F451147

General Info

Members Datasets Scaffolds Average Seq Length
474 224 469 266

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100060262|Ga0070679_1000602624
Length 272
Sequence MTDGYAADAMVTQSSCDRVPLISVNGVSKSYETRRGEKVLAIGEVNLHLAEQEFVSLIGPSGCGKSTLLHVASGLLKPTTGQVLVRGESRPIRAEEFGMVFQDAVLFPWLTIRQNVEMPAQVLRIPKRVYRPRSAQLLELVGLAGFGDMYPRELSGGMQQRASIARALIHDPELLLMDEPFGAVDAITRESLNIELQRIRTVARKSVLFVTHSISEAVFLSDRVVIMSSRPSEIRSVIDIDLPTNRGPELIESPEFNNIVRKVHRELGRHDH

Samples

Sample ID Description Type Environment
1 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 641522639 Methylobacterium sp. 4-46 Isolate Nodule
222 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
223 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
224 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.75
Nodule 0.42
Rhizoplane 2.74
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10259530 3300005289 Bacteria 969
2 Ga0065712_10000740 3300005290 Bacteria 9142
3 Ga0065715_10090143 3300005293 Bacteria 7578
4 Ga0065707_10176008 3300005295 Bacteria 1434
5 Ga0070690_100189067 3300005330 Bacteria 1427
6 Ga0070670_100083499 3300005331 Bacteria 2745
7 Ga0070680_100003751 3300005336 Bacteria 11352
8 Ga0070680_100017779 3300005336 Bacteria 5609
9 Ga0070680_100040197 3300005336 Bacteria 3786
10 Ga0070680_100134781 3300005336 Bacteria 2068
11 Ga0070682_100000304 3300005337 Bacteria 34095
12 Ga0070682_100024286 3300005337 Bacteria 3605
13 Ga0070660_100001492 3300005339 Bacteria 16013
14 Ga0070660_100097575 3300005339 Bacteria 2325
15 Ga0070661_100014112 3300005344 Bacteria 5626
16 Ga0070669_100108078 3300005353 Bacteria 2108
17 Ga0070675_100612840 3300005354 Bacteria 988
18 Ga0070674_100513747 3300005356 Bacteria 1000
19 Ga0070659_100040464 3300005366 Bacteria 3642
20 Ga0070703_10001020 3300005406 Bacteria 8781
21 Ga0070703_10017094 3300005406 Bacteria 2088
22 Ga0070701_10009021 3300005438 Bacteria 4350
23 Ga0070701_10105454 3300005438 Bacteria 1567
24 Ga0070705_100000048 3300005440 Bacteria 61670
25 Ga0070705_100014955 3300005440 Bacteria 4003
26 Ga0070700_100026743 3300005441 Bacteria 3412
27 Ga0070694_100000996 3300005444 Bacteria 16075
28 Ga0070694_100006104 3300005444 Bacteria 7309
29 Ga0070694_100009892 3300005444 Bacteria 5861
30 Ga0070694_100016738 3300005444 Bacteria 4618
31 Ga0070694_100326244 3300005444 Bacteria 1183
32 Ga0070694_100335914 3300005444 Bacteria 1167
33 Ga0070708_100003901 3300005445 Bacteria 11705
34 Ga0070708_100049468 3300005445 Bacteria 3719
35 Ga0070662_100038826 3300005457 Bacteria 3384
36 Ga0070662_100048914 3300005457 Bacteria 3048
37 Ga0070662_100448116 3300005457 Bacteria 1071
38 Ga0070681_10115914 3300005458 Bacteria 2616
39 Ga0070681_10255565 3300005458 Bacteria 1664
40 Ga0068867_100053873 3300005459 Bacteria 2971
41 Ga0068867_100292055 3300005459 Bacteria 1341
42 Ga0068867_100762184 3300005459 Bacteria 860
43 Ga0070699_100000318 3300005518 Bacteria 46655
44 Ga0070699_100002614 3300005518 Bacteria 16088
45 Ga0070699_100378895 3300005518 Bacteria 1277
46 Ga0070679_100009483 3300005530 Bacteria 9207
47 Ga0070679_100029332 3300005530 Bacteria 5428
48 Ga0070679_100030402 3300005530 Bacteria 5332
49 Ga0070679_100060262 3300005530 Bacteria 3782
50 Ga0070679_100070983 3300005530 Bacteria 3473
51 Ga0070679_100098820 3300005530 Bacteria 2906
52 Ga0070697_100002937 3300005536 Bacteria 13118
53 Ga0070697_100013718 3300005536 Bacteria 6357
54 Ga0070697_100470333 3300005536 Bacteria 1097
55 Ga0068853_100059587 3300005539 Bacteria 3298
56 Ga0070695_100000762 3300005545 Bacteria 17297
57 Ga0070695_100007597 3300005545 Bacteria 6422
58 Ga0070695_100016653 3300005545 Bacteria 4452
59 Ga0070695_100025990 3300005545 Bacteria 3620
60 Ga0070695_100223077 3300005545 Bacteria 1359
61 Ga0070696_100000572 3300005546 Bacteria 23515
62 Ga0070696_100002962 3300005546 Bacteria 11287
63 Ga0070696_100004049 3300005546 Bacteria 9775
64 Ga0070696_100015307 3300005546 Bacteria 5150
65 Ga0070696_100037017 3300005546 Bacteria 3365
66 Ga0070696_100202641 3300005546 Bacteria 1482
67 Ga0070696_100473860 3300005546 Bacteria 992
68 Ga0070693_100022114 3300005547 Bacteria 3376
69 Ga0070693_100036028 3300005547 Bacteria 2748
70 Ga0070693_100074351 3300005547 Bacteria 2010
71 Ga0070704_100019379 3300005549 Bacteria 4370
72 Ga0070704_100022197 3300005549 Bacteria 4127
73 Ga0070704_100036127 3300005549 Bacteria 3364
74 Ga0070704_100046055 3300005549 Bacteria 3038
75 Ga0068855_100037711 3300005563 Bacteria 5745
76 Ga0070664_100000926 3300005564 Bacteria 22932
77 Ga0070664_100050451 3300005564 Bacteria 3522
78 Ga0068857_100016358 3300005577 Bacteria 6499
79 Ga0068857_100032499 3300005577 Bacteria 4614
80 Ga0068854_100085825 3300005578 Bacteria 2332
81 Ga0068854_100140415 3300005578 Bacteria 1853
82 Ga0068856_100031420 3300005614 Bacteria 5194
83 Ga0070702_100063173 3300005615 Bacteria 2161
84 Ga0068859_100001430 3300005617 Bacteria 24211
85 Ga0068859_100082362 3300005617 Bacteria 3260
86 Ga0068859_100130049 3300005617 Bacteria 2589
87 Ga0068859_100612988 3300005617 Bacteria 1181
88 Ga0068864_100022371 3300005618 Bacteria 5301
89 Ga0068861_100029600 3300005719 Bacteria 4007
90 Ga0068861_100109760 3300005719 Bacteria 2209
91 Ga0068860_100057364 3300005843 Bacteria 3702
92 Ga0068860_100275385 3300005843 Bacteria 1643
93 Ga0068862_100002280 3300005844 Bacteria 17170
94 Ga0068862_100056128 3300005844 Bacteria 3374
95 Ga0075365_10000903 3300006038 Bacteria 12451
96 Ga0075368_10030562 3300006042 Bacteria 2086
97 Ga0075368_10078473 3300006042 Bacteria 1341
98 Ga0075364_10022292 3300006051 Bacteria 3998
99 Ga0075367_10006453 3300006178 Bacteria 5929
100 Ga0075367_10008135 3300006178 Bacteria 5416
101 Ga0075367_10023904 3300006178 Bacteria 3443
102 Ga0075367_10160030 3300006178 Bacteria 1400
103 Ga0075369_10024081 3300006186 Bacteria 2520
104 Ga0075369_10082298 3300006186 Bacteria 1429
105 Ga0075428_100370895 3300006844 Bacteria 1535
106 Ga0075428_100377215 3300006844 Bacteria 1520
107 Ga0075431_100019734 3300006847 Bacteria 6880
108 Ga0075431_100041033 3300006847 Bacteria 4771
109 Ga0075431_100099602 3300006847 Bacteria 2999
110 Ga0075431_100265997 3300006847 Bacteria 1739
111 Ga0075433_10000359 3300006852 Bacteria 28647
112 Ga0075433_10162639 3300006852 Bacteria 1987
113 Ga0075434_100008208 3300006871 Bacteria 9688
114 Ga0075434_100013365 3300006871 Bacteria 7807
115 Ga0075434_100031244 3300006871 Bacteria 5249
116 Ga0075434_100115928 3300006871 Bacteria 2692
117 Ga0075434_100241024 3300006871 Bacteria 1828
118 Ga0075429_100051273 3300006880 Bacteria 3590
119 Ga0075436_100002655 3300006914 Bacteria 12290
120 Ga0075436_100029709 3300006914 Bacteria 3759
121 Ga0075436_100035797 3300006914 Bacteria 3424
122 Ga0075436_100041018 3300006914 Bacteria 3194
123 Ga0097620_100001430 3300006931 Bacteria 24211
124 Ga0097620_100082364 3300006931 Bacteria 3260
125 Ga0097620_100130049 3300006931 Bacteria 2589
126 Ga0097620_100612918 3300006931 Bacteria 1181
127 Ga0075435_100034393 3300007076 Bacteria 4015
128 Ga0075435_100053169 3300007076 Bacteria 3265
129 Ga0075435_100055696 3300007076 Bacteria 3194
130 Ga0075435_100111088 3300007076 Bacteria 2280
131 Ga0075435_100218749 3300007076 Bacteria 1617
132 Ga0075435_100376010 3300007076 Bacteria 1220
133 Ga0075435_100391123 3300007076 Bacteria 1195
134 Ga0099794_10000098 3300007265 Bacteria 32096
135 Ga0099794_10020661 3300007265 Bacteria 2982
136 Ga0105250_10087986 3300009092 Bacteria 1262
137 Ga0105240_10102017 3300009093 Bacteria 3488
138 Ga0105240_10127500 3300009093 Bacteria 3056
139 Ga0111539_10002470 3300009094 Bacteria 24536
140 Ga0111539_10090256 3300009094 Bacteria 3601
141 Ga0111539_10201128 3300009094 Bacteria 2323
142 Ga0114129_10002927 3300009147 Bacteria 23882
143 Ga0114129_10004902 3300009147 Bacteria 18889
144 Ga0114129_10005154 3300009147 Bacteria 18399
145 Ga0114129_10042585 3300009147 Bacteria 6392
146 Ga0114129_10066782 3300009147 Bacteria 5015
147 Ga0114129_10173266 3300009147 Bacteria 2940
148 Ga0114129_10748162 3300009147 Bacteria 1251
149 Ga0105241_10002218 3300009174 Bacteria 14603
150 Ga0105241_10148661 3300009174 Bacteria 1914
151 Ga0105248_10045459 3300009177 Bacteria 4924
152 Ga0105249_10000751 3300009553 Bacteria 29147
153 Ga0105249_10140052 3300009553 Bacteria 2319
154 Ga0105249_10599944 3300009553 Bacteria 1156
155 Ga0105239_10837344 3300010375 Bacteria 1055
156 Ga0157373_10009664 3300013100 Bacteria 7119
157 Ga0157373_10033003 3300013100 Bacteria 3726
158 Ga0157370_10031130 3300013104 Bacteria 5222
159 Ga0157370_10122272 3300013104 Bacteria 2430
160 Ga0157378_10436537 3300013297 Bacteria 1297
161 Ga0163162_10374559 3300013306 Bacteria 1557
162 Ga0157372_10028103 3300013307 Bacteria 6135
163 Ga0157372_10060062 3300013307 Bacteria 4254
164 Ga0157375_10778819 3300013308 Bacteria 1106
165 Ga0157380_10009180 3300014326 Bacteria 7075
166 Ga0163161_10390896 3300017792 Bacteria 1113
167 Ga0213872_10066001 3300021361 Bacteria 1634
168 Ga0209758_1000878 3300025297 Bacteria 41328
169 Ga0207653_10000522 3300025885 Bacteria 14587
170 Ga0207685_10050937 3300025905 Bacteria 1597
171 Ga0207645_10090307 3300025907 Bacteria 1970
172 Ga0207645_10174756 3300025907 Bacteria 1408
173 Ga0207684_10000320 3300025910 Bacteria 68296
174 Ga0207654_10203545 3300025911 Bacteria 1305
175 Ga0207707_10022419 3300025912 Bacteria 5520
176 Ga0207707_10040638 3300025912 Bacteria 4062
177 Ga0207707_10163655 3300025912 Bacteria 1944
178 Ga0207695_10317539 3300025913 Bacteria 1447
179 Ga0207671_10169026 3300025914 Bacteria 1697
180 Ga0207660_10009652 3300025917 Bacteria 6246
181 Ga0207660_10069967 3300025917 Bacteria 2550
182 Ga0207660_10097166 3300025917 Bacteria 2194
183 Ga0207662_10110676 3300025918 Bacteria 1712
184 Ga0207662_10162763 3300025918 Bacteria 1426
185 Ga0207657_10004166 3300025919 Bacteria 15325
186 Ga0207649_10028955 3300025920 Bacteria 3267
187 Ga0207649_10127375 3300025920 Bacteria 1725
188 Ga0207652_10001992 3300025921 Bacteria 17667
189 Ga0207652_10157890 3300025921 Bacteria 2032
190 Ga0207652_10171785 3300025921 Bacteria 1945
191 Ga0207652_10202164 3300025921 Bacteria 1788
192 Ga0207646_10050905 3300025922 Bacteria 3706
193 Ga0207664_10317749 3300025929 Bacteria 1374
194 Ga0207690_10064877 3300025932 Bacteria 2495
195 Ga0207690_10129923 3300025932 Bacteria 1842
196 Ga0207690_10300472 3300025932 Bacteria 1256
197 Ga0207706_10050913 3300025933 Bacteria 3659
198 Ga0207706_10057084 3300025933 Bacteria 3440
199 Ga0207706_10068800 3300025933 Bacteria 3115
200 Ga0207670_10188793 3300025936 Bacteria 1558
201 Ga0207704_10201493 3300025938 Bacteria 1457
202 Ga0207691_10285845 3300025940 Bacteria 1419
203 Ga0207711_10036539 3300025941 Bacteria 4168
204 Ga0207711_10589224 3300025941 Bacteria 1037
205 Ga0207689_10002032 3300025942 Bacteria 19115
206 Ga0207689_10004418 3300025942 Bacteria 12761
207 Ga0207689_10065081 3300025942 Bacteria 2999
208 Ga0207689_10066785 3300025942 Bacteria 2956
209 Ga0207679_10000343 3300025945 Bacteria 33879
210 Ga0207667_10046364 3300025949 Bacteria 4602
211 Ga0207712_10004270 3300025961 Bacteria 9016
212 Ga0207712_10155561 3300025961 Bacteria 1771
213 Ga0207712_10164653 3300025961 Bacteria 1727
214 Ga0207668_10330072 3300025972 Bacteria 1269
215 Ga0207640_10072943 3300025981 Bacteria 2318
216 Ga0207658_10059055 3300025986 Bacteria 2857
217 Ga0207658_10148463 3300025986 Bacteria 1907
218 Ga0207677_10083653 3300026023 Bacteria 2298
219 Ga0207639_10404591 3300026041 Bacteria 1230
220 Ga0207639_10444570 3300026041 Bacteria 1176
221 Ga0207678_10007713 3300026067 Bacteria 9509
222 Ga0207678_10276617 3300026067 Bacteria 1440
223 Ga0207708_10051449 3300026075 Bacteria 3136
224 Ga0207702_10036873 3300026078 Bacteria 4090
225 Ga0207648_10136676 3300026089 Bacteria 2159
226 Ga0207648_10289600 3300026089 Bacteria 1466
227 Ga0207676_10009541 3300026095 Bacteria 6909
228 Ga0207674_10003304 3300026116 Bacteria 19830
229 Ga0207674_10032009 3300026116 Bacteria 5519
230 Ga0207675_100002943 3300026118 Bacteria 16748
231 Ga0207675_100025409 3300026118 Bacteria 5514
232 Ga0209588_1000034 3300027671 Bacteria 66337
233 Ga0209813_10001864 3300027866 Bacteria 4755
234 Ga0209813_10002334 3300027866 Bacteria 4349
235 Ga0207428_10110806 3300027907 Bacteria 2113
236 Ga0268265_10003738 3300028380 Bacteria 10821
237 Ga0268265_10052640 3300028380 Bacteria 3080
238 Ga0268264_10002460 3300028381 Bacteria 16280
239 Ga0268264_10049193 3300028381 Bacteria 3507
240 Ga0268264_10241294 3300028381 Bacteria 1674
241 Ga0268264_10371258 3300028381 Bacteria 1367
242 Ga0268264_10592459 3300028381 Bacteria 1092
243 Ga0307515_10023773 3300028794 Bacteria 10718
244 Ga0307509_10126070 3300031507 Bacteria 2526
245 Ga0265314_10002400 3300031711 Bacteria 19257
246 Ga0307412_10423846 3300031911 Bacteria 1089
247 Ga0307409_100027606 3300031995 Bacteria 4026
248 Ga0307416_100017363 3300032002 Bacteria 5034
249 Ga0307415_100043498 3300032126 Bacteria 2997
250 Ga0373929_0057949 3300035085 Bacteria 900
251 Ga0373940_0015386 3300035088 Bacteria 1880
252 Ga0373940_0062255 3300035088 Bacteria 1070
253 Ga0373936_0000008 3300035113 Bacteria 268505
254 Ga0373941_0022004 3300035115 Bacteria 1805
255 Ga0373956_0194277 3300035119 Bacteria 961
256 Ga0373960_0010245 3300035121 Bacteria 2286
257 Ga0373942_0018892 3300035207 Bacteria 1715
258 Ga0373931_0000551 3300035691 Bacteria 15400
259 Ga0373931_0005793 3300035691 Bacteria 5744
260 Ga0373931_0020780 3300035691 Bacteria 3287
261 Ga0373931_0078777 3300035691 Bacteria 1813
262 Ga0373947_0162088 3300035725 Bacteria 1447
263 Ga0436360_0435466 3300039438 Bacteria 2697
264 Ga0436361_0246722 3300039447 Bacteria 1634
265 Ga0439448_0000739 3300042005 Bacteria 7889
266 Ga0439459_0007249 3300042438 Bacteria 1868
267 Ga0451577_0033872 3300042876 Bacteria 4606
268 Ga0451577_0118081 3300042876 Bacteria 2376
269 Ga0466963_0452351 3300044694 Bacteria 906
270 Ga0451576_0004637 3300045051 Bacteria 17739
271 Ga0451576_0053769 3300045051 Bacteria 4217
272 Ga0495603_0048714 3300046455 Bacteria 2523
273 Ga0495603_0053787 3300046455 Bacteria 2388
274 Ga0495580_0086934 3300046472 Bacteria 2178
275 Ga0495594_0019346 3300046499 Bacteria 3617
276 Ga0495598_0042198 3300046537 Bacteria 1338
277 Ga0495621_0062518 3300046539 Bacteria 1355
278 Ga0495656_0099071 3300046615 Bacteria 1345
279 Ga0495669_0008711 3300046684 Bacteria 4272
280 Ga0495672_0125330 3300047320 Bacteria 1359
281 Ga0495672_0160324 3300047320 Bacteria 1157
282 Ga0496101_0120038 3300048904 Bacteria 1987
283 Ga0496102_0003687 3300048905 Bacteria 12957
284 Ga0496102_0035952 3300048905 Bacteria 4460
285 Ga0496103_0041236 3300048906 Bacteria 2838
286 Ga0496104_0041545 3300048907 Bacteria 4312
287 Ga0496106_0003189 3300048909 Bacteria 12265
288 Ga0496108_0155791 3300048911 Bacteria 1973
289 Ga0496109_0028728 3300048912 Bacteria 4978
290 Ga0496109_0353340 3300048912 Bacteria 1388
291 Ga0496110_0040804 3300048913 Bacteria 4046
292 Ga0496111_0034418 3300048914 Bacteria 3617
293 Ga0496112_0163202 3300048915 Bacteria 2194
294 Ga0496115_0020042 3300048918 Bacteria 5153
295 Ga0496117_0063397 3300048920 Bacteria 2527
296 Ga0496118_0177375 3300048921 Bacteria 1292
297 Ga0496119_0003124 3300048922 Bacteria 17450
298 Ga0496121_0001096 3300048924 Bacteria 47791
299 Ga0496121_0007329 3300048924 Bacteria 13337
300 Ga0496126_0003732 3300048929 Bacteria 18985
301 Ga0496126_0553595 3300048929 Bacteria 912
302 Ga0501031_0115491 3300049568 Bacteria 1754
303 Ga0501032_0000005 3300049569 Bacteria 262926
304 Ga0501032_0041217 3300049569 Bacteria 3136
305 Ga0501032_0056856 3300049569 Bacteria 2628
306 Ga0501032_0104590 3300049569 Bacteria 1875
307 Ga0501032_0253789 3300049569 Bacteria 1141
308 Ga0501033_0002556 3300049570 Bacteria 15371
309 Ga0501033_0030257 3300049570 Bacteria 4068
310 Ga0501034_0000027 3300049571 Bacteria 260512
311 Ga0501034_0000119 3300049571 Bacteria 144440
312 Ga0501034_0000295 3300049571 Bacteria 88435
313 Ga0501034_0149061 3300049571 Bacteria 2315
314 Ga0501034_0184651 3300049571 Bacteria 2049
315 Ga0501034_0372686 3300049571 Bacteria 1353
316 Ga0501036_0000217 3300049572 Bacteria 38514
317 Ga0501036_0045887 3300049572 Bacteria 3700
318 Ga0501036_0057223 3300049572 Bacteria 3303
319 Ga0501036_0100369 3300049572 Bacteria 2448
320 Ga0501037_0000125 3300049573 Bacteria 71187
321 Ga0501037_0025039 3300049573 Bacteria 4410
322 Ga0501037_0069263 3300049573 Bacteria 2568
323 Ga0501038_0000053 3300049574 Bacteria 94583
324 Ga0501038_0135599 3300049574 Bacteria 2017
325 Ga0501038_0153750 3300049574 Bacteria 1874
326 Ga0501038_0323335 3300049574 Bacteria 1206
327 Ga0501038_0352746 3300049574 Bacteria 1145
328 Ga0501038_0395329 3300049574 Bacteria 1070
329 Ga0501039_0051645 3300049575 Bacteria 3181
330 Ga0501039_0094232 3300049575 Bacteria 2334
331 Ga0501039_0173463 3300049575 Bacteria 1695
332 Ga0501040_0328497 3300049576 Bacteria 1094
333 Ga0501043_0000011 3300049579 Bacteria 198958
334 Ga0501043_0003332 3300049579 Bacteria 13236
335 Ga0501043_0073965 3300049579 Bacteria 2676
336 Ga0501043_0167312 3300049579 Bacteria 1716
337 Ga0501046_0095683 3300049580 Bacteria 2281
338 Ga0501046_0123423 3300049580 Bacteria 1969
339 Ga0501046_0351281 3300049580 Bacteria 1070
340 Ga0501047_0000382 3300049581 Bacteria 49844
341 Ga0501047_0009272 3300049581 Bacteria 9296
342 Ga0501047_0138729 3300049581 Bacteria 2310
343 Ga0501047_0356506 3300049581 Bacteria 1299
344 Ga0501048_0000031 3300049582 Bacteria 65561
345 Ga0501048_0029455 3300049582 Bacteria 3982
346 Ga0501067_0087912 3300049583 Bacteria 1724
347 Ga0501068_0059900 3300049584 Bacteria 2311
348 Ga0501069_0001609 3300049585 Bacteria 11174
349 Ga0501069_0058395 3300049585 Bacteria 2151
350 Ga0501069_0157494 3300049585 Bacteria 1307
351 Ga0501070_0003372 3300049586 Bacteria 13862
352 Ga0501070_0005422 3300049586 Bacteria 10887
353 Ga0501070_0072142 3300049586 Bacteria 2858
354 Ga0501070_0238472 3300049586 Bacteria 1489
355 Ga0501070_0307352 3300049586 Bacteria 1291
356 Ga0501071_0080372 3300049587 Bacteria 2384
357 Ga0501071_0088386 3300049587 Bacteria 2273
358 Ga0501072_0023869 3300049588 Bacteria 4752
359 Ga0501073_0000687 3300049589 Bacteria 23778
360 Ga0501073_0152292 3300049589 Bacteria 1602
361 Ga0501073_0218534 3300049589 Bacteria 1316
362 Ga0501073_0302644 3300049589 Bacteria 1103
363 Ga0501074_0003900 3300049590 Bacteria 10629
364 Ga0501074_0008609 3300049590 Bacteria 7389
365 Ga0501074_0043729 3300049590 Bacteria 3242
366 Ga0501074_0207623 3300049590 Bacteria 1395
367 Ga0501074_0258644 3300049590 Bacteria 1238
368 Ga0501076_0007483 3300049592 Bacteria 7949
369 Ga0501076_0024932 3300049592 Bacteria 4627
370 Ga0501077_0004621 3300049593 Bacteria 8361
371 Ga0501077_0296929 3300049593 Bacteria 1029
372 Ga0501079_0009556 3300049741 Bacteria 7353
373 Ga0501079_0066565 3300049741 Bacteria 2780
374 Ga0501079_0073438 3300049741 Bacteria 2644
375 Ga0501079_0205711 3300049741 Bacteria 1537
376 Ga0501079_0373084 3300049741 Bacteria 1118
377 Ga0501080_0000478 3300049742 Bacteria 31148
378 Ga0501080_0008686 3300049742 Bacteria 9224
379 Ga0501080_0016378 3300049742 Bacteria 6846
380 Ga0501080_0041373 3300049742 Bacteria 4294
381 Ga0501080_0045617 3300049742 Bacteria 4080
382 Ga0501080_0048573 3300049742 Bacteria 3949
383 Ga0501080_0180178 3300049742 Bacteria 1945
384 Ga0501080_0435654 3300049742 Bacteria 1176
385 Ga0501080_0514523 3300049742 Bacteria 1068
386 Ga0501081_0023728 3300049743 Bacteria 4113
387 Ga0501081_0028572 3300049743 Bacteria 3764
388 Ga0501081_0079268 3300049743 Bacteria 2297
389 Ga0501083_0001432 3300049744 Bacteria 16284
390 Ga0501083_0002087 3300049744 Bacteria 13749
391 Ga0501083_0026964 3300049744 Bacteria 3968
392 Ga0501083_0032221 3300049744 Bacteria 3596
393 Ga0501083_0046008 3300049744 Bacteria 2951
394 Ga0501083_0079767 3300049744 Bacteria 2170
395 Ga0501083_0081414 3300049744 Bacteria 2146
396 Ga0501035_0081241 3300049822 Bacteria 2861
397 Ga0501035_0166942 3300049822 Bacteria 1903
398 Ga0501035_0206738 3300049822 Bacteria 1681
399 Ga0501035_0279938 3300049822 Bacteria 1410
400 Ga0501035_0449276 3300049822 Bacteria 1066
401 Ga0501044_0001546 3300049823 Bacteria 26990
402 Ga0501044_0083486 3300049823 Bacteria 3230
403 Ga0501044_0106464 3300049823 Bacteria 2816
404 Ga0501044_0192793 3300049823 Bacteria 1999
405 Ga0501044_0312502 3300049823 Bacteria 1497
406 Ga0501045_0180153 3300049824 Bacteria 1574
407 Ga0501045_0315715 3300049824 Bacteria 1163
408 nmdc:mga00v17_53503_c1 3300050491 Bacteria 2461
409 nmdc:mga0yw44_3013_c1 3300050492 Bacteria 7359
410 nmdc:mga0k408_134019_c1 3300050493 Bacteria 1471
411 nmdc:mga06z11_3038_c1 3300050494 Bacteria 6456
412 nmdc:mga06z11_667_c1 3300050494 Bacteria 12487
413 nmdc:mga06z11_812_c1 3300050494 Bacteria 11421
414 nmdc:mga04h51_3639_c1 3300050495 Bacteria 3766
415 nmdc:mga04h51_7991_c1 3300050495 Bacteria 2817
416 nmdc:mga07m45_146611_c1 3300050496 Bacteria 1368
417 nmdc:mga05p37_102249_c1 3300050507 Bacteria 3529
418 nmdc:mga05p37_112175_c1 3300050507 Bacteria 3353
419 nmdc:mga05p37_12399_c1 3300050507 Bacteria 10179
420 nmdc:mga05p37_15384_c1 3300050507 Bacteria 9191
421 nmdc:mga05p37_177294_c1 3300050507 Bacteria 2596
422 nmdc:mga05p37_5066_c1 3300050507 Bacteria 15447
423 nmdc:mga09592_197934_c1 3300050508 Bacteria 1740
424 nmdc:mga09592_49458_c1 3300050508 Bacteria 3544
425 nmdc:mga0qj67_162894_c1 3300050509 Bacteria 1810
426 nmdc:mga06r32_23541_c1 3300050510 Bacteria 5700
427 nmdc:mga06r32_312190_c1 3300050510 Bacteria 1558
428 nmdc:mga06r32_81380_c1 3300050510 Bacteria 3154
429 nmdc:mga06r32_9484_c1 3300050510 Bacteria 8785
430 nmdc:mga08y16_24625_c1 3300050511 Bacteria 6352
431 nmdc:mga08y16_278468_c1 3300050511 Bacteria 1726
432 nmdc:mga08y16_49108_c1 3300050511 Bacteria 4416
433 nmdc:mga0n895_136595_c1 3300050512 Bacteria 2478
434 nmdc:mga0n895_14786_c1 3300050512 Bacteria 7101
435 nmdc:mga0n895_158075_c1 3300050512 Bacteria 2298
436 nmdc:mga0n895_197164_c1 3300050512 Bacteria 2045
437 nmdc:mga0n895_22507_c1 3300050512 Bacteria 5911
438 nmdc:mga0n895_26141_c1 3300050512 Bacteria 5524
439 nmdc:mga0n895_676500_c1 3300050512 Bacteria 1029
440 nmdc:mga0rr50_152957_c1 3300050513 Bacteria 1866
441 nmdc:mga0rr50_198723_c1 3300050513 Bacteria 1647
442 nmdc:mga0rr50_44600_c1 3300050513 Bacteria 3253
443 nmdc:mga0rr50_75632_c2 3300050513 Bacteria 2038
444 nmdc:mga0rr50_9712_c1 3300050513 Bacteria 6069
445 nmdc:mga08x19_15631_c1 3300050514 Bacteria 4619
446 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
447 nmdc:mga0a205_187931_c1 3300050515 Bacteria 1958
448 nmdc:mga0a205_194608_c1 3300050515 Bacteria 1919
449 nmdc:mga0a205_6111_c1 3300050515 Bacteria 10862
450 nmdc:mga0a205_8834_c1 3300050515 Bacteria 9177
451 Ga0500651_0000742 3300053093 Bacteria 15931
452 Ga0500562_016182 3300053108 Bacteria 1917
453 Ga0500595_002811 3300053119 Bacteria 8368
454 Ga0500595_020615 3300053119 Bacteria 2368
455 Ga0500642_0037536 3300053130 Bacteria 2071
456 Ga0500603_009900 3300053150 Bacteria 2142
457 Ga0500616_0054220 3300053153 Bacteria 2101
458 Ga0500636_0017720 3300053177 Bacteria 4210
459 Ga0500636_0093442 3300053177 Bacteria 1720
460 Ga0500601_008728 3300053737 Unclassified 1128
461 Ga0501084_0101057 3300054114 Bacteria 2421
462 Ga0501082_0000027 3300060353 Bacteria 100915
463 Ga0501082_0075282 3300060353 Bacteria 2908
464 Ga0501082_0081804 3300060353 Bacteria 2787
465 Ga0501082_0364506 3300060353 Bacteria 1260
466 Ga0501082_0488993 3300060353 Bacteria 1075
467 Ga0501082_0490711 3300060353 Bacteria 1073
468 Ga0530510_0130736 3300061734 Bacteria 1847
469 Ga0530510_0161930 3300061734 Bacteria 1655

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10115914 Ga0070681_101159142 210
2 3300005546 Ga0070696_100004049 Ga0070696_1000040493 210
3 3300025912 Ga0207707_10163655 Ga0207707_101636552 210
4 3300009147 Ga0114129_10042585 Ga0114129_100425855 235
5 3300050507 nmdc:mga05p37_112175_c1 nmdc:mga05p37_112175_c1_2457_3293 235
6 3300050510 nmdc:mga06r32_23541_c1 nmdc:mga06r32_23541_c1_2088_2924 235
7 3300006871 Ga0075434_100241024 Ga0075434_1002410242 250
8 3300006914 Ga0075436_100035797 Ga0075436_1000357972 250
9 3300007076 Ga0075435_100053169 Ga0075435_1000531692 250
10 3300006186 Ga0075369_10082298 Ga0075369_100822982 252
11 3300009093 Ga0105240_10102017 Ga0105240_101020172 252
12 3300049586 Ga0501070_0307352 Ga0501070_0307352_60_824 252
13 3300049822 Ga0501035_0081241 Ga0501035_0081241_46_810 252
14 3300005445 Ga0070708_100003901 Ga0070708_10000390110 253
15 3300005530 Ga0070679_100060262 Ga0070679_1000602624 253
16 3300005536 Ga0070697_100470333 Ga0070697_1004703332 253
17 3300009093 Ga0105240_10127500 Ga0105240_101275002 253
18 3300025913 Ga0207695_10317539 Ga0207695_103175392 253
19 3300025921 Ga0207652_10171785 Ga0207652_101717852 253
20 3300031711 Ga0265314_10002400 Ga0265314_1000240015 253
21 3300049569 Ga0501032_0253789 Ga0501032_0253789_276_1091 253
22 3300049574 Ga0501038_0323335 Ga0501038_0323335_308_1123 253
23 3300049581 Ga0501047_0009272 Ga0501047_0009272_6386_7186 253
24 3300049581 Ga0501047_0356506 Ga0501047_0356506_308_1126 253
25 3300049585 Ga0501069_0001609 Ga0501069_0001609_3959_4759 253
26 3300049586 Ga0501070_0003372 Ga0501070_0003372_1845_2645 253
27 3300049589 Ga0501073_0000687 Ga0501073_0000687_6301_7101 253
28 3300049589 Ga0501073_0302644 Ga0501073_0302644_198_1013 253
29 3300049590 Ga0501074_0003900 Ga0501074_0003900_389_1189 253
30 3300049741 Ga0501079_0009556 Ga0501079_0009556_3799_4599 253
31 3300049742 Ga0501080_0016378 Ga0501080_0016378_2015_2815 253
32 3300049742 Ga0501080_0435654 Ga0501080_0435654_68_868 253
33 3300049744 Ga0501083_0001432 Ga0501083_0001432_9665_10465 253
34 3300049823 Ga0501044_0106464 Ga0501044_0106464_201_1016 253
35 3300050512 nmdc:mga0n895_676500_c1 nmdc:mga0n895_676500_c1_246_1016 253
36 3300053150 Ga0500603_009900 Ga0500603_009900_397_1215 253
37 3300053177 Ga0500636_0017720 Ga0500636_0017720_2193_3011 253
38 3300053177 Ga0500636_0093442 Ga0500636_0093442_534_1352 253
39 3300053737 Ga0500601_008728 Ga0500601_008728_112_930 253
40 3300060353 Ga0501082_0081804 Ga0501082_0081804_768_1568 253
41 3300007076 Ga0075435_100391123 Ga0075435_1003911231 254
42 3300026067 Ga0207678_10007713 Ga0207678_100077132 254
43 3300031507 Ga0307509_10126070 Ga0307509_101260702 254
44 3300035119 Ga0373956_0194277 Ga0373956_0194277_41_907 254
45 3300035725 Ga0373947_0162088 Ga0373947_0162088_517_1320 254
46 3300047320 Ga0495672_0160324 Ga0495672_0160324_120_941 254
47 3300005336 Ga0070680_100017779 Ga0070680_1000177793 255
48 3300005336 Ga0070680_100134781 Ga0070680_1001347812 255
49 3300005337 Ga0070682_100024286 Ga0070682_1000242863 255
50 3300005339 Ga0070660_100097575 Ga0070660_1000975753 255
51 3300005354 Ga0070675_100612840 Ga0070675_1006128401 255
52 3300005406 Ga0070703_10001020 Ga0070703_100010208 255
53 3300005438 Ga0070701_10009021 Ga0070701_100090213 255
54 3300005440 Ga0070705_100000048 Ga0070705_10000004851 255
55 3300005441 Ga0070700_100026743 Ga0070700_1000267433 255
56 3300005444 Ga0070694_100000996 Ga0070694_1000009966 255
57 3300005444 Ga0070694_100335914 Ga0070694_1003359142 255
58 3300005457 Ga0070662_100448116 Ga0070662_1004481162 255
59 3300005458 Ga0070681_10255565 Ga0070681_102555651 255
60 3300005518 Ga0070699_100000318 Ga0070699_10000031835 255
61 3300005530 Ga0070679_100029332 Ga0070679_1000293324 255
62 3300005530 Ga0070679_100030402 Ga0070679_1000304025 255
63 3300005530 Ga0070679_100070983 Ga0070679_1000709832 255
64 3300005536 Ga0070697_100002937 Ga0070697_1000029375 255
65 3300005539 Ga0068853_100059587 Ga0068853_1000595872 255
66 3300005545 Ga0070695_100000762 Ga0070695_10000076215 255
67 3300005545 Ga0070695_100016653 Ga0070695_1000166533 255
68 3300005545 Ga0070695_100025990 Ga0070695_1000259903 255
69 3300005545 Ga0070695_100223077 Ga0070695_1002230772 255
70 3300005546 Ga0070696_100002962 Ga0070696_1000029625 255
71 3300005546 Ga0070696_100015307 Ga0070696_1000153076 255
72 3300005547 Ga0070693_100036028 Ga0070693_1000360283 255
73 3300005547 Ga0070693_100074351 Ga0070693_1000743513 255
74 3300005549 Ga0070704_100019379 Ga0070704_1000193791 255
75 3300005549 Ga0070704_100036127 Ga0070704_1000361272 255
76 3300005577 Ga0068857_100016358 Ga0068857_1000163587 255
77 3300005578 Ga0068854_100140415 Ga0068854_1001404152 255
78 3300005615 Ga0070702_100063173 Ga0070702_1000631733 255
79 3300005617 Ga0068859_100001430 Ga0068859_10000143011 255
80 3300005617 Ga0068859_100130049 Ga0068859_1001300492 255
81 3300005618 Ga0068864_100022371 Ga0068864_1000223716 255
82 3300005719 Ga0068861_100029600 Ga0068861_1000296006 255
83 3300005719 Ga0068861_100109760 Ga0068861_1001097602 255
84 3300005843 Ga0068860_100275385 Ga0068860_1002753851 255
85 3300005844 Ga0068862_100002280 Ga0068862_10000228018 255
86 3300005844 Ga0068862_100056128 Ga0068862_1000561283 255
87 3300006038 Ga0075365_10000903 Ga0075365_100009036 255
88 3300006042 Ga0075368_10030562 Ga0075368_100305623 255
89 3300006042 Ga0075368_10078473 Ga0075368_100784731 255
90 3300006051 Ga0075364_10022292 Ga0075364_100222923 255
91 3300006178 Ga0075367_10006453 Ga0075367_100064535 255
92 3300006178 Ga0075367_10008135 Ga0075367_100081354 255
93 3300006178 Ga0075367_10023904 Ga0075367_100239044 255
94 3300006178 Ga0075367_10160030 Ga0075367_101600302 255
95 3300006186 Ga0075369_10024081 Ga0075369_100240812 255
96 3300006847 Ga0075431_100099602 Ga0075431_1000996023 255
97 3300006852 Ga0075433_10162639 Ga0075433_101626392 255
98 3300006914 Ga0075436_100002655 Ga0075436_1000026557 255
99 3300006931 Ga0097620_100001430 Ga0097620_10000143011 255
100 3300006931 Ga0097620_100130049 Ga0097620_1001300492 255
101 3300007076 Ga0075435_100111088 Ga0075435_1001110883 255
102 3300007076 Ga0075435_100218749 Ga0075435_1002187492 255
103 3300009092 Ga0105250_10087986 Ga0105250_100879862 255
104 3300009147 Ga0114129_10004902 Ga0114129_100049028 255
105 3300009147 Ga0114129_10066782 Ga0114129_100667825 255
106 3300009553 Ga0105249_10000751 Ga0105249_1000075122 255
107 3300009553 Ga0105249_10140052 Ga0105249_101400523 255
108 3300009553 Ga0105249_10599944 Ga0105249_105999442 255
109 3300010375 Ga0105239_10837344 Ga0105239_108373441 255
110 3300013100 Ga0157373_10033003 Ga0157373_100330033 255
111 3300013104 Ga0157370_10031130 Ga0157370_100311301 255
112 3300013104 Ga0157370_10122272 Ga0157370_101222723 255
113 3300013297 Ga0157378_10436537 Ga0157378_104365372 255
114 3300013307 Ga0157372_10060062 Ga0157372_100600623 255
115 3300014326 Ga0157380_10009180 Ga0157380_100091802 255
116 3300021361 Ga0213872_10066001 Ga0213872_100660012 255
117 3300025297 Ga0209758_1000878 Ga0209758_100087822 255
118 3300025885 Ga0207653_10000522 Ga0207653_1000052211 255
119 3300025905 Ga0207685_10050937 Ga0207685_100509372 255
120 3300025907 Ga0207645_10174756 Ga0207645_101747562 255
121 3300025912 Ga0207707_10040638 Ga0207707_100406384 255
122 3300025914 Ga0207671_10169026 Ga0207671_101690262 255
123 3300025917 Ga0207660_10009652 Ga0207660_100096526 255
124 3300025917 Ga0207660_10069967 Ga0207660_100699672 255
125 3300025917 Ga0207660_10097166 Ga0207660_100971662 255
126 3300025918 Ga0207662_10110676 Ga0207662_101106762 255
127 3300025918 Ga0207662_10162763 Ga0207662_101627631 255
128 3300025921 Ga0207652_10157890 Ga0207652_101578902 255
129 3300025929 Ga0207664_10317749 Ga0207664_103177492 255
130 3300025932 Ga0207690_10129923 Ga0207690_101299232 255
131 3300025933 Ga0207706_10057084 Ga0207706_100570844 255
132 3300025942 Ga0207689_10004418 Ga0207689_100044187 255
133 3300025942 Ga0207689_10065081 Ga0207689_100650812 255
134 3300025942 Ga0207689_10066785 Ga0207689_100667854 255
135 3300025961 Ga0207712_10004270 Ga0207712_100042703 255
136 3300025961 Ga0207712_10155561 Ga0207712_101555612 255
137 3300025986 Ga0207658_10059055 Ga0207658_100590553 255
138 3300025986 Ga0207658_10148463 Ga0207658_101484632 255
139 3300026041 Ga0207639_10404591 Ga0207639_104045911 255
140 3300026041 Ga0207639_10444570 Ga0207639_104445701 255
141 3300026075 Ga0207708_10051449 Ga0207708_100514495 255
142 3300026095 Ga0207676_10009541 Ga0207676_100095416 255
143 3300026116 Ga0207674_10003304 Ga0207674_1000330417 255
144 3300026118 Ga0207675_100002943 Ga0207675_1000029432 255
145 3300026118 Ga0207675_100025409 Ga0207675_1000254094 255
146 3300027866 Ga0209813_10001864 Ga0209813_100018643 255
147 3300027866 Ga0209813_10002334 Ga0209813_100023342 255
148 3300028380 Ga0268265_10003738 Ga0268265_100037383 255
149 3300028380 Ga0268265_10052640 Ga0268265_100526402 255
150 3300028381 Ga0268264_10002460 Ga0268264_1000246011 255
151 3300028794 Ga0307515_10023773 Ga0307515_100237735 255
152 3300031911 Ga0307412_10423846 Ga0307412_104238462 255
153 3300031995 Ga0307409_100027606 Ga0307409_1000276063 255
154 3300032002 Ga0307416_100017363 Ga0307416_1000173633 255
155 3300032126 Ga0307415_100043498 Ga0307415_1000434982 255
156 3300035113 Ga0373936_0000008 Ga0373936_0000008_110602_111387 255
157 3300035115 Ga0373941_0022004 Ga0373941_0022004_985_1794 255
158 3300035121 Ga0373960_0010245 Ga0373960_0010245_1210_2067 255
159 3300035691 Ga0373931_0000551 Ga0373931_0000551_7700_8557 255
160 3300039447 Ga0436361_0246722 Ga0436361_0246722_519_1316 255
161 3300044694 Ga0466963_0452351 Ga0466963_0452351_86_889 255
162 3300046455 Ga0495603_0048714 Ga0495603_0048714_1688_2500 255
163 3300047320 Ga0495672_0125330 Ga0495672_0125330_98_937 255
164 3300048904 Ga0496101_0120038 Ga0496101_0120038_555_1367 255
165 3300048905 Ga0496102_0035952 Ga0496102_0035952_529_1341 255
166 3300048906 Ga0496103_0041236 Ga0496103_0041236_40_852 255
167 3300048907 Ga0496104_0041545 Ga0496104_0041545_2034_2876 255
168 3300048909 Ga0496106_0003189 Ga0496106_0003189_1202_2014 255
169 3300048912 Ga0496109_0028728 Ga0496109_0028728_3555_4397 255
170 3300048912 Ga0496109_0353340 Ga0496109_0353340_181_993 255
171 3300048913 Ga0496110_0040804 Ga0496110_0040804_1965_2807 255
172 3300048914 Ga0496111_0034418 Ga0496111_0034418_224_1066 255
173 3300048918 Ga0496115_0020042 Ga0496115_0020042_1751_2563 255
174 3300048920 Ga0496117_0063397 Ga0496117_0063397_17_829 255
175 3300048921 Ga0496118_0177375 Ga0496118_0177375_53_865 255
176 3300048922 Ga0496119_0003124 Ga0496119_0003124_4599_5396 255
177 3300048924 Ga0496121_0001096 Ga0496121_0001096_25635_26474 255
178 3300048924 Ga0496121_0007329 Ga0496121_0007329_9720_10532 255
179 3300048929 Ga0496126_0003732 Ga0496126_0003732_12321_13160 255
180 3300048929 Ga0496126_0553595 Ga0496126_0553595_16_828 255
181 3300049569 Ga0501032_0000005 Ga0501032_0000005_172541_173353 255
182 3300049569 Ga0501032_0041217 Ga0501032_0041217_659_1468 255
183 3300049569 Ga0501032_0056856 Ga0501032_0056856_305_1114 255
184 3300049569 Ga0501032_0104590 Ga0501032_0104590_167_976 255
185 3300049570 Ga0501033_0002556 Ga0501033_0002556_3300_4112 255
186 3300049570 Ga0501033_0030257 Ga0501033_0030257_1837_2646 255
187 3300049571 Ga0501034_0000027 Ga0501034_0000027_89573_90385 255
188 3300049571 Ga0501034_0000119 Ga0501034_0000119_133009_133818 255
189 3300049571 Ga0501034_0000295 Ga0501034_0000295_50086_50895 255
190 3300049571 Ga0501034_0149061 Ga0501034_0149061_1286_2071 255
191 3300049571 Ga0501034_0184651 Ga0501034_0184651_1117_1926 255
192 3300049571 Ga0501034_0372686 Ga0501034_0372686_387_1211 255
193 3300049572 Ga0501036_0000217 Ga0501036_0000217_7685_8494 255
194 3300049572 Ga0501036_0045887 Ga0501036_0045887_1716_2501 255
195 3300049572 Ga0501036_0100369 Ga0501036_0100369_712_1521 255
196 3300049573 Ga0501037_0000125 Ga0501037_0000125_41794_42606 255
197 3300049573 Ga0501037_0025039 Ga0501037_0025039_879_1664 255
198 3300049573 Ga0501037_0069263 Ga0501037_0069263_566_1375 255
199 3300049574 Ga0501038_0000053 Ga0501038_0000053_29744_30556 255
200 3300049574 Ga0501038_0135599 Ga0501038_0135599_850_1659 255
201 3300049574 Ga0501038_0153750 Ga0501038_0153750_986_1771 255
202 3300049574 Ga0501038_0352746 Ga0501038_0352746_205_1014 255
203 3300049575 Ga0501039_0094232 Ga0501039_0094232_822_1631 255
204 3300049575 Ga0501039_0173463 Ga0501039_0173463_49_858 255
205 3300049579 Ga0501043_0000011 Ga0501043_0000011_170198_171010 255
206 3300049579 Ga0501043_0003332 Ga0501043_0003332_11646_12455 255
207 3300049579 Ga0501043_0073965 Ga0501043_0073965_31_840 255
208 3300049579 Ga0501043_0167312 Ga0501043_0167312_244_1029 255
209 3300049580 Ga0501046_0123423 Ga0501046_0123423_851_1660 255
210 3300049580 Ga0501046_0351281 Ga0501046_0351281_207_992 255
211 3300049581 Ga0501047_0000382 Ga0501047_0000382_33352_34161 255
212 3300049581 Ga0501047_0138729 Ga0501047_0138729_711_1496 255
213 3300049582 Ga0501048_0000031 Ga0501048_0000031_40969_41778 255
214 3300049582 Ga0501048_0029455 Ga0501048_0029455_833_1618 255
215 3300049583 Ga0501067_0087912 Ga0501067_0087912_888_1673 255
216 3300049584 Ga0501068_0059900 Ga0501068_0059900_1313_2098 255
217 3300049585 Ga0501069_0058395 Ga0501069_0058395_453_1238 255
218 3300049585 Ga0501069_0157494 Ga0501069_0157494_148_957 255
219 3300049586 Ga0501070_0005422 Ga0501070_0005422_3950_4759 255
220 3300049586 Ga0501070_0072142 Ga0501070_0072142_815_1600 255
221 3300049586 Ga0501070_0238472 Ga0501070_0238472_12_809 255
222 3300049587 Ga0501071_0088386 Ga0501071_0088386_1392_2177 255
223 3300049589 Ga0501073_0152292 Ga0501073_0152292_336_1145 255
224 3300049589 Ga0501073_0218534 Ga0501073_0218534_326_1111 255
225 3300049590 Ga0501074_0008609 Ga0501074_0008609_5246_6055 255
226 3300049590 Ga0501074_0043729 Ga0501074_0043729_1762_2571 255
227 3300049590 Ga0501074_0207623 Ga0501074_0207623_507_1292 255
228 3300049593 Ga0501077_0296929 Ga0501077_0296929_31_840 255
229 3300049741 Ga0501079_0205711 Ga0501079_0205711_171_980 255
230 3300049741 Ga0501079_0373084 Ga0501079_0373084_76_861 255
231 3300049742 Ga0501080_0000478 Ga0501080_0000478_13489_14298 255
232 3300049742 Ga0501080_0008686 Ga0501080_0008686_1888_2697 255
233 3300049742 Ga0501080_0041373 Ga0501080_0041373_1932_2741 255
234 3300049742 Ga0501080_0045617 Ga0501080_0045617_3021_3830 255
235 3300049742 Ga0501080_0048573 Ga0501080_0048573_1925_2710 255
236 3300049742 Ga0501080_0514523 Ga0501080_0514523_119_943 255
237 3300049744 Ga0501083_0002087 Ga0501083_0002087_10513_11322 255
238 3300049744 Ga0501083_0026964 Ga0501083_0026964_1331_2128 255
239 3300049744 Ga0501083_0032221 Ga0501083_0032221_2115_2924 255
240 3300049744 Ga0501083_0079767 Ga0501083_0079767_688_1473 255
241 3300049744 Ga0501083_0081414 Ga0501083_0081414_25_834 255
242 3300049822 Ga0501035_0166942 Ga0501035_0166942_729_1538 255
243 3300049822 Ga0501035_0206738 Ga0501035_0206738_504_1313 255
244 3300049822 Ga0501035_0279938 Ga0501035_0279938_568_1380 255
245 3300049822 Ga0501035_0449276 Ga0501035_0449276_28_831 255
246 3300049823 Ga0501044_0001546 Ga0501044_0001546_11449_12258 255
247 3300049823 Ga0501044_0083486 Ga0501044_0083486_1872_2681 255
248 3300049823 Ga0501044_0192793 Ga0501044_0192793_441_1250 255
249 3300049823 Ga0501044_0312502 Ga0501044_0312502_469_1254 255
250 3300049824 Ga0501045_0315715 Ga0501045_0315715_307_1092 255
251 3300050491 nmdc:mga00v17_53503_c1 nmdc:mga00v17_53503_c1_1159_2091 255
252 3300050492 nmdc:mga0yw44_3013_c1 nmdc:mga0yw44_3013_c1_1603_2535 255
253 3300050493 nmdc:mga0k408_134019_c1 nmdc:mga0k408_134019_c1_595_1434 255
254 3300050494 nmdc:mga06z11_3038_c1 nmdc:mga06z11_3038_c1_3340_4116 255
255 3300050494 nmdc:mga06z11_667_c1 nmdc:mga06z11_667_c1_1829_2761 255
256 3300050494 nmdc:mga06z11_812_c1 nmdc:mga06z11_812_c1_3083_4036 255
257 3300050495 nmdc:mga04h51_3639_c1 nmdc:mga04h51_3639_c1_1570_2502 255
258 3300050495 nmdc:mga04h51_7991_c1 nmdc:mga04h51_7991_c1_2020_2796 255
259 3300050496 nmdc:mga07m45_146611_c1 nmdc:mga07m45_146611_c1_419_1258 255
260 3300050507 nmdc:mga05p37_102249_c1 nmdc:mga05p37_102249_c1_145_924 255
261 3300050507 nmdc:mga05p37_5066_c1 nmdc:mga05p37_5066_c1_2225_3001 255
262 3300050510 nmdc:mga06r32_81380_c1 nmdc:mga06r32_81380_c1_1837_2616 255
263 3300050512 nmdc:mga0n895_136595_c1 nmdc:mga0n895_136595_c1_1295_2071 255
264 3300050513 nmdc:mga0rr50_152957_c1 nmdc:mga0rr50_152957_c1_837_1613 255
265 3300050513 nmdc:mga0rr50_198723_c1 nmdc:mga0rr50_198723_c1_147_935 255
266 3300050513 nmdc:mga0rr50_75632_c2 nmdc:mga0rr50_75632_c2_1006_1848 255
267 3300050514 nmdc:mga08x19_35_c1 nmdc:mga08x19_35_c1_133362_134204 255
268 3300050515 nmdc:mga0a205_8834_c1 nmdc:mga0a205_8834_c1_481_1257 255
269 3300053093 Ga0500651_0000742 Ga0500651_0000742_3911_4732 255
270 3300053108 Ga0500562_016182 Ga0500562_016182_372_1160 255
271 3300053119 Ga0500595_002811 Ga0500595_002811_2568_3407 255
272 3300053119 Ga0500595_020615 Ga0500595_020615_1506_2318 255
273 3300053130 Ga0500642_0037536 Ga0500642_0037536_969_1790 255
274 3300053153 Ga0500616_0054220 Ga0500616_0054220_497_1429 255
275 3300060353 Ga0501082_0000027 Ga0501082_0000027_27660_28451 255
276 3300060353 Ga0501082_0075282 Ga0501082_0075282_186_983 255
277 3300060353 Ga0501082_0488993 Ga0501082_0488993_244_1029 255
278 3300060353 Ga0501082_0490711 Ga0501082_0490711_108_917 255
279 iso_pu_bacteria 2929199973 2929200144 255
280 iso_pu_bacteria 641522639 641641084 255
281 iso_pu_bacteria 643348564 643600691 255
282 iso_pu_bacteria 8006984368 8006985678 255
283 iso_pu_bacteria 8055909800 8055912220 255
284 3300005289 Ga0065704_10259530 Ga0065704_102595301 256
285 3300005290 Ga0065712_10000740 Ga0065712_1000074011 256
286 3300005293 Ga0065715_10090143 Ga0065715_100901438 256
287 3300005295 Ga0065707_10176008 Ga0065707_101760082 256
288 3300005330 Ga0070690_100189067 Ga0070690_1001890672 256
289 3300005331 Ga0070670_100083499 Ga0070670_1000834992 256
290 3300005336 Ga0070680_100003751 Ga0070680_1000037518 256
291 3300005336 Ga0070680_100040197 Ga0070680_1000401972 256
292 3300005337 Ga0070682_100000304 Ga0070682_10000030426 256
293 3300005339 Ga0070660_100001492 Ga0070660_10000149211 256
294 3300005344 Ga0070661_100014112 Ga0070661_1000141124 256
295 3300005353 Ga0070669_100108078 Ga0070669_1001080783 256
296 3300005356 Ga0070674_100513747 Ga0070674_1005137471 256
297 3300005366 Ga0070659_100040464 Ga0070659_1000404645 256
298 3300005406 Ga0070703_10017094 Ga0070703_100170943 256
299 3300005438 Ga0070701_10105454 Ga0070701_101054542 256
300 3300005440 Ga0070705_100014955 Ga0070705_1000149553 256
301 3300005444 Ga0070694_100006104 Ga0070694_1000061046 256
302 3300005444 Ga0070694_100009892 Ga0070694_1000098925 256
303 3300005444 Ga0070694_100016738 Ga0070694_1000167382 256
304 3300005444 Ga0070694_100326244 Ga0070694_1003262442 256
305 3300005445 Ga0070708_100049468 Ga0070708_1000494682 256
306 3300005457 Ga0070662_100038826 Ga0070662_1000388262 256
307 3300005457 Ga0070662_100048914 Ga0070662_1000489143 256
308 3300005459 Ga0068867_100053873 Ga0068867_1000538733 256
309 3300005459 Ga0068867_100292055 Ga0068867_1002920552 256
310 3300005459 Ga0068867_100762184 Ga0068867_1007621841 256
311 3300005518 Ga0070699_100002614 Ga0070699_10000261414 256
312 3300005518 Ga0070699_100378895 Ga0070699_1003788952 256
313 3300005530 Ga0070679_100009483 Ga0070679_1000094834 256
314 3300005530 Ga0070679_100098820 Ga0070679_1000988201 256
315 3300005536 Ga0070697_100013718 Ga0070697_1000137183 256
316 3300005545 Ga0070695_100007597 Ga0070695_1000075974 256
317 3300005546 Ga0070696_100000572 Ga0070696_10000057219 256
318 3300005546 Ga0070696_100037017 Ga0070696_1000370173 256
319 3300005546 Ga0070696_100202641 Ga0070696_1002026412 256
320 3300005546 Ga0070696_100473860 Ga0070696_1004738601 256
321 3300005547 Ga0070693_100022114 Ga0070693_1000221142 256
322 3300005549 Ga0070704_100022197 Ga0070704_1000221971 256
323 3300005549 Ga0070704_100046055 Ga0070704_1000460553 256
324 3300005563 Ga0068855_100037711 Ga0068855_1000377114 256
325 3300005564 Ga0070664_100000926 Ga0070664_10000092614 256
326 3300005564 Ga0070664_100050451 Ga0070664_1000504513 256
327 3300005577 Ga0068857_100032499 Ga0068857_1000324994 256
328 3300005578 Ga0068854_100085825 Ga0068854_1000858253 256
329 3300005614 Ga0068856_100031420 Ga0068856_1000314203 256
330 3300005617 Ga0068859_100082362 Ga0068859_1000823623 256
331 3300005617 Ga0068859_100612988 Ga0068859_1006129882 256
332 3300005843 Ga0068860_100057364 Ga0068860_1000573644 256
333 3300006844 Ga0075428_100370895 Ga0075428_1003708952 256
334 3300006844 Ga0075428_100377215 Ga0075428_1003772152 256
335 3300006847 Ga0075431_100019734 Ga0075431_1000197344 256
336 3300006847 Ga0075431_100041033 Ga0075431_1000410333 256
337 3300006847 Ga0075431_100265997 Ga0075431_1002659972 256
338 3300006852 Ga0075433_10000359 Ga0075433_1000035911 256
339 3300006871 Ga0075434_100008208 Ga0075434_1000082089 256
340 3300006871 Ga0075434_100013365 Ga0075434_1000133652 256
341 3300006871 Ga0075434_100031244 Ga0075434_1000312445 256
342 3300006871 Ga0075434_100115928 Ga0075434_1001159282 256
343 3300006880 Ga0075429_100051273 Ga0075429_1000512733 256
344 3300006914 Ga0075436_100029709 Ga0075436_1000297093 256
345 3300006914 Ga0075436_100041018 Ga0075436_1000410182 256
346 3300006931 Ga0097620_100082364 Ga0097620_1000823642 256
347 3300006931 Ga0097620_100612918 Ga0097620_1006129182 256
348 3300007076 Ga0075435_100034393 Ga0075435_1000343933 256
349 3300007076 Ga0075435_100055696 Ga0075435_1000556962 256
350 3300007076 Ga0075435_100376010 Ga0075435_1003760102 256
351 3300007265 Ga0099794_10000098 Ga0099794_1000009812 256
352 3300007265 Ga0099794_10020661 Ga0099794_100206612 256
353 3300009094 Ga0111539_10002470 Ga0111539_100024706 256
354 3300009094 Ga0111539_10090256 Ga0111539_100902562 256
355 3300009094 Ga0111539_10201128 Ga0111539_102011283 256
356 3300009147 Ga0114129_10002927 Ga0114129_1000292711 256
357 3300009147 Ga0114129_10005154 Ga0114129_100051547 256
358 3300009147 Ga0114129_10173266 Ga0114129_101732663 256
359 3300009147 Ga0114129_10748162 Ga0114129_107481621 256
360 3300009174 Ga0105241_10002218 Ga0105241_100022189 256
361 3300009174 Ga0105241_10148661 Ga0105241_101486612 256
362 3300009177 Ga0105248_10045459 Ga0105248_100454595 256
363 3300013100 Ga0157373_10009664 Ga0157373_100096643 256
364 3300013306 Ga0163162_10374559 Ga0163162_103745592 256
365 3300013307 Ga0157372_10028103 Ga0157372_100281034 256
366 3300013308 Ga0157375_10778819 Ga0157375_107788192 256
367 3300017792 Ga0163161_10390896 Ga0163161_103908962 256
368 3300025907 Ga0207645_10090307 Ga0207645_100903071 256
369 3300025910 Ga0207684_10000320 Ga0207684_1000032014 256
370 3300025911 Ga0207654_10203545 Ga0207654_102035452 256
371 3300025912 Ga0207707_10022419 Ga0207707_100224195 256
372 3300025919 Ga0207657_10004166 Ga0207657_100041668 256
373 3300025920 Ga0207649_10028955 Ga0207649_100289553 256
374 3300025920 Ga0207649_10127375 Ga0207649_101273752 256
375 3300025921 Ga0207652_10001992 Ga0207652_1000199213 256
376 3300025921 Ga0207652_10202164 Ga0207652_102021641 256
377 3300025922 Ga0207646_10050905 Ga0207646_100509055 256
378 3300025932 Ga0207690_10064877 Ga0207690_100648773 256
379 3300025932 Ga0207690_10300472 Ga0207690_103004721 256
380 3300025933 Ga0207706_10050913 Ga0207706_100509133 256
381 3300025933 Ga0207706_10068800 Ga0207706_100688002 256
382 3300025936 Ga0207670_10188793 Ga0207670_101887931 256
383 3300025938 Ga0207704_10201493 Ga0207704_102014932 256
384 3300025940 Ga0207691_10285845 Ga0207691_102858452 256
385 3300025941 Ga0207711_10036539 Ga0207711_100365394 256
386 3300025941 Ga0207711_10589224 Ga0207711_105892242 256
387 3300025942 Ga0207689_10002032 Ga0207689_100020329 256
388 3300025945 Ga0207679_10000343 Ga0207679_1000034325 256
389 3300025949 Ga0207667_10046364 Ga0207667_100463644 256
390 3300025961 Ga0207712_10164653 Ga0207712_101646532 256
391 3300025972 Ga0207668_10330072 Ga0207668_103300722 256
392 3300025981 Ga0207640_10072943 Ga0207640_100729433 256
393 3300026023 Ga0207677_10083653 Ga0207677_100836532 256
394 3300026067 Ga0207678_10276617 Ga0207678_102766172 256
395 3300026078 Ga0207702_10036873 Ga0207702_100368735 256
396 3300026089 Ga0207648_10136676 Ga0207648_101366763 256
397 3300026089 Ga0207648_10289600 Ga0207648_102896002 256
398 3300026116 Ga0207674_10032009 Ga0207674_100320094 256
399 3300027671 Ga0209588_1000034 Ga0209588_100003466 256
400 3300027907 Ga0207428_10110806 Ga0207428_101108061 256
401 3300028381 Ga0268264_10049193 Ga0268264_100491934 256
402 3300028381 Ga0268264_10241294 Ga0268264_102412942 256
403 3300028381 Ga0268264_10371258 Ga0268264_103712582 256
404 3300028381 Ga0268264_10592459 Ga0268264_105924592 256
405 3300035085 Ga0373929_0057949 Ga0373929_0057949_31_813 256
406 3300035088 Ga0373940_0015386 Ga0373940_0015386_87_869 256
407 3300035088 Ga0373940_0062255 Ga0373940_0062255_62_838 256
408 3300035207 Ga0373942_0018892 Ga0373942_0018892_291_1061 256
409 3300035691 Ga0373931_0005793 Ga0373931_0005793_992_1762 256
410 3300035691 Ga0373931_0020780 Ga0373931_0020780_2256_3026 256
411 3300035691 Ga0373931_0078777 Ga0373931_0078777_637_1419 256
412 3300039438 Ga0436360_0435466 Ga0436360_0435466_1699_2511 256
413 3300042005 Ga0439448_0000739 Ga0439448_0000739_137_949 256
414 3300042438 Ga0439459_0007249 Ga0439459_0007249_740_1552 256
415 3300042876 Ga0451577_0033872 Ga0451577_0033872_3196_3981 256
416 3300042876 Ga0451577_0118081 Ga0451577_0118081_1519_2331 256
417 3300045051 Ga0451576_0004637 Ga0451576_0004637_11955_12731 256
418 3300045051 Ga0451576_0053769 Ga0451576_0053769_2777_3589 256
419 3300046455 Ga0495603_0053787 Ga0495603_0053787_711_1493 256
420 3300046472 Ga0495580_0086934 Ga0495580_0086934_756_1532 256
421 3300046499 Ga0495594_0019346 Ga0495594_0019346_877_1659 256
422 3300046537 Ga0495598_0042198 Ga0495598_0042198_17_799 256
423 3300046539 Ga0495621_0062518 Ga0495621_0062518_46_828 256
424 3300046615 Ga0495656_0099071 Ga0495656_0099071_200_982 256
425 3300046684 Ga0495669_0008711 Ga0495669_0008711_1020_1802 256
426 3300048905 Ga0496102_0003687 Ga0496102_0003687_2051_2833 256
427 3300048911 Ga0496108_0155791 Ga0496108_0155791_615_1385 256
428 3300048915 Ga0496112_0163202 Ga0496112_0163202_1172_1942 256
429 3300049568 Ga0501031_0115491 Ga0501031_0115491_903_1673 256
430 3300049572 Ga0501036_0057223 Ga0501036_0057223_1457_2227 256
431 3300049574 Ga0501038_0395329 Ga0501038_0395329_36_806 256
432 3300049575 Ga0501039_0051645 Ga0501039_0051645_1421_2191 256
433 3300049576 Ga0501040_0328497 Ga0501040_0328497_130_900 256
434 3300049580 Ga0501046_0095683 Ga0501046_0095683_1183_1953 256
435 3300049587 Ga0501071_0080372 Ga0501071_0080372_1075_1845 256
436 3300049588 Ga0501072_0023869 Ga0501072_0023869_22_792 256
437 3300049590 Ga0501074_0258644 Ga0501074_0258644_296_1066 256
438 3300049592 Ga0501076_0007483 Ga0501076_0007483_664_1446 256
439 3300049592 Ga0501076_0024932 Ga0501076_0024932_2841_3611 256
440 3300049593 Ga0501077_0004621 Ga0501077_0004621_6887_7657 256
441 3300049741 Ga0501079_0066565 Ga0501079_0066565_1868_2638 256
442 3300049741 Ga0501079_0073438 Ga0501079_0073438_1651_2433 256
443 3300049742 Ga0501080_0180178 Ga0501080_0180178_619_1389 256
444 3300049743 Ga0501081_0023728 Ga0501081_0023728_1707_2477 256
445 3300049743 Ga0501081_0028572 Ga0501081_0028572_354_1136 256
446 3300049743 Ga0501081_0079268 Ga0501081_0079268_904_1674 256
447 3300049744 Ga0501083_0046008 Ga0501083_0046008_1426_2196 256
448 3300049824 Ga0501045_0180153 Ga0501045_0180153_379_1149 256
449 3300050507 nmdc:mga05p37_12399_c1 nmdc:mga05p37_12399_c1_6603_7385 256
450 3300050507 nmdc:mga05p37_15384_c1 nmdc:mga05p37_15384_c1_2909_3685 256
451 3300050507 nmdc:mga05p37_177294_c1 nmdc:mga05p37_177294_c1_203_973 256
452 3300050508 nmdc:mga09592_197934_c1 nmdc:mga09592_197934_c1_770_1561 256
453 3300050508 nmdc:mga09592_49458_c1 nmdc:mga09592_49458_c1_1332_2114 256
454 3300050509 nmdc:mga0qj67_162894_c1 nmdc:mga0qj67_162894_c1_919_1701 256
455 3300050510 nmdc:mga06r32_312190_c1 nmdc:mga06r32_312190_c1_200_970 256
456 3300050510 nmdc:mga06r32_9484_c1 nmdc:mga06r32_9484_c1_3145_3927 256
457 3300050511 nmdc:mga08y16_24625_c1 nmdc:mga08y16_24625_c1_3085_3855 256
458 3300050511 nmdc:mga08y16_278468_c1 nmdc:mga08y16_278468_c1_129_899 256
459 3300050511 nmdc:mga08y16_49108_c1 nmdc:mga08y16_49108_c1_3026_3808 256
460 3300050512 nmdc:mga0n895_14786_c1 nmdc:mga0n895_14786_c1_2335_3105 256
461 3300050512 nmdc:mga0n895_158075_c1 nmdc:mga0n895_158075_c1_834_1616 256
462 3300050512 nmdc:mga0n895_197164_c1 nmdc:mga0n895_197164_c1_1205_1990 256
463 3300050512 nmdc:mga0n895_22507_c1 nmdc:mga0n895_22507_c1_3052_3828 256
464 3300050512 nmdc:mga0n895_26141_c1 nmdc:mga0n895_26141_c1_1078_1854 256
465 3300050513 nmdc:mga0rr50_44600_c1 nmdc:mga0rr50_44600_c1_485_1255 256
466 3300050513 nmdc:mga0rr50_9712_c1 nmdc:mga0rr50_9712_c1_2748_3524 256
467 3300050514 nmdc:mga08x19_15631_c1 nmdc:mga08x19_15631_c1_1096_1872 256
468 3300050515 nmdc:mga0a205_187931_c1 nmdc:mga0a205_187931_c1_545_1315 256
469 3300050515 nmdc:mga0a205_194608_c1 nmdc:mga0a205_194608_c1_798_1568 256
470 3300050515 nmdc:mga0a205_6111_c1 nmdc:mga0a205_6111_c1_8991_9767 256
471 3300054114 Ga0501084_0101057 Ga0501084_0101057_1313_2083 256
472 3300060353 Ga0501082_0364506 Ga0501082_0364506_77_847 256
473 3300061734 Ga0530510_0130736 Ga0530510_0130736_684_1454 256
474 3300061734 Ga0530510_0161930 Ga0530510_0161930_284_1066 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

42

182

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.9295 4 223
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.929 3 222
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9283 4 220
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9266 3 220
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9261 3 220
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.951 4 244 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9425 4 250 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9335 2 207 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9321 4 244 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9266 4 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1W9VND7-F1-model_v4 ABC transporter domain-containing protein 0.9677 1 75 GO:0005524
GO:0016887
AF-A0A7V4SRL2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9644 1 168 GO:0005524
GO:0016887
AF-A0A147KIF1-F1-model_v4 Nitrate ABC transporter ATPase 0.9591 2 177 GO:0005524
GO:0016887
AF-A0A7W4J802-F1-model_v4 ABC transporter ATP-binding protein 0.95 1 252 GO:0005524
GO:0016887
AF-A0A4V2TDA4-F1-model_v4 deleted 0.9483 2 246

Feature Viewer

pLDDT pTM Quality
92.03 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map