ga0495593_0138416
813 Ga0495602_0067309
814 Ga0496101_0196792
815 Ga0496101_0575779
816 Ga0496102_0021484
817 Ga0496102_0069608
818 Ga0496102_0216696
819 Ga0496103_0261741
820 Ga0496104_0007898
821 Ga0496104_0024667
822 Ga0496105_0131053
823 Ga0496106_0018989
824 Ga0496106_0031915
825 Ga0496107_0046504
826 Ga0496107_0077710
827 Ga0496107_0263946
828 Ga0496108_0008492
829 Ga0496108_0027078
830 Ga0496108_0678532
831 Ga0496109_0002862
832 Ga0496109_0039904
833 Ga0496109_0066483
834 Ga0496110_0002304
835 Ga0496110_0006257
836 Ga0496110_0018325
837 Ga0496110_0470390
838 Ga0496111_0008052
839 Ga0496111_0028281
840 Ga0496112_0012086
841 Ga0496112_0068076
842 Ga0496112_0088767
843 Ga0496113_0006792
844 Ga0496113_0039669
845 Ga0496113_0197055
846 Ga0496114_0077263
847 Ga0496114_0166312
848 Ga0496114_0361879
849 Ga0496114_0362177
850 Ga0496115_0229700
851 Ga0496115_0725667
852 Ga0501034_0034347
853 Ga0501036_0008692
854 Ga0501036_0063343
855 Ga0501036_0377668
856 Ga0501038_0014278
857 Ga0501039_0008757
858 Ga0501039_0053853
859 Ga0501039_0254309
860 Ga0501040_0002774
861 Ga0501040_0016521
862 Ga0501041_0041486
863 Ga0501041_0054874
864 Ga0501042_0020125
865 Ga0501042_0026150
866 Ga0501042_0531187
867 Ga0501046_0040065
868 Ga0501046_0042893
869 Ga0501048_0010816
870 Ga0501048_0024111
871 Ga0501048_0167691
872 Ga0501048_0376713
873 Ga0501067_0034385
874 Ga0501068_0010707
875 Ga0501069_0006211
876 Ga0501070_0012611
877 Ga0501070_0082775
878 Ga0501071_0008329
879 Ga0501071_0124679
880 Ga0501071_0166692
881 Ga0501071_0230507
882 Ga0501072_0008682
883 Ga0501072_0022591
884 Ga0501072_0071252
885 Ga0501072_0196202
886 Ga0501073_0032609
887 Ga0501073_0231271
888 Ga0501074_0017302
889 Ga0501074_0019215
890 Ga0501075_0007043
891 Ga0501076_0008605
892 Ga0501076_0034606
893 Ga0501076_0352086
894 Ga0501077_0001469
895 Ga0501077_0037799
896 Ga0501079_0676676
897 Ga0501080_0043996
898 Ga0501081_0033838
899 Ga0501081_0083876
900 Ga0501083_0015092
901 Ga0501083_0112628
902 Ga0501035_0057130
903 Ga0501035_0502621
904 Ga0501045_0007937
905 nmdc:mga05p37_164919_c1
906 nmdc:mga05p37_226619_c1
907 nmdc:mga05p37_2610_c1
908 nmdc:mga05p37_538233_c1
909 nmdc:mga05p37_608265_c1
910 nmdc:mga05p37_691439_c1
911 nmdc:mga09592_4107_c1
912 nmdc:mga09592_55883_c1
913 nmdc:mga0qj67_133203_c1
914 nmdc:mga0qj67_157937_c1
915 nmdc:mga06r32_16659_c1
916 nmdc:mga06r32_188457_c1
917 nmdc:mga06r32_2726_c1
918 nmdc:mga06r32_395630_c1
919 nmdc:mga06r32_573227_c1
920 nmdc:mga06r32_6835_c1
921 nmdc:mga08y16_116766_c1
922 nmdc:mga08y16_41122_c1
923 nmdc:mga08y16_443440_c1
924 nmdc:mga08y16_777473_c1
925 nmdc:mga0n895_45857_c1
926 nmdc:mga0rr50_167837_c1
927 nmdc:mga0rr50_309088_c1
928 nmdc:mga08x19_2845_c1
929 nmdc:mga0a205_10406_c1
930 nmdc:mga0a205_146184_c1
931 nmdc:mga0a205_57823_c1
932 Ga0501084_0023437
933 Ga0501084_0050069
934 Ga0501084_0120954
935 Ga0501084_0859401
936 Ga0590075_014613
937 Ga0587079_058826
938 Ga0501082_0025931
939 Ga0501082_0030460
940 Ga0501082_0333634
941 Ga0466962_0016137
942 Ga0530510_0009589
943 Ga0530510_0010710
944 Ga0530510_0127271
945 Ga0530510_0218857
946 2808873630
947 2819728605
948 8054611397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nkz-assembly1.cif.gz_B the crystal structure of a flagella protein from yersinia enterocolitica subsp. enterocolitica 8081 0.7136 86 160
6dg6-assembly5.cif.gz_E structure of a de novo designed interleukin-2/interleukin-15 mimetic 0.6718 33 100
3hq2-assembly1.cif.gz_B bsucp crystal structure 0.5911 26 134
8dz8-assembly7.cif.gz_G neoleukin 4, a de novo designed il-4 mimetic 0.5839 34 127
3k1i-assembly2.cif.gz_B crystal strcture of flis-hp1076 complex in h. pylori 0.577 33 137
ID Description Score Start End Superfamily
af_Q54P12_52_173_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.628 87 179 1.20.120.230
3k1iA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.5911 33 134 1.20.120.340
3k1iB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.577 33 137 1.20.120.340
af_A0A1D6QB23_226_553_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.5737 32 195 1.20.58.390
af_B7ZC77_465_595_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5713 87 194 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A351X1N5-F1-model_v4 Acetylglutamate kinase 0.999 25 205 GO:0016301
AF-A0A351X1N5-F1-model_v4 Acetylglutamate kinase 0.9935 25 205 GO:0016301
AF-A0A6N3A3U9-F1-model_v4 Glycosyltransferase 0.9917 35 205
AF-A0A3Q9RNS1-F1-model_v4 Glycosyltransferase 0.9902 69 205 GO:0016740
AF-A0A559J4E1-F1-model_v4 Acetylglutamate kinase 0.9898 37 205 GO:0016301

Map