F451147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 474 | 224 | 469 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100060262|Ga0070679_1000602624 |
| Length | 272 |
| Sequence | MTDGYAADAMVTQSSCDRVPLISVNGVSKSYETRRGEKVLAIGEVNLHLAEQEFVSLIGPSGCGKSTLLHVASGLLKPTTGQVLVRGESRPIRAEEFGMVFQDAVLFPWLTIRQNVEMPAQVLRIPKRVYRPRSAQLLELVGLAGFGDMYPRELSGGMQQRASIARALIHDPELLLMDEPFGAVDAITRESLNIELQRIRTVARKSVLFVTHSISEAVFLSDRVVIMSSRPSEIRSVIDIDLPTNRGPELIESPEFNNIVRKVHRELGRHDH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 125 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 126 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 128 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 135 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 136 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 137 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 138 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 139 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 151 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 161 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 162 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 163 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 164 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 165 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 196 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 199 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 200 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 201 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 211 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 212 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 213 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 214 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 215 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 216 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 218 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 221 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 222 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 223 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 224 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0 |
| Isolates | 1.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.75 |
| Nodule | 0.42 |
| Rhizoplane | 2.74 |
| Rhizosphere | 87.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10259530 | 3300005289 | Bacteria | 969 |
| 2 | Ga0065712_10000740 | 3300005290 | Bacteria | 9142 |
| 3 | Ga0065715_10090143 | 3300005293 | Bacteria | 7578 |
| 4 | Ga0065707_10176008 | 3300005295 | Bacteria | 1434 |
| 5 | Ga0070690_100189067 | 3300005330 | Bacteria | 1427 |
| 6 | Ga0070670_100083499 | 3300005331 | Bacteria | 2745 |
| 7 | Ga0070680_100003751 | 3300005336 | Bacteria | 11352 |
| 8 | Ga0070680_100017779 | 3300005336 | Bacteria | 5609 |
| 9 | Ga0070680_100040197 | 3300005336 | Bacteria | 3786 |
| 10 | Ga0070680_100134781 | 3300005336 | Bacteria | 2068 |
| 11 | Ga0070682_100000304 | 3300005337 | Bacteria | 34095 |
| 12 | Ga0070682_100024286 | 3300005337 | Bacteria | 3605 |
| 13 | Ga0070660_100001492 | 3300005339 | Bacteria | 16013 |
| 14 | Ga0070660_100097575 | 3300005339 | Bacteria | 2325 |
| 15 | Ga0070661_100014112 | 3300005344 | Bacteria | 5626 |
| 16 | Ga0070669_100108078 | 3300005353 | Bacteria | 2108 |
| 17 | Ga0070675_100612840 | 3300005354 | Bacteria | 988 |
| 18 | Ga0070674_100513747 | 3300005356 | Bacteria | 1000 |
| 19 | Ga0070659_100040464 | 3300005366 | Bacteria | 3642 |
| 20 | Ga0070703_10001020 | 3300005406 | Bacteria | 8781 |
| 21 | Ga0070703_10017094 | 3300005406 | Bacteria | 2088 |
| 22 | Ga0070701_10009021 | 3300005438 | Bacteria | 4350 |
| 23 | Ga0070701_10105454 | 3300005438 | Bacteria | 1567 |
| 24 | Ga0070705_100000048 | 3300005440 | Bacteria | 61670 |
| 25 | Ga0070705_100014955 | 3300005440 | Bacteria | 4003 |
| 26 | Ga0070700_100026743 | 3300005441 | Bacteria | 3412 |
| 27 | Ga0070694_100000996 | 3300005444 | Bacteria | 16075 |
| 28 | Ga0070694_100006104 | 3300005444 | Bacteria | 7309 |
| 29 | Ga0070694_100009892 | 3300005444 | Bacteria | 5861 |
| 30 | Ga0070694_100016738 | 3300005444 | Bacteria | 4618 |
| 31 | Ga0070694_100326244 | 3300005444 | Bacteria | 1183 |
| 32 | Ga0070694_100335914 | 3300005444 | Bacteria | 1167 |
| 33 | Ga0070708_100003901 | 3300005445 | Bacteria | 11705 |
| 34 | Ga0070708_100049468 | 3300005445 | Bacteria | 3719 |
| 35 | Ga0070662_100038826 | 3300005457 | Bacteria | 3384 |
| 36 | Ga0070662_100048914 | 3300005457 | Bacteria | 3048 |
| 37 | Ga0070662_100448116 | 3300005457 | Bacteria | 1071 |
| 38 | Ga0070681_10115914 | 3300005458 | Bacteria | 2616 |
| 39 | Ga0070681_10255565 | 3300005458 | Bacteria | 1664 |
| 40 | Ga0068867_100053873 | 3300005459 | Bacteria | 2971 |
| 41 | Ga0068867_100292055 | 3300005459 | Bacteria | 1341 |
| 42 | Ga0068867_100762184 | 3300005459 | Bacteria | 860 |
| 43 | Ga0070699_100000318 | 3300005518 | Bacteria | 46655 |
| 44 | Ga0070699_100002614 | 3300005518 | Bacteria | 16088 |
| 45 | Ga0070699_100378895 | 3300005518 | Bacteria | 1277 |
| 46 | Ga0070679_100009483 | 3300005530 | Bacteria | 9207 |
| 47 | Ga0070679_100029332 | 3300005530 | Bacteria | 5428 |
| 48 | Ga0070679_100030402 | 3300005530 | Bacteria | 5332 |
| 49 | Ga0070679_100060262 | 3300005530 | Bacteria | 3782 |
| 50 | Ga0070679_100070983 | 3300005530 | Bacteria | 3473 |
| 51 | Ga0070679_100098820 | 3300005530 | Bacteria | 2906 |
| 52 | Ga0070697_100002937 | 3300005536 | Bacteria | 13118 |
| 53 | Ga0070697_100013718 | 3300005536 | Bacteria | 6357 |
| 54 | Ga0070697_100470333 | 3300005536 | Bacteria | 1097 |
| 55 | Ga0068853_100059587 | 3300005539 | Bacteria | 3298 |
| 56 | Ga0070695_100000762 | 3300005545 | Bacteria | 17297 |
| 57 | Ga0070695_100007597 | 3300005545 | Bacteria | 6422 |
| 58 | Ga0070695_100016653 | 3300005545 | Bacteria | 4452 |
| 59 | Ga0070695_100025990 | 3300005545 | Bacteria | 3620 |
| 60 | Ga0070695_100223077 | 3300005545 | Bacteria | 1359 |
| 61 | Ga0070696_100000572 | 3300005546 | Bacteria | 23515 |
| 62 | Ga0070696_100002962 | 3300005546 | Bacteria | 11287 |
| 63 | Ga0070696_100004049 | 3300005546 | Bacteria | 9775 |
| 64 | Ga0070696_100015307 | 3300005546 | Bacteria | 5150 |
| 65 | Ga0070696_100037017 | 3300005546 | Bacteria | 3365 |
| 66 | Ga0070696_100202641 | 3300005546 | Bacteria | 1482 |
| 67 | Ga0070696_100473860 | 3300005546 | Bacteria | 992 |
| 68 | Ga0070693_100022114 | 3300005547 | Bacteria | 3376 |
| 69 | Ga0070693_100036028 | 3300005547 | Bacteria | 2748 |
| 70 | Ga0070693_100074351 | 3300005547 | Bacteria | 2010 |
| 71 | Ga0070704_100019379 | 3300005549 | Bacteria | 4370 |
| 72 | Ga0070704_100022197 | 3300005549 | Bacteria | 4127 |
| 73 | Ga0070704_100036127 | 3300005549 | Bacteria | 3364 |
| 74 | Ga0070704_100046055 | 3300005549 | Bacteria | 3038 |
| 75 | Ga0068855_100037711 | 3300005563 | Bacteria | 5745 |
| 76 | Ga0070664_100000926 | 3300005564 | Bacteria | 22932 |
| 77 | Ga0070664_100050451 | 3300005564 | Bacteria | 3522 |
| 78 | Ga0068857_100016358 | 3300005577 | Bacteria | 6499 |
| 79 | Ga0068857_100032499 | 3300005577 | Bacteria | 4614 |
| 80 | Ga0068854_100085825 | 3300005578 | Bacteria | 2332 |
| 81 | Ga0068854_100140415 | 3300005578 | Bacteria | 1853 |
| 82 | Ga0068856_100031420 | 3300005614 | Bacteria | 5194 |
| 83 | Ga0070702_100063173 | 3300005615 | Bacteria | 2161 |
| 84 | Ga0068859_100001430 | 3300005617 | Bacteria | 24211 |
| 85 | Ga0068859_100082362 | 3300005617 | Bacteria | 3260 |
| 86 | Ga0068859_100130049 | 3300005617 | Bacteria | 2589 |
| 87 | Ga0068859_100612988 | 3300005617 | Bacteria | 1181 |
| 88 | Ga0068864_100022371 | 3300005618 | Bacteria | 5301 |
| 89 | Ga0068861_100029600 | 3300005719 | Bacteria | 4007 |
| 90 | Ga0068861_100109760 | 3300005719 | Bacteria | 2209 |
| 91 | Ga0068860_100057364 | 3300005843 | Bacteria | 3702 |
| 92 | Ga0068860_100275385 | 3300005843 | Bacteria | 1643 |
| 93 | Ga0068862_100002280 | 3300005844 | Bacteria | 17170 |
| 94 | Ga0068862_100056128 | 3300005844 | Bacteria | 3374 |
| 95 | Ga0075365_10000903 | 3300006038 | Bacteria | 12451 |
| 96 | Ga0075368_10030562 | 3300006042 | Bacteria | 2086 |
| 97 | Ga0075368_10078473 | 3300006042 | Bacteria | 1341 |
| 98 | Ga0075364_10022292 | 3300006051 | Bacteria | 3998 |
| 99 | Ga0075367_10006453 | 3300006178 | Bacteria | 5929 |
| 100 | Ga0075367_10008135 | 3300006178 | Bacteria | 5416 |
| 101 | Ga0075367_10023904 | 3300006178 | Bacteria | 3443 |
| 102 | Ga0075367_10160030 | 3300006178 | Bacteria | 1400 |
| 103 | Ga0075369_10024081 | 3300006186 | Bacteria | 2520 |
| 104 | Ga0075369_10082298 | 3300006186 | Bacteria | 1429 |
| 105 | Ga0075428_100370895 | 3300006844 | Bacteria | 1535 |
| 106 | Ga0075428_100377215 | 3300006844 | Bacteria | 1520 |
| 107 | Ga0075431_100019734 | 3300006847 | Bacteria | 6880 |
| 108 | Ga0075431_100041033 | 3300006847 | Bacteria | 4771 |
| 109 | Ga0075431_100099602 | 3300006847 | Bacteria | 2999 |
| 110 | Ga0075431_100265997 | 3300006847 | Bacteria | 1739 |
| 111 | Ga0075433_10000359 | 3300006852 | Bacteria | 28647 |
| 112 | Ga0075433_10162639 | 3300006852 | Bacteria | 1987 |
| 113 | Ga0075434_100008208 | 3300006871 | Bacteria | 9688 |
| 114 | Ga0075434_100013365 | 3300006871 | Bacteria | 7807 |
| 115 | Ga0075434_100031244 | 3300006871 | Bacteria | 5249 |
| 116 | Ga0075434_100115928 | 3300006871 | Bacteria | 2692 |
| 117 | Ga0075434_100241024 | 3300006871 | Bacteria | 1828 |
| 118 | Ga0075429_100051273 | 3300006880 | Bacteria | 3590 |
| 119 | Ga0075436_100002655 | 3300006914 | Bacteria | 12290 |
| 120 | Ga0075436_100029709 | 3300006914 | Bacteria | 3759 |
| 121 | Ga0075436_100035797 | 3300006914 | Bacteria | 3424 |
| 122 | Ga0075436_100041018 | 3300006914 | Bacteria | 3194 |
| 123 | Ga0097620_100001430 | 3300006931 | Bacteria | 24211 |
| 124 | Ga0097620_100082364 | 3300006931 | Bacteria | 3260 |
| 125 | Ga0097620_100130049 | 3300006931 | Bacteria | 2589 |
| 126 | Ga0097620_100612918 | 3300006931 | Bacteria | 1181 |
| 127 | Ga0075435_100034393 | 3300007076 | Bacteria | 4015 |
| 128 | Ga0075435_100053169 | 3300007076 | Bacteria | 3265 |
| 129 | Ga0075435_100055696 | 3300007076 | Bacteria | 3194 |
| 130 | Ga0075435_100111088 | 3300007076 | Bacteria | 2280 |
| 131 | Ga0075435_100218749 | 3300007076 | Bacteria | 1617 |
| 132 | Ga0075435_100376010 | 3300007076 | Bacteria | 1220 |
| 133 | Ga0075435_100391123 | 3300007076 | Bacteria | 1195 |
| 134 | Ga0099794_10000098 | 3300007265 | Bacteria | 32096 |
| 135 | Ga0099794_10020661 | 3300007265 | Bacteria | 2982 |
| 136 | Ga0105250_10087986 | 3300009092 | Bacteria | 1262 |
| 137 | Ga0105240_10102017 | 3300009093 | Bacteria | 3488 |
| 138 | Ga0105240_10127500 | 3300009093 | Bacteria | 3056 |
| 139 | Ga0111539_10002470 | 3300009094 | Bacteria | 24536 |
| 140 | Ga0111539_10090256 | 3300009094 | Bacteria | 3601 |
| 141 | Ga0111539_10201128 | 3300009094 | Bacteria | 2323 |
| 142 | Ga0114129_10002927 | 3300009147 | Bacteria | 23882 |
| 143 | Ga0114129_10004902 | 3300009147 | Bacteria | 18889 |
| 144 | Ga0114129_10005154 | 3300009147 | Bacteria | 18399 |
| 145 | Ga0114129_10042585 | 3300009147 | Bacteria | 6392 |
| 146 | Ga0114129_10066782 | 3300009147 | Bacteria | 5015 |
| 147 | Ga0114129_10173266 | 3300009147 | Bacteria | 2940 |
| 148 | Ga0114129_10748162 | 3300009147 | Bacteria | 1251 |
| 149 | Ga0105241_10002218 | 3300009174 | Bacteria | 14603 |
| 150 | Ga0105241_10148661 | 3300009174 | Bacteria | 1914 |
| 151 | Ga0105248_10045459 | 3300009177 | Bacteria | 4924 |
| 152 | Ga0105249_10000751 | 3300009553 | Bacteria | 29147 |
| 153 | Ga0105249_10140052 | 3300009553 | Bacteria | 2319 |
| 154 | Ga0105249_10599944 | 3300009553 | Bacteria | 1156 |
| 155 | Ga0105239_10837344 | 3300010375 | Bacteria | 1055 |
| 156 | Ga0157373_10009664 | 3300013100 | Bacteria | 7119 |
| 157 | Ga0157373_10033003 | 3300013100 | Bacteria | 3726 |
| 158 | Ga0157370_10031130 | 3300013104 | Bacteria | 5222 |
| 159 | Ga0157370_10122272 | 3300013104 | Bacteria | 2430 |
| 160 | Ga0157378_10436537 | 3300013297 | Bacteria | 1297 |
| 161 | Ga0163162_10374559 | 3300013306 | Bacteria | 1557 |
| 162 | Ga0157372_10028103 | 3300013307 | Bacteria | 6135 |
| 163 | Ga0157372_10060062 | 3300013307 | Bacteria | 4254 |
| 164 | Ga0157375_10778819 | 3300013308 | Bacteria | 1106 |
| 165 | Ga0157380_10009180 | 3300014326 | Bacteria | 7075 |
| 166 | Ga0163161_10390896 | 3300017792 | Bacteria | 1113 |
| 167 | Ga0213872_10066001 | 3300021361 | Bacteria | 1634 |
| 168 | Ga0209758_1000878 | 3300025297 | Bacteria | 41328 |
| 169 | Ga0207653_10000522 | 3300025885 | Bacteria | 14587 |
| 170 | Ga0207685_10050937 | 3300025905 | Bacteria | 1597 |
| 171 | Ga0207645_10090307 | 3300025907 | Bacteria | 1970 |
| 172 | Ga0207645_10174756 | 3300025907 | Bacteria | 1408 |
| 173 | Ga0207684_10000320 | 3300025910 | Bacteria | 68296 |
| 174 | Ga0207654_10203545 | 3300025911 | Bacteria | 1305 |
| 175 | Ga0207707_10022419 | 3300025912 | Bacteria | 5520 |
| 176 | Ga0207707_10040638 | 3300025912 | Bacteria | 4062 |
| 177 | Ga0207707_10163655 | 3300025912 | Bacteria | 1944 |
| 178 | Ga0207695_10317539 | 3300025913 | Bacteria | 1447 |
| 179 | Ga0207671_10169026 | 3300025914 | Bacteria | 1697 |
| 180 | Ga0207660_10009652 | 3300025917 | Bacteria | 6246 |
| 181 | Ga0207660_10069967 | 3300025917 | Bacteria | 2550 |
| 182 | Ga0207660_10097166 | 3300025917 | Bacteria | 2194 |
| 183 | Ga0207662_10110676 | 3300025918 | Bacteria | 1712 |
| 184 | Ga0207662_10162763 | 3300025918 | Bacteria | 1426 |
| 185 | Ga0207657_10004166 | 3300025919 | Bacteria | 15325 |
| 186 | Ga0207649_10028955 | 3300025920 | Bacteria | 3267 |
| 187 | Ga0207649_10127375 | 3300025920 | Bacteria | 1725 |
| 188 | Ga0207652_10001992 | 3300025921 | Bacteria | 17667 |
| 189 | Ga0207652_10157890 | 3300025921 | Bacteria | 2032 |
| 190 | Ga0207652_10171785 | 3300025921 | Bacteria | 1945 |
| 191 | Ga0207652_10202164 | 3300025921 | Bacteria | 1788 |
| 192 | Ga0207646_10050905 | 3300025922 | Bacteria | 3706 |
| 193 | Ga0207664_10317749 | 3300025929 | Bacteria | 1374 |
| 194 | Ga0207690_10064877 | 3300025932 | Bacteria | 2495 |
| 195 | Ga0207690_10129923 | 3300025932 | Bacteria | 1842 |
| 196 | Ga0207690_10300472 | 3300025932 | Bacteria | 1256 |
| 197 | Ga0207706_10050913 | 3300025933 | Bacteria | 3659 |
| 198 | Ga0207706_10057084 | 3300025933 | Bacteria | 3440 |
| 199 | Ga0207706_10068800 | 3300025933 | Bacteria | 3115 |
| 200 | Ga0207670_10188793 | 3300025936 | Bacteria | 1558 |
| 201 | Ga0207704_10201493 | 3300025938 | Bacteria | 1457 |
| 202 | Ga0207691_10285845 | 3300025940 | Bacteria | 1419 |
| 203 | Ga0207711_10036539 | 3300025941 | Bacteria | 4168 |
| 204 | Ga0207711_10589224 | 3300025941 | Bacteria | 1037 |
| 205 | Ga0207689_10002032 | 3300025942 | Bacteria | 19115 |
| 206 | Ga0207689_10004418 | 3300025942 | Bacteria | 12761 |
| 207 | Ga0207689_10065081 | 3300025942 | Bacteria | 2999 |
| 208 | Ga0207689_10066785 | 3300025942 | Bacteria | 2956 |
| 209 | Ga0207679_10000343 | 3300025945 | Bacteria | 33879 |
| 210 | Ga0207667_10046364 | 3300025949 | Bacteria | 4602 |
| 211 | Ga0207712_10004270 | 3300025961 | Bacteria | 9016 |
| 212 | Ga0207712_10155561 | 3300025961 | Bacteria | 1771 |
| 213 | Ga0207712_10164653 | 3300025961 | Bacteria | 1727 |
| 214 | Ga0207668_10330072 | 3300025972 | Bacteria | 1269 |
| 215 | Ga0207640_10072943 | 3300025981 | Bacteria | 2318 |
| 216 | Ga0207658_10059055 | 3300025986 | Bacteria | 2857 |
| 217 | Ga0207658_10148463 | 3300025986 | Bacteria | 1907 |
| 218 | Ga0207677_10083653 | 3300026023 | Bacteria | 2298 |
| 219 | Ga0207639_10404591 | 3300026041 | Bacteria | 1230 |
| 220 | Ga0207639_10444570 | 3300026041 | Bacteria | 1176 |
| 221 | Ga0207678_10007713 | 3300026067 | Bacteria | 9509 |
| 222 | Ga0207678_10276617 | 3300026067 | Bacteria | 1440 |
| 223 | Ga0207708_10051449 | 3300026075 | Bacteria | 3136 |
| 224 | Ga0207702_10036873 | 3300026078 | Bacteria | 4090 |
| 225 | Ga0207648_10136676 | 3300026089 | Bacteria | 2159 |
| 226 | Ga0207648_10289600 | 3300026089 | Bacteria | 1466 |
| 227 | Ga0207676_10009541 | 3300026095 | Bacteria | 6909 |
| 228 | Ga0207674_10003304 | 3300026116 | Bacteria | 19830 |
| 229 | Ga0207674_10032009 | 3300026116 | Bacteria | 5519 |
| 230 | Ga0207675_100002943 | 3300026118 | Bacteria | 16748 |
| 231 | Ga0207675_100025409 | 3300026118 | Bacteria | 5514 |
| 232 | Ga0209588_1000034 | 3300027671 | Bacteria | 66337 |
| 233 | Ga0209813_10001864 | 3300027866 | Bacteria | 4755 |
| 234 | Ga0209813_10002334 | 3300027866 | Bacteria | 4349 |
| 235 | Ga0207428_10110806 | 3300027907 | Bacteria | 2113 |
| 236 | Ga0268265_10003738 | 3300028380 | Bacteria | 10821 |
| 237 | Ga0268265_10052640 | 3300028380 | Bacteria | 3080 |
| 238 | Ga0268264_10002460 | 3300028381 | Bacteria | 16280 |
| 239 | Ga0268264_10049193 | 3300028381 | Bacteria | 3507 |
| 240 | Ga0268264_10241294 | 3300028381 | Bacteria | 1674 |
| 241 | Ga0268264_10371258 | 3300028381 | Bacteria | 1367 |
| 242 | Ga0268264_10592459 | 3300028381 | Bacteria | 1092 |
| 243 | Ga0307515_10023773 | 3300028794 | Bacteria | 10718 |
| 244 | Ga0307509_10126070 | 3300031507 | Bacteria | 2526 |
| 245 | Ga0265314_10002400 | 3300031711 | Bacteria | 19257 |
| 246 | Ga0307412_10423846 | 3300031911 | Bacteria | 1089 |
| 247 | Ga0307409_100027606 | 3300031995 | Bacteria | 4026 |
| 248 | Ga0307416_100017363 | 3300032002 | Bacteria | 5034 |
| 249 | Ga0307415_100043498 | 3300032126 | Bacteria | 2997 |
| 250 | Ga0373929_0057949 | 3300035085 | Bacteria | 900 |
| 251 | Ga0373940_0015386 | 3300035088 | Bacteria | 1880 |
| 252 | Ga0373940_0062255 | 3300035088 | Bacteria | 1070 |
| 253 | Ga0373936_0000008 | 3300035113 | Bacteria | 268505 |
| 254 | Ga0373941_0022004 | 3300035115 | Bacteria | 1805 |
| 255 | Ga0373956_0194277 | 3300035119 | Bacteria | 961 |
| 256 | Ga0373960_0010245 | 3300035121 | Bacteria | 2286 |
| 257 | Ga0373942_0018892 | 3300035207 | Bacteria | 1715 |
| 258 | Ga0373931_0000551 | 3300035691 | Bacteria | 15400 |
| 259 | Ga0373931_0005793 | 3300035691 | Bacteria | 5744 |
| 260 | Ga0373931_0020780 | 3300035691 | Bacteria | 3287 |
| 261 | Ga0373931_0078777 | 3300035691 | Bacteria | 1813 |
| 262 | Ga0373947_0162088 | 3300035725 | Bacteria | 1447 |
| 263 | Ga0436360_0435466 | 3300039438 | Bacteria | 2697 |
| 264 | Ga0436361_0246722 | 3300039447 | Bacteria | 1634 |
| 265 | Ga0439448_0000739 | 3300042005 | Bacteria | 7889 |
| 266 | Ga0439459_0007249 | 3300042438 | Bacteria | 1868 |
| 267 | Ga0451577_0033872 | 3300042876 | Bacteria | 4606 |
| 268 | Ga0451577_0118081 | 3300042876 | Bacteria | 2376 |
| 269 | Ga0466963_0452351 | 3300044694 | Bacteria | 906 |
| 270 | Ga0451576_0004637 | 3300045051 | Bacteria | 17739 |
| 271 | Ga0451576_0053769 | 3300045051 | Bacteria | 4217 |
| 272 | Ga0495603_0048714 | 3300046455 | Bacteria | 2523 |
| 273 | Ga0495603_0053787 | 3300046455 | Bacteria | 2388 |
| 274 | Ga0495580_0086934 | 3300046472 | Bacteria | 2178 |
| 275 | Ga0495594_0019346 | 3300046499 | Bacteria | 3617 |
| 276 | Ga0495598_0042198 | 3300046537 | Bacteria | 1338 |
| 277 | Ga0495621_0062518 | 3300046539 | Bacteria | 1355 |
| 278 | Ga0495656_0099071 | 3300046615 | Bacteria | 1345 |
| 279 | Ga0495669_0008711 | 3300046684 | Bacteria | 4272 |
| 280 | Ga0495672_0125330 | 3300047320 | Bacteria | 1359 |
| 281 | Ga0495672_0160324 | 3300047320 | Bacteria | 1157 |
| 282 | Ga0496101_0120038 | 3300048904 | Bacteria | 1987 |
| 283 | Ga0496102_0003687 | 3300048905 | Bacteria | 12957 |
| 284 | Ga0496102_0035952 | 3300048905 | Bacteria | 4460 |
| 285 | Ga0496103_0041236 | 3300048906 | Bacteria | 2838 |
| 286 | Ga0496104_0041545 | 3300048907 | Bacteria | 4312 |
| 287 | Ga0496106_0003189 | 3300048909 | Bacteria | 12265 |
| 288 | Ga0496108_0155791 | 3300048911 | Bacteria | 1973 |
| 289 | Ga0496109_0028728 | 3300048912 | Bacteria | 4978 |
| 290 | Ga0496109_0353340 | 3300048912 | Bacteria | 1388 |
| 291 | Ga0496110_0040804 | 3300048913 | Bacteria | 4046 |
| 292 | Ga0496111_0034418 | 3300048914 | Bacteria | 3617 |
| 293 | Ga0496112_0163202 | 3300048915 | Bacteria | 2194 |
| 294 | Ga0496115_0020042 | 3300048918 | Bacteria | 5153 |
| 295 | Ga0496117_0063397 | 3300048920 | Bacteria | 2527 |
| 296 | Ga0496118_0177375 | 3300048921 | Bacteria | 1292 |
| 297 | Ga0496119_0003124 | 3300048922 | Bacteria | 17450 |
| 298 | Ga0496121_0001096 | 3300048924 | Bacteria | 47791 |
| 299 | Ga0496121_0007329 | 3300048924 | Bacteria | 13337 |
| 300 | Ga0496126_0003732 | 3300048929 | Bacteria | 18985 |
| 301 | Ga0496126_0553595 | 3300048929 | Bacteria | 912 |
| 302 | Ga0501031_0115491 | 3300049568 | Bacteria | 1754 |
| 303 | Ga0501032_0000005 | 3300049569 | Bacteria | 262926 |
| 304 | Ga0501032_0041217 | 3300049569 | Bacteria | 3136 |
| 305 | Ga0501032_0056856 | 3300049569 | Bacteria | 2628 |
| 306 | Ga0501032_0104590 | 3300049569 | Bacteria | 1875 |
| 307 | Ga0501032_0253789 | 3300049569 | Bacteria | 1141 |
| 308 | Ga0501033_0002556 | 3300049570 | Bacteria | 15371 |
| 309 | Ga0501033_0030257 | 3300049570 | Bacteria | 4068 |
| 310 | Ga0501034_0000027 | 3300049571 | Bacteria | 260512 |
| 311 | Ga0501034_0000119 | 3300049571 | Bacteria | 144440 |
| 312 | Ga0501034_0000295 | 3300049571 | Bacteria | 88435 |
| 313 | Ga0501034_0149061 | 3300049571 | Bacteria | 2315 |
| 314 | Ga0501034_0184651 | 3300049571 | Bacteria | 2049 |
| 315 | Ga0501034_0372686 | 3300049571 | Bacteria | 1353 |
| 316 | Ga0501036_0000217 | 3300049572 | Bacteria | 38514 |
| 317 | Ga0501036_0045887 | 3300049572 | Bacteria | 3700 |
| 318 | Ga0501036_0057223 | 3300049572 | Bacteria | 3303 |
| 319 | Ga0501036_0100369 | 3300049572 | Bacteria | 2448 |
| 320 | Ga0501037_0000125 | 3300049573 | Bacteria | 71187 |
| 321 | Ga0501037_0025039 | 3300049573 | Bacteria | 4410 |
| 322 | Ga0501037_0069263 | 3300049573 | Bacteria | 2568 |
| 323 | Ga0501038_0000053 | 3300049574 | Bacteria | 94583 |
| 324 | Ga0501038_0135599 | 3300049574 | Bacteria | 2017 |
| 325 | Ga0501038_0153750 | 3300049574 | Bacteria | 1874 |
| 326 | Ga0501038_0323335 | 3300049574 | Bacteria | 1206 |
| 327 | Ga0501038_0352746 | 3300049574 | Bacteria | 1145 |
| 328 | Ga0501038_0395329 | 3300049574 | Bacteria | 1070 |
| 329 | Ga0501039_0051645 | 3300049575 | Bacteria | 3181 |
| 330 | Ga0501039_0094232 | 3300049575 | Bacteria | 2334 |
| 331 | Ga0501039_0173463 | 3300049575 | Bacteria | 1695 |
| 332 | Ga0501040_0328497 | 3300049576 | Bacteria | 1094 |
| 333 | Ga0501043_0000011 | 3300049579 | Bacteria | 198958 |
| 334 | Ga0501043_0003332 | 3300049579 | Bacteria | 13236 |
| 335 | Ga0501043_0073965 | 3300049579 | Bacteria | 2676 |
| 336 | Ga0501043_0167312 | 3300049579 | Bacteria | 1716 |
| 337 | Ga0501046_0095683 | 3300049580 | Bacteria | 2281 |
| 338 | Ga0501046_0123423 | 3300049580 | Bacteria | 1969 |
| 339 | Ga0501046_0351281 | 3300049580 | Bacteria | 1070 |
| 340 | Ga0501047_0000382 | 3300049581 | Bacteria | 49844 |
| 341 | Ga0501047_0009272 | 3300049581 | Bacteria | 9296 |
| 342 | Ga0501047_0138729 | 3300049581 | Bacteria | 2310 |
| 343 | Ga0501047_0356506 | 3300049581 | Bacteria | 1299 |
| 344 | Ga0501048_0000031 | 3300049582 | Bacteria | 65561 |
| 345 | Ga0501048_0029455 | 3300049582 | Bacteria | 3982 |
| 346 | Ga0501067_0087912 | 3300049583 | Bacteria | 1724 |
| 347 | Ga0501068_0059900 | 3300049584 | Bacteria | 2311 |
| 348 | Ga0501069_0001609 | 3300049585 | Bacteria | 11174 |
| 349 | Ga0501069_0058395 | 3300049585 | Bacteria | 2151 |
| 350 | Ga0501069_0157494 | 3300049585 | Bacteria | 1307 |
| 351 | Ga0501070_0003372 | 3300049586 | Bacteria | 13862 |
| 352 | Ga0501070_0005422 | 3300049586 | Bacteria | 10887 |
| 353 | Ga0501070_0072142 | 3300049586 | Bacteria | 2858 |
| 354 | Ga0501070_0238472 | 3300049586 | Bacteria | 1489 |
| 355 | Ga0501070_0307352 | 3300049586 | Bacteria | 1291 |
| 356 | Ga0501071_0080372 | 3300049587 | Bacteria | 2384 |
| 357 | Ga0501071_0088386 | 3300049587 | Bacteria | 2273 |
| 358 | Ga0501072_0023869 | 3300049588 | Bacteria | 4752 |
| 359 | Ga0501073_0000687 | 3300049589 | Bacteria | 23778 |
| 360 | Ga0501073_0152292 | 3300049589 | Bacteria | 1602 |
| 361 | Ga0501073_0218534 | 3300049589 | Bacteria | 1316 |
| 362 | Ga0501073_0302644 | 3300049589 | Bacteria | 1103 |
| 363 | Ga0501074_0003900 | 3300049590 | Bacteria | 10629 |
| 364 | Ga0501074_0008609 | 3300049590 | Bacteria | 7389 |
| 365 | Ga0501074_0043729 | 3300049590 | Bacteria | 3242 |
| 366 | Ga0501074_0207623 | 3300049590 | Bacteria | 1395 |
| 367 | Ga0501074_0258644 | 3300049590 | Bacteria | 1238 |
| 368 | Ga0501076_0007483 | 3300049592 | Bacteria | 7949 |
| 369 | Ga0501076_0024932 | 3300049592 | Bacteria | 4627 |
| 370 | Ga0501077_0004621 | 3300049593 | Bacteria | 8361 |
| 371 | Ga0501077_0296929 | 3300049593 | Bacteria | 1029 |
| 372 | Ga0501079_0009556 | 3300049741 | Bacteria | 7353 |
| 373 | Ga0501079_0066565 | 3300049741 | Bacteria | 2780 |
| 374 | Ga0501079_0073438 | 3300049741 | Bacteria | 2644 |
| 375 | Ga0501079_0205711 | 3300049741 | Bacteria | 1537 |
| 376 | Ga0501079_0373084 | 3300049741 | Bacteria | 1118 |
| 377 | Ga0501080_0000478 | 3300049742 | Bacteria | 31148 |
| 378 | Ga0501080_0008686 | 3300049742 | Bacteria | 9224 |
| 379 | Ga0501080_0016378 | 3300049742 | Bacteria | 6846 |
| 380 | Ga0501080_0041373 | 3300049742 | Bacteria | 4294 |
| 381 | Ga0501080_0045617 | 3300049742 | Bacteria | 4080 |
| 382 | Ga0501080_0048573 | 3300049742 | Bacteria | 3949 |
| 383 | Ga0501080_0180178 | 3300049742 | Bacteria | 1945 |
| 384 | Ga0501080_0435654 | 3300049742 | Bacteria | 1176 |
| 385 | Ga0501080_0514523 | 3300049742 | Bacteria | 1068 |
| 386 | Ga0501081_0023728 | 3300049743 | Bacteria | 4113 |
| 387 | Ga0501081_0028572 | 3300049743 | Bacteria | 3764 |
| 388 | Ga0501081_0079268 | 3300049743 | Bacteria | 2297 |
| 389 | Ga0501083_0001432 | 3300049744 | Bacteria | 16284 |
| 390 | Ga0501083_0002087 | 3300049744 | Bacteria | 13749 |
| 391 | Ga0501083_0026964 | 3300049744 | Bacteria | 3968 |
| 392 | Ga0501083_0032221 | 3300049744 | Bacteria | 3596 |
| 393 | Ga0501083_0046008 | 3300049744 | Bacteria | 2951 |
| 394 | Ga0501083_0079767 | 3300049744 | Bacteria | 2170 |
| 395 | Ga0501083_0081414 | 3300049744 | Bacteria | 2146 |
| 396 | Ga0501035_0081241 | 3300049822 | Bacteria | 2861 |
| 397 | Ga0501035_0166942 | 3300049822 | Bacteria | 1903 |
| 398 | Ga0501035_0206738 | 3300049822 | Bacteria | 1681 |
| 399 | Ga0501035_0279938 | 3300049822 | Bacteria | 1410 |
| 400 | Ga0501035_0449276 | 3300049822 | Bacteria | 1066 |
| 401 | Ga0501044_0001546 | 3300049823 | Bacteria | 26990 |
| 402 | Ga0501044_0083486 | 3300049823 | Bacteria | 3230 |
| 403 | Ga0501044_0106464 | 3300049823 | Bacteria | 2816 |
| 404 | Ga0501044_0192793 | 3300049823 | Bacteria | 1999 |
| 405 | Ga0501044_0312502 | 3300049823 | Bacteria | 1497 |
| 406 | Ga0501045_0180153 | 3300049824 | Bacteria | 1574 |
| 407 | Ga0501045_0315715 | 3300049824 | Bacteria | 1163 |
| 408 | nmdc:mga00v17_53503_c1 | 3300050491 | Bacteria | 2461 |
| 409 | nmdc:mga0yw44_3013_c1 | 3300050492 | Bacteria | 7359 |
| 410 | nmdc:mga0k408_134019_c1 | 3300050493 | Bacteria | 1471 |
| 411 | nmdc:mga06z11_3038_c1 | 3300050494 | Bacteria | 6456 |
| 412 | nmdc:mga06z11_667_c1 | 3300050494 | Bacteria | 12487 |
| 413 | nmdc:mga06z11_812_c1 | 3300050494 | Bacteria | 11421 |
| 414 | nmdc:mga04h51_3639_c1 | 3300050495 | Bacteria | 3766 |
| 415 | nmdc:mga04h51_7991_c1 | 3300050495 | Bacteria | 2817 |
| 416 | nmdc:mga07m45_146611_c1 | 3300050496 | Bacteria | 1368 |
| 417 | nmdc:mga05p37_102249_c1 | 3300050507 | Bacteria | 3529 |
| 418 | nmdc:mga05p37_112175_c1 | 3300050507 | Bacteria | 3353 |
| 419 | nmdc:mga05p37_12399_c1 | 3300050507 | Bacteria | 10179 |
| 420 | nmdc:mga05p37_15384_c1 | 3300050507 | Bacteria | 9191 |
| 421 | nmdc:mga05p37_177294_c1 | 3300050507 | Bacteria | 2596 |
| 422 | nmdc:mga05p37_5066_c1 | 3300050507 | Bacteria | 15447 |
| 423 | nmdc:mga09592_197934_c1 | 3300050508 | Bacteria | 1740 |
| 424 | nmdc:mga09592_49458_c1 | 3300050508 | Bacteria | 3544 |
| 425 | nmdc:mga0qj67_162894_c1 | 3300050509 | Bacteria | 1810 |
| 426 | nmdc:mga06r32_23541_c1 | 3300050510 | Bacteria | 5700 |
| 427 | nmdc:mga06r32_312190_c1 | 3300050510 | Bacteria | 1558 |
| 428 | nmdc:mga06r32_81380_c1 | 3300050510 | Bacteria | 3154 |
| 429 | nmdc:mga06r32_9484_c1 | 3300050510 | Bacteria | 8785 |
| 430 | nmdc:mga08y16_24625_c1 | 3300050511 | Bacteria | 6352 |
| 431 | nmdc:mga08y16_278468_c1 | 3300050511 | Bacteria | 1726 |
| 432 | nmdc:mga08y16_49108_c1 | 3300050511 | Bacteria | 4416 |
| 433 | nmdc:mga0n895_136595_c1 | 3300050512 | Bacteria | 2478 |
| 434 | nmdc:mga0n895_14786_c1 | 3300050512 | Bacteria | 7101 |
| 435 | nmdc:mga0n895_158075_c1 | 3300050512 | Bacteria | 2298 |
| 436 | nmdc:mga0n895_197164_c1 | 3300050512 | Bacteria | 2045 |
| 437 | nmdc:mga0n895_22507_c1 | 3300050512 | Bacteria | 5911 |
| 438 | nmdc:mga0n895_26141_c1 | 3300050512 | Bacteria | 5524 |
| 439 | nmdc:mga0n895_676500_c1 | 3300050512 | Bacteria | 1029 |
| 440 | nmdc:mga0rr50_152957_c1 | 3300050513 | Bacteria | 1866 |
| 441 | nmdc:mga0rr50_198723_c1 | 3300050513 | Bacteria | 1647 |
| 442 | nmdc:mga0rr50_44600_c1 | 3300050513 | Bacteria | 3253 |
| 443 | nmdc:mga0rr50_75632_c2 | 3300050513 | Bacteria | 2038 |
| 444 | nmdc:mga0rr50_9712_c1 | 3300050513 | Bacteria | 6069 |
| 445 | nmdc:mga08x19_15631_c1 | 3300050514 | Bacteria | 4619 |
| 446 | nmdc:mga08x19_35_c1 | 3300050514 | Bacteria | 185171 |
| 447 | nmdc:mga0a205_187931_c1 | 3300050515 | Bacteria | 1958 |
| 448 | nmdc:mga0a205_194608_c1 | 3300050515 | Bacteria | 1919 |
| 449 | nmdc:mga0a205_6111_c1 | 3300050515 | Bacteria | 10862 |
| 450 | nmdc:mga0a205_8834_c1 | 3300050515 | Bacteria | 9177 |
| 451 | Ga0500651_0000742 | 3300053093 | Bacteria | 15931 |
| 452 | Ga0500562_016182 | 3300053108 | Bacteria | 1917 |
| 453 | Ga0500595_002811 | 3300053119 | Bacteria | 8368 |
| 454 | Ga0500595_020615 | 3300053119 | Bacteria | 2368 |
| 455 | Ga0500642_0037536 | 3300053130 | Bacteria | 2071 |
| 456 | Ga0500603_009900 | 3300053150 | Bacteria | 2142 |
| 457 | Ga0500616_0054220 | 3300053153 | Bacteria | 2101 |
| 458 | Ga0500636_0017720 | 3300053177 | Bacteria | 4210 |
| 459 | Ga0500636_0093442 | 3300053177 | Bacteria | 1720 |
| 460 | Ga0500601_008728 | 3300053737 | Unclassified | 1128 |
| 461 | Ga0501084_0101057 | 3300054114 | Bacteria | 2421 |
| 462 | Ga0501082_0000027 | 3300060353 | Bacteria | 100915 |
| 463 | Ga0501082_0075282 | 3300060353 | Bacteria | 2908 |
| 464 | Ga0501082_0081804 | 3300060353 | Bacteria | 2787 |
| 465 | Ga0501082_0364506 | 3300060353 | Bacteria | 1260 |
| 466 | Ga0501082_0488993 | 3300060353 | Bacteria | 1075 |
| 467 | Ga0501082_0490711 | 3300060353 | Bacteria | 1073 |
| 468 | Ga0530510_0130736 | 3300061734 | Bacteria | 1847 |
| 469 | Ga0530510_0161930 | 3300061734 | Bacteria | 1655 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005458 | Ga0070681_10115914 | Ga0070681_101159142 | 210 |
| 2 | 3300005546 | Ga0070696_100004049 | Ga0070696_1000040493 | 210 |
| 3 | 3300025912 | Ga0207707_10163655 | Ga0207707_101636552 | 210 |
| 4 | 3300009147 | Ga0114129_10042585 | Ga0114129_100425855 | 235 |
| 5 | 3300050507 | nmdc:mga05p37_112175_c1 | nmdc:mga05p37_112175_c1_2457_3293 | 235 |
| 6 | 3300050510 | nmdc:mga06r32_23541_c1 | nmdc:mga06r32_23541_c1_2088_2924 | 235 |
| 7 | 3300006871 | Ga0075434_100241024 | Ga0075434_1002410242 | 250 |
| 8 | 3300006914 | Ga0075436_100035797 | Ga0075436_1000357972 | 250 |
| 9 | 3300007076 | Ga0075435_100053169 | Ga0075435_1000531692 | 250 |
| 10 | 3300006186 | Ga0075369_10082298 | Ga0075369_100822982 | 252 |
| 11 | 3300009093 | Ga0105240_10102017 | Ga0105240_101020172 | 252 |
| 12 | 3300049586 | Ga0501070_0307352 | Ga0501070_0307352_60_824 | 252 |
| 13 | 3300049822 | Ga0501035_0081241 | Ga0501035_0081241_46_810 | 252 |
| 14 | 3300005445 | Ga0070708_100003901 | Ga0070708_10000390110 | 253 |
| 15 | 3300005530 | Ga0070679_100060262 | Ga0070679_1000602624 | 253 |
| 16 | 3300005536 | Ga0070697_100470333 | Ga0070697_1004703332 | 253 |
| 17 | 3300009093 | Ga0105240_10127500 | Ga0105240_101275002 | 253 |
| 18 | 3300025913 | Ga0207695_10317539 | Ga0207695_103175392 | 253 |
| 19 | 3300025921 | Ga0207652_10171785 | Ga0207652_101717852 | 253 |
| 20 | 3300031711 | Ga0265314_10002400 | Ga0265314_1000240015 | 253 |
| 21 | 3300049569 | Ga0501032_0253789 | Ga0501032_0253789_276_1091 | 253 |
| 22 | 3300049574 | Ga0501038_0323335 | Ga0501038_0323335_308_1123 | 253 |
| 23 | 3300049581 | Ga0501047_0009272 | Ga0501047_0009272_6386_7186 | 253 |
| 24 | 3300049581 | Ga0501047_0356506 | Ga0501047_0356506_308_1126 | 253 |
| 25 | 3300049585 | Ga0501069_0001609 | Ga0501069_0001609_3959_4759 | 253 |
| 26 | 3300049586 | Ga0501070_0003372 | Ga0501070_0003372_1845_2645 | 253 |
| 27 | 3300049589 | Ga0501073_0000687 | Ga0501073_0000687_6301_7101 | 253 |
| 28 | 3300049589 | Ga0501073_0302644 | Ga0501073_0302644_198_1013 | 253 |
| 29 | 3300049590 | Ga0501074_0003900 | Ga0501074_0003900_389_1189 | 253 |
| 30 | 3300049741 | Ga0501079_0009556 | Ga0501079_0009556_3799_4599 | 253 |
| 31 | 3300049742 | Ga0501080_0016378 | Ga0501080_0016378_2015_2815 | 253 |
| 32 | 3300049742 | Ga0501080_0435654 | Ga0501080_0435654_68_868 | 253 |
| 33 | 3300049744 | Ga0501083_0001432 | Ga0501083_0001432_9665_10465 | 253 |
| 34 | 3300049823 | Ga0501044_0106464 | Ga0501044_0106464_201_1016 | 253 |
| 35 | 3300050512 | nmdc:mga0n895_676500_c1 | nmdc:mga0n895_676500_c1_246_1016 | 253 |
| 36 | 3300053150 | Ga0500603_009900 | Ga0500603_009900_397_1215 | 253 |
| 37 | 3300053177 | Ga0500636_0017720 | Ga0500636_0017720_2193_3011 | 253 |
| 38 | 3300053177 | Ga0500636_0093442 | Ga0500636_0093442_534_1352 | 253 |
| 39 | 3300053737 | Ga0500601_008728 | Ga0500601_008728_112_930 | 253 |
| 40 | 3300060353 | Ga0501082_0081804 | Ga0501082_0081804_768_1568 | 253 |
| 41 | 3300007076 | Ga0075435_100391123 | Ga0075435_1003911231 | 254 |
| 42 | 3300026067 | Ga0207678_10007713 | Ga0207678_100077132 | 254 |
| 43 | 3300031507 | Ga0307509_10126070 | Ga0307509_101260702 | 254 |
| 44 | 3300035119 | Ga0373956_0194277 | Ga0373956_0194277_41_907 | 254 |
| 45 | 3300035725 | Ga0373947_0162088 | Ga0373947_0162088_517_1320 | 254 |
| 46 | 3300047320 | Ga0495672_0160324 | Ga0495672_0160324_120_941 | 254 |
| 47 | 3300005336 | Ga0070680_100017779 | Ga0070680_1000177793 | 255 |
| 48 | 3300005336 | Ga0070680_100134781 | Ga0070680_1001347812 | 255 |
| 49 | 3300005337 | Ga0070682_100024286 | Ga0070682_1000242863 | 255 |
| 50 | 3300005339 | Ga0070660_100097575 | Ga0070660_1000975753 | 255 |
| 51 | 3300005354 | Ga0070675_100612840 | Ga0070675_1006128401 | 255 |
| 52 | 3300005406 | Ga0070703_10001020 | Ga0070703_100010208 | 255 |
| 53 | 3300005438 | Ga0070701_10009021 | Ga0070701_100090213 | 255 |
| 54 | 3300005440 | Ga0070705_100000048 | Ga0070705_10000004851 | 255 |
| 55 | 3300005441 | Ga0070700_100026743 | Ga0070700_1000267433 | 255 |
| 56 | 3300005444 | Ga0070694_100000996 | Ga0070694_1000009966 | 255 |
| 57 | 3300005444 | Ga0070694_100335914 | Ga0070694_1003359142 | 255 |
| 58 | 3300005457 | Ga0070662_100448116 | Ga0070662_1004481162 | 255 |
| 59 | 3300005458 | Ga0070681_10255565 | Ga0070681_102555651 | 255 |
| 60 | 3300005518 | Ga0070699_100000318 | Ga0070699_10000031835 | 255 |
| 61 | 3300005530 | Ga0070679_100029332 | Ga0070679_1000293324 | 255 |
| 62 | 3300005530 | Ga0070679_100030402 | Ga0070679_1000304025 | 255 |
| 63 | 3300005530 | Ga0070679_100070983 | Ga0070679_1000709832 | 255 |
| 64 | 3300005536 | Ga0070697_100002937 | Ga0070697_1000029375 | 255 |
| 65 | 3300005539 | Ga0068853_100059587 | Ga0068853_1000595872 | 255 |
| 66 | 3300005545 | Ga0070695_100000762 | Ga0070695_10000076215 | 255 |
| 67 | 3300005545 | Ga0070695_100016653 | Ga0070695_1000166533 | 255 |
| 68 | 3300005545 | Ga0070695_100025990 | Ga0070695_1000259903 | 255 |
| 69 | 3300005545 | Ga0070695_100223077 | Ga0070695_1002230772 | 255 |
| 70 | 3300005546 | Ga0070696_100002962 | Ga0070696_1000029625 | 255 |
| 71 | 3300005546 | Ga0070696_100015307 | Ga0070696_1000153076 | 255 |
| 72 | 3300005547 | Ga0070693_100036028 | Ga0070693_1000360283 | 255 |
| 73 | 3300005547 | Ga0070693_100074351 | Ga0070693_1000743513 | 255 |
| 74 | 3300005549 | Ga0070704_100019379 | Ga0070704_1000193791 | 255 |
| 75 | 3300005549 | Ga0070704_100036127 | Ga0070704_1000361272 | 255 |
| 76 | 3300005577 | Ga0068857_100016358 | Ga0068857_1000163587 | 255 |
| 77 | 3300005578 | Ga0068854_100140415 | Ga0068854_1001404152 | 255 |
| 78 | 3300005615 | Ga0070702_100063173 | Ga0070702_1000631733 | 255 |
| 79 | 3300005617 | Ga0068859_100001430 | Ga0068859_10000143011 | 255 |
| 80 | 3300005617 | Ga0068859_100130049 | Ga0068859_1001300492 | 255 |
| 81 | 3300005618 | Ga0068864_100022371 | Ga0068864_1000223716 | 255 |
| 82 | 3300005719 | Ga0068861_100029600 | Ga0068861_1000296006 | 255 |
| 83 | 3300005719 | Ga0068861_100109760 | Ga0068861_1001097602 | 255 |
| 84 | 3300005843 | Ga0068860_100275385 | Ga0068860_1002753851 | 255 |
| 85 | 3300005844 | Ga0068862_100002280 | Ga0068862_10000228018 | 255 |
| 86 | 3300005844 | Ga0068862_100056128 | Ga0068862_1000561283 | 255 |
| 87 | 3300006038 | Ga0075365_10000903 | Ga0075365_100009036 | 255 |
| 88 | 3300006042 | Ga0075368_10030562 | Ga0075368_100305623 | 255 |
| 89 | 3300006042 | Ga0075368_10078473 | Ga0075368_100784731 | 255 |
| 90 | 3300006051 | Ga0075364_10022292 | Ga0075364_100222923 | 255 |
| 91 | 3300006178 | Ga0075367_10006453 | Ga0075367_100064535 | 255 |
| 92 | 3300006178 | Ga0075367_10008135 | Ga0075367_100081354 | 255 |
| 93 | 3300006178 | Ga0075367_10023904 | Ga0075367_100239044 | 255 |
| 94 | 3300006178 | Ga0075367_10160030 | Ga0075367_101600302 | 255 |
| 95 | 3300006186 | Ga0075369_10024081 | Ga0075369_100240812 | 255 |
| 96 | 3300006847 | Ga0075431_100099602 | Ga0075431_1000996023 | 255 |
| 97 | 3300006852 | Ga0075433_10162639 | Ga0075433_101626392 | 255 |
| 98 | 3300006914 | Ga0075436_100002655 | Ga0075436_1000026557 | 255 |
| 99 | 3300006931 | Ga0097620_100001430 | Ga0097620_10000143011 | 255 |
| 100 | 3300006931 | Ga0097620_100130049 | Ga0097620_1001300492 | 255 |
| 101 | 3300007076 | Ga0075435_100111088 | Ga0075435_1001110883 | 255 |
| 102 | 3300007076 | Ga0075435_100218749 | Ga0075435_1002187492 | 255 |
| 103 | 3300009092 | Ga0105250_10087986 | Ga0105250_100879862 | 255 |
| 104 | 3300009147 | Ga0114129_10004902 | Ga0114129_100049028 | 255 |
| 105 | 3300009147 | Ga0114129_10066782 | Ga0114129_100667825 | 255 |
| 106 | 3300009553 | Ga0105249_10000751 | Ga0105249_1000075122 | 255 |
| 107 | 3300009553 | Ga0105249_10140052 | Ga0105249_101400523 | 255 |
| 108 | 3300009553 | Ga0105249_10599944 | Ga0105249_105999442 | 255 |
| 109 | 3300010375 | Ga0105239_10837344 | Ga0105239_108373441 | 255 |
| 110 | 3300013100 | Ga0157373_10033003 | Ga0157373_100330033 | 255 |
| 111 | 3300013104 | Ga0157370_10031130 | Ga0157370_100311301 | 255 |
| 112 | 3300013104 | Ga0157370_10122272 | Ga0157370_101222723 | 255 |
| 113 | 3300013297 | Ga0157378_10436537 | Ga0157378_104365372 | 255 |
| 114 | 3300013307 | Ga0157372_10060062 | Ga0157372_100600623 | 255 |
| 115 | 3300014326 | Ga0157380_10009180 | Ga0157380_100091802 | 255 |
| 116 | 3300021361 | Ga0213872_10066001 | Ga0213872_100660012 | 255 |
| 117 | 3300025297 | Ga0209758_1000878 | Ga0209758_100087822 | 255 |
| 118 | 3300025885 | Ga0207653_10000522 | Ga0207653_1000052211 | 255 |
| 119 | 3300025905 | Ga0207685_10050937 | Ga0207685_100509372 | 255 |
| 120 | 3300025907 | Ga0207645_10174756 | Ga0207645_101747562 | 255 |
| 121 | 3300025912 | Ga0207707_10040638 | Ga0207707_100406384 | 255 |
| 122 | 3300025914 | Ga0207671_10169026 | Ga0207671_101690262 | 255 |
| 123 | 3300025917 | Ga0207660_10009652 | Ga0207660_100096526 | 255 |
| 124 | 3300025917 | Ga0207660_10069967 | Ga0207660_100699672 | 255 |
| 125 | 3300025917 | Ga0207660_10097166 | Ga0207660_100971662 | 255 |
| 126 | 3300025918 | Ga0207662_10110676 | Ga0207662_101106762 | 255 |
| 127 | 3300025918 | Ga0207662_10162763 | Ga0207662_101627631 | 255 |
| 128 | 3300025921 | Ga0207652_10157890 | Ga0207652_101578902 | 255 |
| 129 | 3300025929 | Ga0207664_10317749 | Ga0207664_103177492 | 255 |
| 130 | 3300025932 | Ga0207690_10129923 | Ga0207690_101299232 | 255 |
| 131 | 3300025933 | Ga0207706_10057084 | Ga0207706_100570844 | 255 |
| 132 | 3300025942 | Ga0207689_10004418 | Ga0207689_100044187 | 255 |
| 133 | 3300025942 | Ga0207689_10065081 | Ga0207689_100650812 | 255 |
| 134 | 3300025942 | Ga0207689_10066785 | Ga0207689_100667854 | 255 |
| 135 | 3300025961 | Ga0207712_10004270 | Ga0207712_100042703 | 255 |
| 136 | 3300025961 | Ga0207712_10155561 | Ga0207712_101555612 | 255 |
| 137 | 3300025986 | Ga0207658_10059055 | Ga0207658_100590553 | 255 |
| 138 | 3300025986 | Ga0207658_10148463 | Ga0207658_101484632 | 255 |
| 139 | 3300026041 | Ga0207639_10404591 | Ga0207639_104045911 | 255 |
| 140 | 3300026041 | Ga0207639_10444570 | Ga0207639_104445701 | 255 |
| 141 | 3300026075 | Ga0207708_10051449 | Ga0207708_100514495 | 255 |
| 142 | 3300026095 | Ga0207676_10009541 | Ga0207676_100095416 | 255 |
| 143 | 3300026116 | Ga0207674_10003304 | Ga0207674_1000330417 | 255 |
| 144 | 3300026118 | Ga0207675_100002943 | Ga0207675_1000029432 | 255 |
| 145 | 3300026118 | Ga0207675_100025409 | Ga0207675_1000254094 | 255 |
| 146 | 3300027866 | Ga0209813_10001864 | Ga0209813_100018643 | 255 |
| 147 | 3300027866 | Ga0209813_10002334 | Ga0209813_100023342 | 255 |
| 148 | 3300028380 | Ga0268265_10003738 | Ga0268265_100037383 | 255 |
| 149 | 3300028380 | Ga0268265_10052640 | Ga0268265_100526402 | 255 |
| 150 | 3300028381 | Ga0268264_10002460 | Ga0268264_1000246011 | 255 |
| 151 | 3300028794 | Ga0307515_10023773 | Ga0307515_100237735 | 255 |
| 152 | 3300031911 | Ga0307412_10423846 | Ga0307412_104238462 | 255 |
| 153 | 3300031995 | Ga0307409_100027606 | Ga0307409_1000276063 | 255 |
| 154 | 3300032002 | Ga0307416_100017363 | Ga0307416_1000173633 | 255 |
| 155 | 3300032126 | Ga0307415_100043498 | Ga0307415_1000434982 | 255 |
| 156 | 3300035113 | Ga0373936_0000008 | Ga0373936_0000008_110602_111387 | 255 |
| 157 | 3300035115 | Ga0373941_0022004 | Ga0373941_0022004_985_1794 | 255 |
| 158 | 3300035121 | Ga0373960_0010245 | Ga0373960_0010245_1210_2067 | 255 |
| 159 | 3300035691 | Ga0373931_0000551 | Ga0373931_0000551_7700_8557 | 255 |
| 160 | 3300039447 | Ga0436361_0246722 | Ga0436361_0246722_519_1316 | 255 |
| 161 | 3300044694 | Ga0466963_0452351 | Ga0466963_0452351_86_889 | 255 |
| 162 | 3300046455 | Ga0495603_0048714 | Ga0495603_0048714_1688_2500 | 255 |
| 163 | 3300047320 | Ga0495672_0125330 | Ga0495672_0125330_98_937 | 255 |
| 164 | 3300048904 | Ga0496101_0120038 | Ga0496101_0120038_555_1367 | 255 |
| 165 | 3300048905 | Ga0496102_0035952 | Ga0496102_0035952_529_1341 | 255 |
| 166 | 3300048906 | Ga0496103_0041236 | Ga0496103_0041236_40_852 | 255 |
| 167 | 3300048907 | Ga0496104_0041545 | Ga0496104_0041545_2034_2876 | 255 |
| 168 | 3300048909 | Ga0496106_0003189 | Ga0496106_0003189_1202_2014 | 255 |
| 169 | 3300048912 | Ga0496109_0028728 | Ga0496109_0028728_3555_4397 | 255 |
| 170 | 3300048912 | Ga0496109_0353340 | Ga0496109_0353340_181_993 | 255 |
| 171 | 3300048913 | Ga0496110_0040804 | Ga0496110_0040804_1965_2807 | 255 |
| 172 | 3300048914 | Ga0496111_0034418 | Ga0496111_0034418_224_1066 | 255 |
| 173 | 3300048918 | Ga0496115_0020042 | Ga0496115_0020042_1751_2563 | 255 |
| 174 | 3300048920 | Ga0496117_0063397 | Ga0496117_0063397_17_829 | 255 |
| 175 | 3300048921 | Ga0496118_0177375 | Ga0496118_0177375_53_865 | 255 |
| 176 | 3300048922 | Ga0496119_0003124 | Ga0496119_0003124_4599_5396 | 255 |
| 177 | 3300048924 | Ga0496121_0001096 | Ga0496121_0001096_25635_26474 | 255 |
| 178 | 3300048924 | Ga0496121_0007329 | Ga0496121_0007329_9720_10532 | 255 |
| 179 | 3300048929 | Ga0496126_0003732 | Ga0496126_0003732_12321_13160 | 255 |
| 180 | 3300048929 | Ga0496126_0553595 | Ga0496126_0553595_16_828 | 255 |
| 181 | 3300049569 | Ga0501032_0000005 | Ga0501032_0000005_172541_173353 | 255 |
| 182 | 3300049569 | Ga0501032_0041217 | Ga0501032_0041217_659_1468 | 255 |
| 183 | 3300049569 | Ga0501032_0056856 | Ga0501032_0056856_305_1114 | 255 |
| 184 | 3300049569 | Ga0501032_0104590 | Ga0501032_0104590_167_976 | 255 |
| 185 | 3300049570 | Ga0501033_0002556 | Ga0501033_0002556_3300_4112 | 255 |
| 186 | 3300049570 | Ga0501033_0030257 | Ga0501033_0030257_1837_2646 | 255 |
| 187 | 3300049571 | Ga0501034_0000027 | Ga0501034_0000027_89573_90385 | 255 |
| 188 | 3300049571 | Ga0501034_0000119 | Ga0501034_0000119_133009_133818 | 255 |
| 189 | 3300049571 | Ga0501034_0000295 | Ga0501034_0000295_50086_50895 | 255 |
| 190 | 3300049571 | Ga0501034_0149061 | Ga0501034_0149061_1286_2071 | 255 |
| 191 | 3300049571 | Ga0501034_0184651 | Ga0501034_0184651_1117_1926 | 255 |
| 192 | 3300049571 | Ga0501034_0372686 | Ga0501034_0372686_387_1211 | 255 |
| 193 | 3300049572 | Ga0501036_0000217 | Ga0501036_0000217_7685_8494 | 255 |
| 194 | 3300049572 | Ga0501036_0045887 | Ga0501036_0045887_1716_2501 | 255 |
| 195 | 3300049572 | Ga0501036_0100369 | Ga0501036_0100369_712_1521 | 255 |
| 196 | 3300049573 | Ga0501037_0000125 | Ga0501037_0000125_41794_42606 | 255 |
| 197 | 3300049573 | Ga0501037_0025039 | Ga0501037_0025039_879_1664 | 255 |
| 198 | 3300049573 | Ga0501037_0069263 | Ga0501037_0069263_566_1375 | 255 |
| 199 | 3300049574 | Ga0501038_0000053 | Ga0501038_0000053_29744_30556 | 255 |
| 200 | 3300049574 | Ga0501038_0135599 | Ga0501038_0135599_850_1659 | 255 |
| 201 | 3300049574 | Ga0501038_0153750 | Ga0501038_0153750_986_1771 | 255 |
| 202 | 3300049574 | Ga0501038_0352746 | Ga0501038_0352746_205_1014 | 255 |
| 203 | 3300049575 | Ga0501039_0094232 | Ga0501039_0094232_822_1631 | 255 |
| 204 | 3300049575 | Ga0501039_0173463 | Ga0501039_0173463_49_858 | 255 |
| 205 | 3300049579 | Ga0501043_0000011 | Ga0501043_0000011_170198_171010 | 255 |
| 206 | 3300049579 | Ga0501043_0003332 | Ga0501043_0003332_11646_12455 | 255 |
| 207 | 3300049579 | Ga0501043_0073965 | Ga0501043_0073965_31_840 | 255 |
| 208 | 3300049579 | Ga0501043_0167312 | Ga0501043_0167312_244_1029 | 255 |
| 209 | 3300049580 | Ga0501046_0123423 | Ga0501046_0123423_851_1660 | 255 |
| 210 | 3300049580 | Ga0501046_0351281 | Ga0501046_0351281_207_992 | 255 |
| 211 | 3300049581 | Ga0501047_0000382 | Ga0501047_0000382_33352_34161 | 255 |
| 212 | 3300049581 | Ga0501047_0138729 | Ga0501047_0138729_711_1496 | 255 |
| 213 | 3300049582 | Ga0501048_0000031 | Ga0501048_0000031_40969_41778 | 255 |
| 214 | 3300049582 | Ga0501048_0029455 | Ga0501048_0029455_833_1618 | 255 |
| 215 | 3300049583 | Ga0501067_0087912 | Ga0501067_0087912_888_1673 | 255 |
| 216 | 3300049584 | Ga0501068_0059900 | Ga0501068_0059900_1313_2098 | 255 |
| 217 | 3300049585 | Ga0501069_0058395 | Ga0501069_0058395_453_1238 | 255 |
| 218 | 3300049585 | Ga0501069_0157494 | Ga0501069_0157494_148_957 | 255 |
| 219 | 3300049586 | Ga0501070_0005422 | Ga0501070_0005422_3950_4759 | 255 |
| 220 | 3300049586 | Ga0501070_0072142 | Ga0501070_0072142_815_1600 | 255 |
| 221 | 3300049586 | Ga0501070_0238472 | Ga0501070_0238472_12_809 | 255 |
| 222 | 3300049587 | Ga0501071_0088386 | Ga0501071_0088386_1392_2177 | 255 |
| 223 | 3300049589 | Ga0501073_0152292 | Ga0501073_0152292_336_1145 | 255 |
| 224 | 3300049589 | Ga0501073_0218534 | Ga0501073_0218534_326_1111 | 255 |
| 225 | 3300049590 | Ga0501074_0008609 | Ga0501074_0008609_5246_6055 | 255 |
| 226 | 3300049590 | Ga0501074_0043729 | Ga0501074_0043729_1762_2571 | 255 |
| 227 | 3300049590 | Ga0501074_0207623 | Ga0501074_0207623_507_1292 | 255 |
| 228 | 3300049593 | Ga0501077_0296929 | Ga0501077_0296929_31_840 | 255 |
| 229 | 3300049741 | Ga0501079_0205711 | Ga0501079_0205711_171_980 | 255 |
| 230 | 3300049741 | Ga0501079_0373084 | Ga0501079_0373084_76_861 | 255 |
| 231 | 3300049742 | Ga0501080_0000478 | Ga0501080_0000478_13489_14298 | 255 |
| 232 | 3300049742 | Ga0501080_0008686 | Ga0501080_0008686_1888_2697 | 255 |
| 233 | 3300049742 | Ga0501080_0041373 | Ga0501080_0041373_1932_2741 | 255 |
| 234 | 3300049742 | Ga0501080_0045617 | Ga0501080_0045617_3021_3830 | 255 |
| 235 | 3300049742 | Ga0501080_0048573 | Ga0501080_0048573_1925_2710 | 255 |
| 236 | 3300049742 | Ga0501080_0514523 | Ga0501080_0514523_119_943 | 255 |
| 237 | 3300049744 | Ga0501083_0002087 | Ga0501083_0002087_10513_11322 | 255 |
| 238 | 3300049744 | Ga0501083_0026964 | Ga0501083_0026964_1331_2128 | 255 |
| 239 | 3300049744 | Ga0501083_0032221 | Ga0501083_0032221_2115_2924 | 255 |
| 240 | 3300049744 | Ga0501083_0079767 | Ga0501083_0079767_688_1473 | 255 |
| 241 | 3300049744 | Ga0501083_0081414 | Ga0501083_0081414_25_834 | 255 |
| 242 | 3300049822 | Ga0501035_0166942 | Ga0501035_0166942_729_1538 | 255 |
| 243 | 3300049822 | Ga0501035_0206738 | Ga0501035_0206738_504_1313 | 255 |
| 244 | 3300049822 | Ga0501035_0279938 | Ga0501035_0279938_568_1380 | 255 |
| 245 | 3300049822 | Ga0501035_0449276 | Ga0501035_0449276_28_831 | 255 |
| 246 | 3300049823 | Ga0501044_0001546 | Ga0501044_0001546_11449_12258 | 255 |
| 247 | 3300049823 | Ga0501044_0083486 | Ga0501044_0083486_1872_2681 | 255 |
| 248 | 3300049823 | Ga0501044_0192793 | Ga0501044_0192793_441_1250 | 255 |
| 249 | 3300049823 | Ga0501044_0312502 | Ga0501044_0312502_469_1254 | 255 |
| 250 | 3300049824 | Ga0501045_0315715 | Ga0501045_0315715_307_1092 | 255 |
| 251 | 3300050491 | nmdc:mga00v17_53503_c1 | nmdc:mga00v17_53503_c1_1159_2091 | 255 |
| 252 | 3300050492 | nmdc:mga0yw44_3013_c1 | nmdc:mga0yw44_3013_c1_1603_2535 | 255 |
| 253 | 3300050493 | nmdc:mga0k408_134019_c1 | nmdc:mga0k408_134019_c1_595_1434 | 255 |
| 254 | 3300050494 | nmdc:mga06z11_3038_c1 | nmdc:mga06z11_3038_c1_3340_4116 | 255 |
| 255 | 3300050494 | nmdc:mga06z11_667_c1 | nmdc:mga06z11_667_c1_1829_2761 | 255 |
| 256 | 3300050494 | nmdc:mga06z11_812_c1 | nmdc:mga06z11_812_c1_3083_4036 | 255 |
| 257 | 3300050495 | nmdc:mga04h51_3639_c1 | nmdc:mga04h51_3639_c1_1570_2502 | 255 |
| 258 | 3300050495 | nmdc:mga04h51_7991_c1 | nmdc:mga04h51_7991_c1_2020_2796 | 255 |
| 259 | 3300050496 | nmdc:mga07m45_146611_c1 | nmdc:mga07m45_146611_c1_419_1258 | 255 |
| 260 | 3300050507 | nmdc:mga05p37_102249_c1 | nmdc:mga05p37_102249_c1_145_924 | 255 |
| 261 | 3300050507 | nmdc:mga05p37_5066_c1 | nmdc:mga05p37_5066_c1_2225_3001 | 255 |
| 262 | 3300050510 | nmdc:mga06r32_81380_c1 | nmdc:mga06r32_81380_c1_1837_2616 | 255 |
| 263 | 3300050512 | nmdc:mga0n895_136595_c1 | nmdc:mga0n895_136595_c1_1295_2071 | 255 |
| 264 | 3300050513 | nmdc:mga0rr50_152957_c1 | nmdc:mga0rr50_152957_c1_837_1613 | 255 |
| 265 | 3300050513 | nmdc:mga0rr50_198723_c1 | nmdc:mga0rr50_198723_c1_147_935 | 255 |
| 266 | 3300050513 | nmdc:mga0rr50_75632_c2 | nmdc:mga0rr50_75632_c2_1006_1848 | 255 |
| 267 | 3300050514 | nmdc:mga08x19_35_c1 | nmdc:mga08x19_35_c1_133362_134204 | 255 |
| 268 | 3300050515 | nmdc:mga0a205_8834_c1 | nmdc:mga0a205_8834_c1_481_1257 | 255 |
| 269 | 3300053093 | Ga0500651_0000742 | Ga0500651_0000742_3911_4732 | 255 |
| 270 | 3300053108 | Ga0500562_016182 | Ga0500562_016182_372_1160 | 255 |
| 271 | 3300053119 | Ga0500595_002811 | Ga0500595_002811_2568_3407 | 255 |
| 272 | 3300053119 | Ga0500595_020615 | Ga0500595_020615_1506_2318 | 255 |
| 273 | 3300053130 | Ga0500642_0037536 | Ga0500642_0037536_969_1790 | 255 |
| 274 | 3300053153 | Ga0500616_0054220 | Ga0500616_0054220_497_1429 | 255 |
| 275 | 3300060353 | Ga0501082_0000027 | Ga0501082_0000027_27660_28451 | 255 |
| 276 | 3300060353 | Ga0501082_0075282 | Ga0501082_0075282_186_983 | 255 |
| 277 | 3300060353 | Ga0501082_0488993 | Ga0501082_0488993_244_1029 | 255 |
| 278 | 3300060353 | Ga0501082_0490711 | Ga0501082_0490711_108_917 | 255 |
| 279 | iso_pu_bacteria | 2929199973 | 2929200144 | 255 |
| 280 | iso_pu_bacteria | 641522639 | 641641084 | 255 |
| 281 | iso_pu_bacteria | 643348564 | 643600691 | 255 |
| 282 | iso_pu_bacteria | 8006984368 | 8006985678 | 255 |
| 283 | iso_pu_bacteria | 8055909800 | 8055912220 | 255 |
| 284 | 3300005289 | Ga0065704_10259530 | Ga0065704_102595301 | 256 |
| 285 | 3300005290 | Ga0065712_10000740 | Ga0065712_1000074011 | 256 |
| 286 | 3300005293 | Ga0065715_10090143 | Ga0065715_100901438 | 256 |
| 287 | 3300005295 | Ga0065707_10176008 | Ga0065707_101760082 | 256 |
| 288 | 3300005330 | Ga0070690_100189067 | Ga0070690_1001890672 | 256 |
| 289 | 3300005331 | Ga0070670_100083499 | Ga0070670_1000834992 | 256 |
| 290 | 3300005336 | Ga0070680_100003751 | Ga0070680_1000037518 | 256 |
| 291 | 3300005336 | Ga0070680_100040197 | Ga0070680_1000401972 | 256 |
| 292 | 3300005337 | Ga0070682_100000304 | Ga0070682_10000030426 | 256 |
| 293 | 3300005339 | Ga0070660_100001492 | Ga0070660_10000149211 | 256 |
| 294 | 3300005344 | Ga0070661_100014112 | Ga0070661_1000141124 | 256 |
| 295 | 3300005353 | Ga0070669_100108078 | Ga0070669_1001080783 | 256 |
| 296 | 3300005356 | Ga0070674_100513747 | Ga0070674_1005137471 | 256 |
| 297 | 3300005366 | Ga0070659_100040464 | Ga0070659_1000404645 | 256 |
| 298 | 3300005406 | Ga0070703_10017094 | Ga0070703_100170943 | 256 |
| 299 | 3300005438 | Ga0070701_10105454 | Ga0070701_101054542 | 256 |
| 300 | 3300005440 | Ga0070705_100014955 | Ga0070705_1000149553 | 256 |
| 301 | 3300005444 | Ga0070694_100006104 | Ga0070694_1000061046 | 256 |
| 302 | 3300005444 | Ga0070694_100009892 | Ga0070694_1000098925 | 256 |
| 303 | 3300005444 | Ga0070694_100016738 | Ga0070694_1000167382 | 256 |
| 304 | 3300005444 | Ga0070694_100326244 | Ga0070694_1003262442 | 256 |
| 305 | 3300005445 | Ga0070708_100049468 | Ga0070708_1000494682 | 256 |
| 306 | 3300005457 | Ga0070662_100038826 | Ga0070662_1000388262 | 256 |
| 307 | 3300005457 | Ga0070662_100048914 | Ga0070662_1000489143 | 256 |
| 308 | 3300005459 | Ga0068867_100053873 | Ga0068867_1000538733 | 256 |
| 309 | 3300005459 | Ga0068867_100292055 | Ga0068867_1002920552 | 256 |
| 310 | 3300005459 | Ga0068867_100762184 | Ga0068867_1007621841 | 256 |
| 311 | 3300005518 | Ga0070699_100002614 | Ga0070699_10000261414 | 256 |
| 312 | 3300005518 | Ga0070699_100378895 | Ga0070699_1003788952 | 256 |
| 313 | 3300005530 | Ga0070679_100009483 | Ga0070679_1000094834 | 256 |
| 314 | 3300005530 | Ga0070679_100098820 | Ga0070679_1000988201 | 256 |
| 315 | 3300005536 | Ga0070697_100013718 | Ga0070697_1000137183 | 256 |
| 316 | 3300005545 | Ga0070695_100007597 | Ga0070695_1000075974 | 256 |
| 317 | 3300005546 | Ga0070696_100000572 | Ga0070696_10000057219 | 256 |
| 318 | 3300005546 | Ga0070696_100037017 | Ga0070696_1000370173 | 256 |
| 319 | 3300005546 | Ga0070696_100202641 | Ga0070696_1002026412 | 256 |
| 320 | 3300005546 | Ga0070696_100473860 | Ga0070696_1004738601 | 256 |
| 321 | 3300005547 | Ga0070693_100022114 | Ga0070693_1000221142 | 256 |
| 322 | 3300005549 | Ga0070704_100022197 | Ga0070704_1000221971 | 256 |
| 323 | 3300005549 | Ga0070704_100046055 | Ga0070704_1000460553 | 256 |
| 324 | 3300005563 | Ga0068855_100037711 | Ga0068855_1000377114 | 256 |
| 325 | 3300005564 | Ga0070664_100000926 | Ga0070664_10000092614 | 256 |
| 326 | 3300005564 | Ga0070664_100050451 | Ga0070664_1000504513 | 256 |
| 327 | 3300005577 | Ga0068857_100032499 | Ga0068857_1000324994 | 256 |
| 328 | 3300005578 | Ga0068854_100085825 | Ga0068854_1000858253 | 256 |
| 329 | 3300005614 | Ga0068856_100031420 | Ga0068856_1000314203 | 256 |
| 330 | 3300005617 | Ga0068859_100082362 | Ga0068859_1000823623 | 256 |
| 331 | 3300005617 | Ga0068859_100612988 | Ga0068859_1006129882 | 256 |
| 332 | 3300005843 | Ga0068860_100057364 | Ga0068860_1000573644 | 256 |
| 333 | 3300006844 | Ga0075428_100370895 | Ga0075428_1003708952 | 256 |
| 334 | 3300006844 | Ga0075428_100377215 | Ga0075428_1003772152 | 256 |
| 335 | 3300006847 | Ga0075431_100019734 | Ga0075431_1000197344 | 256 |
| 336 | 3300006847 | Ga0075431_100041033 | Ga0075431_1000410333 | 256 |
| 337 | 3300006847 | Ga0075431_100265997 | Ga0075431_1002659972 | 256 |
| 338 | 3300006852 | Ga0075433_10000359 | Ga0075433_1000035911 | 256 |
| 339 | 3300006871 | Ga0075434_100008208 | Ga0075434_1000082089 | 256 |
| 340 | 3300006871 | Ga0075434_100013365 | Ga0075434_1000133652 | 256 |
| 341 | 3300006871 | Ga0075434_100031244 | Ga0075434_1000312445 | 256 |
| 342 | 3300006871 | Ga0075434_100115928 | Ga0075434_1001159282 | 256 |
| 343 | 3300006880 | Ga0075429_100051273 | Ga0075429_1000512733 | 256 |
| 344 | 3300006914 | Ga0075436_100029709 | Ga0075436_1000297093 | 256 |
| 345 | 3300006914 | Ga0075436_100041018 | Ga0075436_1000410182 | 256 |
| 346 | 3300006931 | Ga0097620_100082364 | Ga0097620_1000823642 | 256 |
| 347 | 3300006931 | Ga0097620_100612918 | Ga0097620_1006129182 | 256 |
| 348 | 3300007076 | Ga0075435_100034393 | Ga0075435_1000343933 | 256 |
| 349 | 3300007076 | Ga0075435_100055696 | Ga0075435_1000556962 | 256 |
| 350 | 3300007076 | Ga0075435_100376010 | Ga0075435_1003760102 | 256 |
| 351 | 3300007265 | Ga0099794_10000098 | Ga0099794_1000009812 | 256 |
| 352 | 3300007265 | Ga0099794_10020661 | Ga0099794_100206612 | 256 |
| 353 | 3300009094 | Ga0111539_10002470 | Ga0111539_100024706 | 256 |
| 354 | 3300009094 | Ga0111539_10090256 | Ga0111539_100902562 | 256 |
| 355 | 3300009094 | Ga0111539_10201128 | Ga0111539_102011283 | 256 |
| 356 | 3300009147 | Ga0114129_10002927 | Ga0114129_1000292711 | 256 |
| 357 | 3300009147 | Ga0114129_10005154 | Ga0114129_100051547 | 256 |
| 358 | 3300009147 | Ga0114129_10173266 | Ga0114129_101732663 | 256 |
| 359 | 3300009147 | Ga0114129_10748162 | Ga0114129_107481621 | 256 |
| 360 | 3300009174 | Ga0105241_10002218 | Ga0105241_100022189 | 256 |
| 361 | 3300009174 | Ga0105241_10148661 | Ga0105241_101486612 | 256 |
| 362 | 3300009177 | Ga0105248_10045459 | Ga0105248_100454595 | 256 |
| 363 | 3300013100 | Ga0157373_10009664 | Ga0157373_100096643 | 256 |
| 364 | 3300013306 | Ga0163162_10374559 | Ga0163162_103745592 | 256 |
| 365 | 3300013307 | Ga0157372_10028103 | Ga0157372_100281034 | 256 |
| 366 | 3300013308 | Ga0157375_10778819 | Ga0157375_107788192 | 256 |
| 367 | 3300017792 | Ga0163161_10390896 | Ga0163161_103908962 | 256 |
| 368 | 3300025907 | Ga0207645_10090307 | Ga0207645_100903071 | 256 |
| 369 | 3300025910 | Ga0207684_10000320 | Ga0207684_1000032014 | 256 |
| 370 | 3300025911 | Ga0207654_10203545 | Ga0207654_102035452 | 256 |
| 371 | 3300025912 | Ga0207707_10022419 | Ga0207707_100224195 | 256 |
| 372 | 3300025919 | Ga0207657_10004166 | Ga0207657_100041668 | 256 |
| 373 | 3300025920 | Ga0207649_10028955 | Ga0207649_100289553 | 256 |
| 374 | 3300025920 | Ga0207649_10127375 | Ga0207649_101273752 | 256 |
| 375 | 3300025921 | Ga0207652_10001992 | Ga0207652_1000199213 | 256 |
| 376 | 3300025921 | Ga0207652_10202164 | Ga0207652_102021641 | 256 |
| 377 | 3300025922 | Ga0207646_10050905 | Ga0207646_100509055 | 256 |
| 378 | 3300025932 | Ga0207690_10064877 | Ga0207690_100648773 | 256 |
| 379 | 3300025932 | Ga0207690_10300472 | Ga0207690_103004721 | 256 |
| 380 | 3300025933 | Ga0207706_10050913 | Ga0207706_100509133 | 256 |
| 381 | 3300025933 | Ga0207706_10068800 | Ga0207706_100688002 | 256 |
| 382 | 3300025936 | Ga0207670_10188793 | Ga0207670_101887931 | 256 |
| 383 | 3300025938 | Ga0207704_10201493 | Ga0207704_102014932 | 256 |
| 384 | 3300025940 | Ga0207691_10285845 | Ga0207691_102858452 | 256 |
| 385 | 3300025941 | Ga0207711_10036539 | Ga0207711_100365394 | 256 |
| 386 | 3300025941 | Ga0207711_10589224 | Ga0207711_105892242 | 256 |
| 387 | 3300025942 | Ga0207689_10002032 | Ga0207689_100020329 | 256 |
| 388 | 3300025945 | Ga0207679_10000343 | Ga0207679_1000034325 | 256 |
| 389 | 3300025949 | Ga0207667_10046364 | Ga0207667_100463644 | 256 |
| 390 | 3300025961 | Ga0207712_10164653 | Ga0207712_101646532 | 256 |
| 391 | 3300025972 | Ga0207668_10330072 | Ga0207668_103300722 | 256 |
| 392 | 3300025981 | Ga0207640_10072943 | Ga0207640_100729433 | 256 |
| 393 | 3300026023 | Ga0207677_10083653 | Ga0207677_100836532 | 256 |
| 394 | 3300026067 | Ga0207678_10276617 | Ga0207678_102766172 | 256 |
| 395 | 3300026078 | Ga0207702_10036873 | Ga0207702_100368735 | 256 |
| 396 | 3300026089 | Ga0207648_10136676 | Ga0207648_101366763 | 256 |
| 397 | 3300026089 | Ga0207648_10289600 | Ga0207648_102896002 | 256 |
| 398 | 3300026116 | Ga0207674_10032009 | Ga0207674_100320094 | 256 |
| 399 | 3300027671 | Ga0209588_1000034 | Ga0209588_100003466 | 256 |
| 400 | 3300027907 | Ga0207428_10110806 | Ga0207428_101108061 | 256 |
| 401 | 3300028381 | Ga0268264_10049193 | Ga0268264_100491934 | 256 |
| 402 | 3300028381 | Ga0268264_10241294 | Ga0268264_102412942 | 256 |
| 403 | 3300028381 | Ga0268264_10371258 | Ga0268264_103712582 | 256 |
| 404 | 3300028381 | Ga0268264_10592459 | Ga0268264_105924592 | 256 |
| 405 | 3300035085 | Ga0373929_0057949 | Ga0373929_0057949_31_813 | 256 |
| 406 | 3300035088 | Ga0373940_0015386 | Ga0373940_0015386_87_869 | 256 |
| 407 | 3300035088 | Ga0373940_0062255 | Ga0373940_0062255_62_838 | 256 |
| 408 | 3300035207 | Ga0373942_0018892 | Ga0373942_0018892_291_1061 | 256 |
| 409 | 3300035691 | Ga0373931_0005793 | Ga0373931_0005793_992_1762 | 256 |
| 410 | 3300035691 | Ga0373931_0020780 | Ga0373931_0020780_2256_3026 | 256 |
| 411 | 3300035691 | Ga0373931_0078777 | Ga0373931_0078777_637_1419 | 256 |
| 412 | 3300039438 | Ga0436360_0435466 | Ga0436360_0435466_1699_2511 | 256 |
| 413 | 3300042005 | Ga0439448_0000739 | Ga0439448_0000739_137_949 | 256 |
| 414 | 3300042438 | Ga0439459_0007249 | Ga0439459_0007249_740_1552 | 256 |
| 415 | 3300042876 | Ga0451577_0033872 | Ga0451577_0033872_3196_3981 | 256 |
| 416 | 3300042876 | Ga0451577_0118081 | Ga0451577_0118081_1519_2331 | 256 |
| 417 | 3300045051 | Ga0451576_0004637 | Ga0451576_0004637_11955_12731 | 256 |
| 418 | 3300045051 | Ga0451576_0053769 | Ga0451576_0053769_2777_3589 | 256 |
| 419 | 3300046455 | Ga0495603_0053787 | Ga0495603_0053787_711_1493 | 256 |
| 420 | 3300046472 | Ga0495580_0086934 | Ga0495580_0086934_756_1532 | 256 |
| 421 | 3300046499 | Ga0495594_0019346 | Ga0495594_0019346_877_1659 | 256 |
| 422 | 3300046537 | Ga0495598_0042198 | Ga0495598_0042198_17_799 | 256 |
| 423 | 3300046539 | Ga0495621_0062518 | Ga0495621_0062518_46_828 | 256 |
| 424 | 3300046615 | Ga0495656_0099071 | Ga0495656_0099071_200_982 | 256 |
| 425 | 3300046684 | Ga0495669_0008711 | Ga0495669_0008711_1020_1802 | 256 |
| 426 | 3300048905 | Ga0496102_0003687 | Ga0496102_0003687_2051_2833 | 256 |
| 427 | 3300048911 | Ga0496108_0155791 | Ga0496108_0155791_615_1385 | 256 |
| 428 | 3300048915 | Ga0496112_0163202 | Ga0496112_0163202_1172_1942 | 256 |
| 429 | 3300049568 | Ga0501031_0115491 | Ga0501031_0115491_903_1673 | 256 |
| 430 | 3300049572 | Ga0501036_0057223 | Ga0501036_0057223_1457_2227 | 256 |
| 431 | 3300049574 | Ga0501038_0395329 | Ga0501038_0395329_36_806 | 256 |
| 432 | 3300049575 | Ga0501039_0051645 | Ga0501039_0051645_1421_2191 | 256 |
| 433 | 3300049576 | Ga0501040_0328497 | Ga0501040_0328497_130_900 | 256 |
| 434 | 3300049580 | Ga0501046_0095683 | Ga0501046_0095683_1183_1953 | 256 |
| 435 | 3300049587 | Ga0501071_0080372 | Ga0501071_0080372_1075_1845 | 256 |
| 436 | 3300049588 | Ga0501072_0023869 | Ga0501072_0023869_22_792 | 256 |
| 437 | 3300049590 | Ga0501074_0258644 | Ga0501074_0258644_296_1066 | 256 |
| 438 | 3300049592 | Ga0501076_0007483 | Ga0501076_0007483_664_1446 | 256 |
| 439 | 3300049592 | Ga0501076_0024932 | Ga0501076_0024932_2841_3611 | 256 |
| 440 | 3300049593 | Ga0501077_0004621 | Ga0501077_0004621_6887_7657 | 256 |
| 441 | 3300049741 | Ga0501079_0066565 | Ga0501079_0066565_1868_2638 | 256 |
| 442 | 3300049741 | Ga0501079_0073438 | Ga0501079_0073438_1651_2433 | 256 |
| 443 | 3300049742 | Ga0501080_0180178 | Ga0501080_0180178_619_1389 | 256 |
| 444 | 3300049743 | Ga0501081_0023728 | Ga0501081_0023728_1707_2477 | 256 |
| 445 | 3300049743 | Ga0501081_0028572 | Ga0501081_0028572_354_1136 | 256 |
| 446 | 3300049743 | Ga0501081_0079268 | Ga0501081_0079268_904_1674 | 256 |
| 447 | 3300049744 | Ga0501083_0046008 | Ga0501083_0046008_1426_2196 | 256 |
| 448 | 3300049824 | Ga0501045_0180153 | Ga0501045_0180153_379_1149 | 256 |
| 449 | 3300050507 | nmdc:mga05p37_12399_c1 | nmdc:mga05p37_12399_c1_6603_7385 | 256 |
| 450 | 3300050507 | nmdc:mga05p37_15384_c1 | nmdc:mga05p37_15384_c1_2909_3685 | 256 |
| 451 | 3300050507 | nmdc:mga05p37_177294_c1 | nmdc:mga05p37_177294_c1_203_973 | 256 |
| 452 | 3300050508 | nmdc:mga09592_197934_c1 | nmdc:mga09592_197934_c1_770_1561 | 256 |
| 453 | 3300050508 | nmdc:mga09592_49458_c1 | nmdc:mga09592_49458_c1_1332_2114 | 256 |
| 454 | 3300050509 | nmdc:mga0qj67_162894_c1 | nmdc:mga0qj67_162894_c1_919_1701 | 256 |
| 455 | 3300050510 | nmdc:mga06r32_312190_c1 | nmdc:mga06r32_312190_c1_200_970 | 256 |
| 456 | 3300050510 | nmdc:mga06r32_9484_c1 | nmdc:mga06r32_9484_c1_3145_3927 | 256 |
| 457 | 3300050511 | nmdc:mga08y16_24625_c1 | nmdc:mga08y16_24625_c1_3085_3855 | 256 |
| 458 | 3300050511 | nmdc:mga08y16_278468_c1 | nmdc:mga08y16_278468_c1_129_899 | 256 |
| 459 | 3300050511 | nmdc:mga08y16_49108_c1 | nmdc:mga08y16_49108_c1_3026_3808 | 256 |
| 460 | 3300050512 | nmdc:mga0n895_14786_c1 | nmdc:mga0n895_14786_c1_2335_3105 | 256 |
| 461 | 3300050512 | nmdc:mga0n895_158075_c1 | nmdc:mga0n895_158075_c1_834_1616 | 256 |
| 462 | 3300050512 | nmdc:mga0n895_197164_c1 | nmdc:mga0n895_197164_c1_1205_1990 | 256 |
| 463 | 3300050512 | nmdc:mga0n895_22507_c1 | nmdc:mga0n895_22507_c1_3052_3828 | 256 |
| 464 | 3300050512 | nmdc:mga0n895_26141_c1 | nmdc:mga0n895_26141_c1_1078_1854 | 256 |
| 465 | 3300050513 | nmdc:mga0rr50_44600_c1 | nmdc:mga0rr50_44600_c1_485_1255 | 256 |
| 466 | 3300050513 | nmdc:mga0rr50_9712_c1 | nmdc:mga0rr50_9712_c1_2748_3524 | 256 |
| 467 | 3300050514 | nmdc:mga08x19_15631_c1 | nmdc:mga08x19_15631_c1_1096_1872 | 256 |
| 468 | 3300050515 | nmdc:mga0a205_187931_c1 | nmdc:mga0a205_187931_c1_545_1315 | 256 |
| 469 | 3300050515 | nmdc:mga0a205_194608_c1 | nmdc:mga0a205_194608_c1_798_1568 | 256 |
| 470 | 3300050515 | nmdc:mga0a205_6111_c1 | nmdc:mga0a205_6111_c1_8991_9767 | 256 |
| 471 | 3300054114 | Ga0501084_0101057 | Ga0501084_0101057_1313_2083 | 256 |
| 472 | 3300060353 | Ga0501082_0364506 | Ga0501082_0364506_77_847 | 256 |
| 473 | 3300061734 | Ga0530510_0130736 | Ga0530510_0130736_684_1454 | 256 |
| 474 | 3300061734 | Ga0530510_0161930 | Ga0530510_0161930_284_1066 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l2t-assembly1.cif.gz_B | dimeric structure of mj0796, a bacterial abc transporter cassette | 0.9295 | 4 | 223 |
| 7ahd-assembly1.cif.gz_D | opua (e190q) occluded | 0.929 | 3 | 222 |
| 3rlf-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.9283 | 4 | 220 |
| 3pux-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 | 0.9266 | 3 | 220 |
| 3puy-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state | 0.9261 | 3 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.951 | 4 | 244 | 3.40.50.300 |
| af_Q2G1I6_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9425 | 4 | 250 | 3.40.50.300 |
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9335 | 2 | 207 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9321 | 4 | 244 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9266 | 4 | 237 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9VND7-F1-model_v4 | ABC transporter domain-containing protein | 0.9677 | 1 | 75 |
GO:0005524
GO:0016887 |
| AF-A0A7V4SRL2-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9644 | 1 | 168 |
GO:0005524
GO:0016887 |
| AF-A0A147KIF1-F1-model_v4 | Nitrate ABC transporter ATPase | 0.9591 | 2 | 177 |
GO:0005524
GO:0016887 |
| AF-A0A7W4J802-F1-model_v4 | ABC transporter ATP-binding protein | 0.95 | 1 | 252 |
GO:0005524
GO:0016887 |
| AF-A0A4V2TDA4-F1-model_v4 | deleted | 0.9483 | 2 | 246 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar