F451131

General Info

Members Datasets Scaffolds Average Seq Length
474 276 471 216

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100153221|Ga0070690_1001532212
Length 240
Sequence MVTGPSTTTAVQKAVGPVVLLGPPGAGKGTQPKRIAEHFGIPQISTGDILRANVAAGTELGKQAKSVMESGNLVPDELLFGMVSARVGEADCARGYILDGFPRTLAQAEWLDKFFQNQRDAQLPPVVVDIQVGYNELLGRLTGRRTCPTCGRIYNVHLSAPKVEGLCDVEGSKLVTRKDDEETVIAERLKAYERQTAPLTDYYKSQGRLLILDGSRSIDEVTSQAFQAIEKAREKNVGQR

Samples

Sample ID Description Type Environment
1 2858950400 Achromobacter sp. K91 Isolate Unclassified
2 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
3 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
246 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
247 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
248 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
258 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
259 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 1.69
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 2.53
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000125 3300003187 Bacteria 103269
2 rootL2_10197350 3300003322 Bacteria 1724
3 JGI25407J50210_10030373 3300003373 Unclassified 1400
4 Ga0055529_1001134 3300003763 Bacteria 11334
5 Ga0058860_12218425 3300004801 Bacteria 1921
6 Ga0058862_12257618 3300004803 Bacteria 1425
7 Ga0065712_10001927 3300005290 Bacteria 6937
8 Ga0065712_10067999 3300005290 Bacteria 17558
9 Ga0065715_10003991 3300005293 Bacteria 5636
10 Ga0065715_10093268 3300005293 Bacteria 4741
11 Ga0065707_10010154 3300005295 Bacteria 2492
12 Ga0065707_10149563 3300005295 Bacteria 1674
13 Ga0070658_10735428 3300005327 Bacteria 857
14 Ga0070676_10016702 3300005328 Bacteria 4058
15 Ga0070683_100867176 3300005329 Bacteria 866
16 Ga0070690_100006446 3300005330 Bacteria 6655
17 Ga0070690_100153221 3300005330 Bacteria 1574
18 Ga0070690_100322935 3300005330 Bacteria 1113
19 Ga0070670_100003499 3300005331 Bacteria 13051
20 Ga0070670_100766759 3300005331 Bacteria 870
21 Ga0070677_10051626 3300005333 Bacteria 1665
22 Ga0068869_100018620 3300005334 Bacteria 4731
23 Ga0070666_10110540 3300005335 Bacteria 1900
24 Ga0070680_100007166 3300005336 Bacteria 8498
25 Ga0070680_100046777 3300005336 Bacteria 3521
26 Ga0070680_100494618 3300005336 Bacteria 1046
27 Ga0070682_100006664 3300005337 Bacteria 6476
28 Ga0070682_100237927 3300005337 Bacteria 1306
29 Ga0068868_100064796 3300005338 Bacteria 2902
30 Ga0070660_100214439 3300005339 Bacteria 1563
31 Ga0070660_100983401 3300005339 Bacteria 713
32 Ga0070689_100073566 3300005340 Bacteria 2673
33 Ga0070689_100409160 3300005340 Bacteria 1148
34 Ga0070691_10154398 3300005341 Bacteria 1179
35 Ga0070661_100007908 3300005344 Bacteria 7343
36 Ga0070668_100045712 3300005347 Bacteria 3359
37 Ga0070668_100782159 3300005347 Bacteria 847
38 Ga0070675_100151568 3300005354 Bacteria 1988
39 Ga0070671_100134464 3300005355 Bacteria 2084
40 Ga0070674_100166276 3300005356 Bacteria 1678
41 Ga0070673_100029641 3300005364 Bacteria 4083
42 Ga0070659_100243422 3300005366 Bacteria 1489
43 Ga0070659_100404408 3300005366 Bacteria 1153
44 Ga0070659_100406888 3300005366 Bacteria 1149
45 Ga0070703_10024786 3300005406 Bacteria 1775
46 Ga0070709_10079670 3300005434 Bacteria 2134
47 Ga0070709_10229790 3300005434 Bacteria 1327
48 Ga0070714_100318563 3300005435 Bacteria 1454
49 Ga0070714_100387494 3300005435 Bacteria 1319
50 Ga0070714_100657984 3300005435 Unclassified 1009
51 Ga0070713_100000364 3300005436 Bacteria 29177
52 Ga0070713_100030142 3300005436 Bacteria 4304
53 Ga0070713_100311865 3300005436 Bacteria 1451
54 Ga0070713_100512526 3300005436 Unclassified 1133
55 Ga0070710_10031205 3300005437 Bacteria 2874
56 Ga0070711_100113461 3300005439 Bacteria 1993
57 Ga0070705_100068087 3300005440 Bacteria 2141
58 Ga0070694_100044357 3300005444 Bacteria 2975
59 Ga0070708_100059463 3300005445 Bacteria 3407
60 Ga0070708_100075166 3300005445 Bacteria 3049
61 Ga0070663_100007805 3300005455 Bacteria 6540
62 Ga0070678_100009325 3300005456 Bacteria 5939
63 Ga0070678_100041189 3300005456 Bacteria 3273
64 Ga0070678_100058796 3300005456 Bacteria 2823
65 Ga0070662_100044501 3300005457 Bacteria 3180
66 Ga0070662_100479626 3300005457 Bacteria 1035
67 Ga0070681_10007681 3300005458 Bacteria 10545
68 Ga0070681_10009423 3300005458 Bacteria 9609
69 Ga0070681_10054241 3300005458 Bacteria 3994
70 Ga0070706_100104438 3300005467 Bacteria 2635
71 Ga0070706_100158025 3300005467 Bacteria 2116
72 Ga0070706_100343784 3300005467 Bacteria 1391
73 Ga0070707_100636040 3300005468 Bacteria 1029
74 Ga0070698_100023059 3300005471 Bacteria 6509
75 Ga0070699_100000239 3300005518 Bacteria 53734
76 Ga0070699_100046351 3300005518 Bacteria 3761
77 Ga0070679_100001504 3300005530 Bacteria 20719
78 Ga0070679_100064759 3300005530 Bacteria 3643
79 Ga0070679_100613736 3300005530 Bacteria 1031
80 Ga0070684_100762968 3300005535 Bacteria 903
81 Ga0070697_100000351 3300005536 Bacteria 36223
82 Ga0070697_100006235 3300005536 Bacteria 9233
83 Ga0070697_100099096 3300005536 Bacteria 2419
84 Ga0068853_100003417 3300005539 Bacteria 12149
85 Ga0068853_100254885 3300005539 Bacteria 1611
86 Ga0070672_100026149 3300005543 Bacteria 4338
87 Ga0070686_100026074 3300005544 Bacteria 3524
88 Ga0070695_100020500 3300005545 Bacteria 4037
89 Ga0070695_100136654 3300005545 Bacteria 1695
90 Ga0070695_100488839 3300005545 Bacteria 950
91 Ga0070696_100015848 3300005546 Bacteria 5066
92 Ga0070696_100048380 3300005546 Bacteria 2952
93 Ga0070696_100110182 3300005546 Bacteria 1982
94 Ga0070693_100006749 3300005547 Bacteria 5573
95 Ga0070693_100016594 3300005547 Bacteria 3814
96 Ga0070704_100029812 3300005549 Bacteria 3648
97 Ga0068855_100023808 3300005563 Bacteria 7336
98 Ga0068855_100140413 3300005563 Bacteria 2755
99 Ga0070664_100077382 3300005564 Bacteria 2860
100 Ga0070664_100195611 3300005564 Bacteria 1802
101 Ga0070664_101221532 3300005564 Bacteria 709
102 Ga0068857_100379313 3300005577 Bacteria 1313
103 Ga0068857_100447525 3300005577 Bacteria 1207
104 Ga0068854_100004643 3300005578 Bacteria 8668
105 Ga0068856_100036536 3300005614 Bacteria 4816
106 Ga0068856_100382198 3300005614 Unclassified 1427
107 Ga0068852_100559026 3300005616 Bacteria 1145
108 Ga0068864_100473722 3300005618 Bacteria 1201
109 Ga0068866_10041285 3300005718 Bacteria 2288
110 Ga0068866_10234946 3300005718 Bacteria 1114
111 Ga0068861_100012967 3300005719 Bacteria 5822
112 Ga0068858_100204716 3300005842 Bacteria 1867
113 Ga0068860_100029326 3300005843 Bacteria 5292
114 Ga0068860_100158753 3300005843 Bacteria 2180
115 Ga0068860_100256456 3300005843 Bacteria 1704
116 Ga0068860_100779037 3300005843 Bacteria 969
117 Ga0068862_100557217 3300005844 Bacteria 1095
118 Ga0081455_10211578 3300005937 Bacteria 1444
119 Ga0081455_10302081 3300005937 Bacteria 1148
120 Ga0081538_10001160 3300005981 Bacteria 27853
121 Ga0081540_1015624 3300005983 Bacteria 4798
122 Ga0081539_10043683 3300005985 Bacteria 2595
123 Ga0070717_10024604 3300006028 Bacteria 4784
124 Ga0070717_10079844 3300006028 Bacteria 2744
125 Ga0070717_10085848 3300006028 Bacteria 2649
126 Ga0070717_10349449 3300006028 Bacteria 1322
127 Ga0070716_100012088 3300006173 Bacteria 4365
128 Ga0070716_100037411 3300006173 Bacteria 2682
129 Ga0070716_100100797 3300006173 Bacteria 1769
130 Ga0070712_100001135 3300006175 Bacteria 16046
131 Ga0070712_100003022 3300006175 Bacteria 10410
132 Ga0070712_100104753 3300006175 Bacteria 2100
133 Ga0070712_100162837 3300006175 Bacteria 1724
134 Ga0075367_10021499 3300006178 Bacteria 3607
135 Ga0097621_100042897 3300006237 Bacteria 3644
136 Ga0068871_100096200 3300006358 Bacteria 2473
137 Ga0075428_100003811 3300006844 Bacteria 16546
138 Ga0075428_100156236 3300006844 Bacteria 2478
139 Ga0075428_100287815 3300006844 Unclassified 1768
140 Ga0075430_100094222 3300006846 Bacteria 2503
141 Ga0075430_100217290 3300006846 Unclassified 1586
142 Ga0075431_100014254 3300006847 Bacteria 8038
143 Ga0075431_100034379 3300006847 Bacteria 5222
144 Ga0075433_10008452 3300006852 Bacteria 8215
145 Ga0075433_10015663 3300006852 Bacteria 6227
146 Ga0075433_10091411 3300006852 Bacteria 2690
147 Ga0075433_10096754 3300006852 Bacteria 2612
148 Ga0075433_10113510 3300006852 Bacteria 2403
149 Ga0075433_10540132 3300006852 Unclassified 1025
150 Ga0075434_100000038 3300006871 Bacteria 59843
151 Ga0075434_100041556 3300006871 Bacteria 4555
152 Ga0075434_100061457 3300006871 Bacteria 3737
153 Ga0075434_100095665 3300006871 Bacteria 2975
154 Ga0075434_100216663 3300006871 Bacteria 1934
155 Ga0075434_100247198 3300006871 Bacteria 1803
156 Ga0075429_100116218 3300006880 Bacteria 2339
157 Ga0075429_100162903 3300006880 Bacteria 1953
158 Ga0068865_100202199 3300006881 Bacteria 1543
159 Ga0075436_100030268 3300006914 Bacteria 3726
160 Ga0075436_100051763 3300006914 Bacteria 2833
161 Ga0075435_100026527 3300007076 Bacteria 4522
162 Ga0075435_100033637 3300007076 Bacteria 4055
163 Ga0075435_100042123 3300007076 Bacteria 3651
164 Ga0075435_100047535 3300007076 Bacteria 3445
165 Ga0075435_100115423 3300007076 Bacteria 2236
166 Ga0075435_100162807 3300007076 Bacteria 1880
167 Ga0075435_100183588 3300007076 Unclassified 1768
168 Ga0099794_10004600 3300007265 Bacteria 5445
169 Ga0099795_10007913 3300007788 Bacteria 2999
170 Ga0105240_10029138 3300009093 Bacteria 7199
171 Ga0105240_10089059 3300009093 Bacteria 3775
172 Ga0111539_10078466 3300009094 Bacteria 3885
173 Ga0111539_10902622 3300009094 Bacteria 1028
174 Ga0114129_10000332 3300009147 Bacteria 55123
175 Ga0114129_10028924 3300009147 Bacteria 7851
176 Ga0114129_10042483 3300009147 Bacteria 6402
177 Ga0114129_10052015 3300009147 Bacteria 5749
178 Ga0114129_10057996 3300009147 Bacteria 5417
179 Ga0114129_10153422 3300009147 Bacteria 3152
180 Ga0114129_10250012 3300009147 Bacteria 2380
181 Ga0114129_10385726 3300009147 Bacteria 1849
182 Ga0105243_10028697 3300009148 Bacteria 4273
183 Ga0105241_10012328 3300009174 Bacteria 6270
184 Ga0105241_10170285 3300009174 Bacteria 1798
185 Ga0105248_10673627 3300009177 Unclassified 1167
186 Ga0105237_10200065 3300009545 Bacteria 1997
187 Ga0105238_10686799 3300009551 Unclassified 1035
188 Ga0105249_10130105 3300009553 Bacteria 2402
189 Ga0105239_10167092 3300010375 Bacteria 2460
190 Ga0105239_10334395 3300010375 Bacteria 1709
191 Ga0157373_10083075 3300013100 Bacteria 2258
192 Ga0157373_10103159 3300013100 Bacteria 2006
193 Ga0157371_10041162 3300013102 Bacteria 3298
194 Ga0157370_10030928 3300013104 Bacteria 5242
195 Ga0157369_10143163 3300013105 Bacteria 2529
196 Ga0157374_10089450 3300013296 Bacteria 2934
197 Ga0157378_10009854 3300013297 Bacteria 8329
198 Ga0157378_10022529 3300013297 Bacteria 5542
199 Ga0163162_10090029 3300013306 Bacteria 3150
200 Ga0157372_10004056 3300013307 Bacteria 15697
201 Ga0157372_10117479 3300013307 Bacteria 3051
202 Ga0157375_11766482 3300013308 Bacteria 733
203 Ga0163163_10178761 3300014325 Bacteria 2169
204 Ga0157377_10148564 3300014745 Bacteria 1447
205 Ga0157379_10197003 3300014968 Bacteria 1821
206 Ga0182007_10038385 3300015262 Bacteria 1606
207 Ga0182007_10096716 3300015262 Bacteria 975
208 Ga0197907_10064221 3300020069 Bacteria 3965
209 Ga0206356_10164288 3300020070 Bacteria 3057
210 Ga0206352_10653387 3300020078 Bacteria 5763
211 Ga0224712_10017833 3300022467 Bacteria 2361
212 Ga0207697_10005586 3300025315 Bacteria 5824
213 Ga0207692_10020497 3300025898 Bacteria 3008
214 Ga0207688_10016663 3300025901 Bacteria 3990
215 Ga0207680_10022908 3300025903 Bacteria 3402
216 Ga0207647_10234807 3300025904 Unclassified 1054
217 Ga0207699_10014274 3300025906 Bacteria 4090
218 Ga0207699_10271114 3300025906 Bacteria 1176
219 Ga0207645_10004575 3300025907 Bacteria 10198
220 Ga0207684_10293700 3300025910 Unclassified 1401
221 Ga0207707_10000723 3300025912 Bacteria 32671
222 Ga0207707_10007456 3300025912 Bacteria 9532
223 Ga0207707_10014575 3300025912 Bacteria 6848
224 Ga0207695_10148753 3300025913 Bacteria 2283
225 Ga0207693_10000026 3300025915 Bacteria 122717
226 Ga0207693_10004232 3300025915 Bacteria 12174
227 Ga0207693_10131173 3300025915 Unclassified 1970
228 Ga0207663_10031788 3300025916 Bacteria 3127
229 Ga0207660_10020146 3300025917 Bacteria 4473
230 Ga0207660_10041447 3300025917 Bacteria 3226
231 Ga0207660_10087989 3300025917 Bacteria 2296
232 Ga0207657_10024114 3300025919 Bacteria 5648
233 Ga0207649_10004988 3300025920 Bacteria 7171
234 Ga0207652_10008500 3300025921 Bacteria 8263
235 Ga0207652_10057221 3300025921 Bacteria 3357
236 Ga0207652_10201250 3300025921 Bacteria 1792
237 Ga0207646_10073859 3300025922 Bacteria 3046
238 Ga0207681_10010269 3300025923 Bacteria 5732
239 Ga0207650_10000836 3300025925 Bacteria 23400
240 Ga0207659_10318630 3300025926 Bacteria 1282
241 Ga0207700_10004902 3300025928 Bacteria 7952
242 Ga0207700_10042550 3300025928 Bacteria 3331
243 Ga0207700_10357956 3300025928 Bacteria 1272
244 Ga0207664_10076602 3300025929 Bacteria 2708
245 Ga0207664_10458125 3300025929 Bacteria 1139
246 Ga0207644_10096639 3300025931 Bacteria 2211
247 Ga0207690_10072361 3300025932 Bacteria 2381
248 Ga0207690_10115848 3300025932 Bacteria 1937
249 Ga0207690_10189783 3300025932 Bacteria 1553
250 Ga0207706_10005201 3300025933 Bacteria 12139
251 Ga0207706_10301429 3300025933 Bacteria 1396
252 Ga0207669_10111099 3300025937 Bacteria 1837
253 Ga0207704_10225344 3300025938 Bacteria 1390
254 Ga0207665_10012476 3300025939 Bacteria 5580
255 Ga0207665_10019095 3300025939 Bacteria 4504
256 Ga0207665_10042405 3300025939 Bacteria 3041
257 Ga0207665_10106710 3300025939 Bacteria 1963
258 Ga0207691_10001493 3300025940 Bacteria 23313
259 Ga0207689_10020564 3300025942 Bacteria 5554
260 Ga0207689_10103370 3300025942 Bacteria 2341
261 Ga0207661_10168187 3300025944 Bacteria 1907
262 Ga0207661_10532595 3300025944 Unclassified 1075
263 Ga0207679_10007512 3300025945 Bacteria 6918
264 Ga0207679_10335446 3300025945 Bacteria 1313
265 Ga0207667_10029278 3300025949 Bacteria 5973
266 Ga0207651_10139963 3300025960 Bacteria 1868
267 Ga0207668_10904600 3300025972 Unclassified 785
268 Ga0207677_10069873 3300026023 Bacteria 2472
269 Ga0207703_10168426 3300026035 Bacteria 1925
270 Ga0207639_10030406 3300026041 Bacteria 3960
271 Ga0207639_10480670 3300026041 Unclassified 1132
272 Ga0207678_10003725 3300026067 Bacteria 13712
273 Ga0207702_10003851 3300026078 Bacteria 13535
274 Ga0207702_10036414 3300026078 Bacteria 4116
275 Ga0207648_10222157 3300026089 Bacteria 1679
276 Ga0207676_10456882 3300026095 Bacteria 1205
277 Ga0207674_10153949 3300026116 Bacteria 2255
278 Ga0207674_10261288 3300026116 Unclassified 1678
279 Ga0207674_10311672 3300026116 Bacteria 1523
280 Ga0207675_100043648 3300026118 Bacteria 4187
281 Ga0207683_10000701 3300026121 Bacteria 30621
282 Ga0207683_10041023 3300026121 Bacteria 4040
283 Ga0207698_10535644 3300026142 Bacteria 1145
284 Ga0209588_1016707 3300027671 Bacteria 2269
285 Ga0209971_1003729 3300027682 Bacteria 3605
286 Ga0209971_1021907 3300027682 Bacteria 1521
287 Ga0209966_1006784 3300027695 Bacteria 1995
288 Ga0209966_1030667 3300027695 Bacteria 1088
289 Ga0207428_10012286 3300027907 Bacteria 7527
290 Ga0207428_10054402 3300027907 Bacteria 3188
291 Ga0207428_10100996 3300027907 Bacteria 2229
292 Ga0268264_10135512 3300028381 Bacteria 2189
293 Ga0268264_10230286 3300028381 Bacteria 1711
294 Ga0268264_10397377 3300028381 Bacteria 1324
295 Ga0265760_10030054 3300031090 Bacteria 1598
296 Ga0307513_10056337 3300031456 Bacteria 4197
297 Ga0316575_10000988 3300031665 Bacteria 8783
298 Ga0316575_10132345 3300031665 Bacteria 1024
299 Ga0316579_10000038 3300031691 Bacteria 30399
300 Ga0316579_10171826 3300031691 Bacteria 1048
301 Ga0316576_10003103 3300031727 Bacteria 9689
302 Ga0307413_10043372 3300031824 Unclassified 2650
303 Ga0307410_10001864 3300031852 Bacteria 9833
304 Ga0307406_10140714 3300031901 Bacteria 1708
305 Ga0307407_10017237 3300031903 Bacteria 3618
306 Ga0307409_100020188 3300031995 Bacteria 4535
307 Ga0307409_100336095 3300031995 Bacteria 1419
308 Ga0307416_100003252 3300032002 Bacteria 9516
309 Ga0307416_100014469 3300032002 Bacteria 5412
310 Ga0307414_10255117 3300032004 Bacteria 1460
311 Ga0307411_10017527 3300032005 Bacteria 4084
312 Ga0307415_100037262 3300032126 Bacteria 3194
313 Ga0307415_100722641 3300032126 Bacteria 901
314 Ga0373926_0015853 3300035083 Bacteria 2572
315 Ga0373941_0066457 3300035115 Bacteria 1187
316 Ga0373945_0021737 3300035116 Bacteria 2207
317 Ga0373943_0064760 3300035170 Bacteria 1836
318 Ga0373943_0157507 3300035170 Bacteria 1234
319 Ga0373946_0025317 3300035171 Bacteria 2333
320 Ga0373955_0742098 3300035172 Bacteria 603
321 Ga0373961_0021649 3300035241 Bacteria 1712
322 Ga0316574_0011204 3300035398 Bacteria 5091
323 Ga0373935_0050100 3300035692 Bacteria 2649
324 Ga0373935_0275685 3300035692 Unclassified 1183
325 Ga0373947_0010840 3300035725 Bacteria 5230
326 Ga0373937_0240705 3300036401 Bacteria 1705
327 Ga0372808_000576 3300036459 Bacteria 3050
328 Ga0316582_0245505 3300036647 Bacteria 1227
329 Ga0373925_0092661 3300037068 Bacteria 2311
330 Ga0400483_079270 3300039062 Bacteria 5041
331 Ga0436365_0021617 3300039437 Bacteria 1310
332 Ga0451577_0013304 3300042876 Bacteria 7707
333 Ga0451577_0044525 3300042876 Bacteria 3973
334 Ga0453684_0215937 3300044712 Bacteria 2225
335 Ga0466957_0272950 3300044842 Bacteria 1130
336 Ga0451576_0203979 3300045051 Bacteria 2065
337 Ga0451576_0509277 3300045051 Bacteria 1264
338 Ga0451576_0517590 3300045051 Bacteria 1253
339 Ga0495580_0011845 3300046472 Bacteria 6729
340 Ga0495580_0132061 3300046472 Bacteria 1732
341 Ga0495584_0327714 3300046491 Bacteria 778
342 Ga0495640_0335540 3300046533 Bacteria 935
343 Ga0495657_0159629 3300046675 Bacteria 1396
344 Ga0495657_0401227 3300046675 Bacteria 807
345 Ga0495669_0048878 3300046684 Bacteria 1893
346 Ga0496101_0489619 3300048904 Bacteria 971
347 Ga0496102_0065899 3300048905 Bacteria 3320
348 Ga0496103_0136887 3300048906 Bacteria 1565
349 Ga0496104_0733659 3300048907 Bacteria 895
350 Ga0496104_1094120 3300048907 Bacteria 701
351 Ga0496104_1217031 3300048907 Bacteria 656
352 Ga0496106_0128528 3300048909 Bacteria 1986
353 Ga0496108_0064962 3300048911 Bacteria 3075
354 Ga0496109_0291364 3300048912 Bacteria 1539
355 Ga0496110_0125467 3300048913 Bacteria 2316
356 Ga0496112_0007275 3300048915 Bacteria 9809
357 Ga0496112_0009585 3300048915 Bacteria 8735
358 Ga0501299_022882 3300049522 Unclassified 1156
359 Ga0501032_0024518 3300049569 Bacteria 4165
360 Ga0501033_0103416 3300049570 Bacteria 2077
361 Ga0501034_0967003 3300049571 Bacteria 736
362 Ga0501036_0023068 3300049572 Bacteria 5238
363 Ga0501036_0024686 3300049572 Bacteria 5068
364 Ga0501036_0028965 3300049572 Bacteria 4680
365 Ga0501036_0077659 3300049572 Bacteria 2809
366 Ga0501037_0010317 3300049573 Bacteria 6854
367 Ga0501037_0123972 3300049573 Bacteria 1856
368 Ga0501038_0000271 3300049574 Bacteria 43706
369 Ga0501038_0088249 3300049574 Bacteria 2603
370 Ga0501038_0338316 3300049574 Bacteria 1174
371 Ga0501039_0005553 3300049575 Bacteria 9541
372 Ga0501039_0117184 3300049575 Bacteria 2085
373 Ga0501039_0648080 3300049575 Bacteria 827
374 Ga0501040_0000757 3300049576 Bacteria 20035
375 Ga0501040_0191124 3300049576 Bacteria 1452
376 Ga0501041_0000002 3300049577 Bacteria 84985
377 Ga0501041_0032080 3300049577 Bacteria 3174
378 Ga0501042_0183284 3300049578 Bacteria 1510
379 Ga0501043_0073036 3300049579 Bacteria 2694
380 Ga0501043_0180805 3300049579 Bacteria 1643
381 Ga0501046_0015293 3300049580 Bacteria 6453
382 Ga0501046_0066927 3300049580 Bacteria 2798
383 Ga0501047_0050949 3300049581 Bacteria 3998
384 Ga0501048_0012610 3300049582 Bacteria 6286
385 Ga0501048_0082093 3300049582 Bacteria 2273
386 Ga0501067_0035889 3300049583 Bacteria 2753
387 Ga0501068_0024373 3300049584 Bacteria 3552
388 Ga0501070_0541101 3300049586 Bacteria 933
389 Ga0501071_0001937 3300049587 Bacteria 12334
390 Ga0501071_0141669 3300049587 Bacteria 1790
391 Ga0501072_0000128 3300049588 Bacteria 56185
392 Ga0501073_0006041 3300049589 Bacteria 9033
393 Ga0501074_0054930 3300049590 Bacteria 2871
394 Ga0501075_0086982 3300049591 Bacteria 2368
395 Ga0501076_0000022 3300049592 Bacteria 83199
396 Ga0501077_0000017 3300049593 Bacteria 86892
397 Ga0501077_0060926 3300049593 Bacteria 2394
398 Ga0501202_016994 3300049652 Unclassified 1417
399 Ga0501206_015931 3300049653 Bacteria 1043
400 Ga0501209_006011 3300049656 Bacteria 2235
401 Ga0501217_007648 3300049661 Unclassified 2321
402 Ga0501235_015959 3300049669 Bacteria 1657
403 Ga0501249_006101 3300049679 Bacteria 2475
404 Ga0501225_0004101 3300049705 Bacteria 4359
405 Ga0501229_002194 3300049706 Bacteria 2297
406 Ga0501079_0000549 3300049741 Bacteria 24511
407 Ga0501079_0034206 3300049741 Bacteria 3910
408 Ga0501080_0015441 3300049742 Bacteria 7041
409 Ga0501080_0071318 3300049742 Bacteria 3231
410 Ga0501080_0173071 3300049742 Bacteria 1990
411 Ga0501081_0000105 3300049743 Bacteria 35434
412 Ga0501083_0008408 3300049744 Bacteria 7296
413 Ga0501264_003202 3300049761 Unclassified 1492
414 Ga0501271_010680 3300049768 Unclassified 973
415 Ga0501283_018778 3300049779 Unclassified 1091
416 Ga0501035_0002385 3300049822 Bacteria 18452
417 Ga0501035_0180009 3300049822 Bacteria 1821
418 Ga0501035_1078706 3300049822 Bacteria 628
419 Ga0501044_0007893 3300049823 Bacteria 11701
420 Ga0501044_0039472 3300049823 Bacteria 4926
421 Ga0501045_0000113 3300049824 Bacteria 40870
422 Ga0501045_0209653 3300049824 Bacteria 1451
423 nmdc:mga05p37_13853_c1 3300050507 Bacteria 9661
424 nmdc:mga05p37_173006_c1 3300050507 Bacteria 2633
425 nmdc:mga05p37_18111_c1 3300050507 Bacteria 8509
426 nmdc:mga05p37_215554_c1 3300050507 Bacteria 2319
427 nmdc:mga05p37_26429_c1 3300050507 Bacteria 7061
428 nmdc:mga05p37_32209_c1 3300050507 Bacteria 6410
429 nmdc:mga05p37_421193_c1 3300050507 Unclassified 1554
430 nmdc:mga09592_217479_c1 3300050508 Unclassified 1655
431 nmdc:mga09592_732473_c1 3300050508 Unclassified 840
432 nmdc:mga0qj67_12954_c1 3300050509 Bacteria 6293
433 nmdc:mga0qj67_92603_c1 3300050509 Bacteria 2430
434 nmdc:mga06r32_14318_c1 3300050510 Bacteria 7195
435 nmdc:mga06r32_38783_c1 3300050510 Bacteria 4517
436 nmdc:mga06r32_714677_c1 3300050510 Unclassified 967
437 nmdc:mga08y16_14411_c1 3300050511 Bacteria 8318
438 nmdc:mga08y16_161527_c1 3300050511 Bacteria 2328
439 nmdc:mga0n895_16294_c1 3300050512 Bacteria 6816
440 nmdc:mga0n895_238574_c1 3300050512 Bacteria 1845
441 nmdc:mga0n895_266827_c1 3300050512 Bacteria 1737
442 nmdc:mga0n895_32155_c1 3300050512 Bacteria 5034
443 nmdc:mga0n895_3908_c1 3300050512 Bacteria 12106
444 nmdc:mga0n895_401900_c1 3300050512 Bacteria 1385
445 nmdc:mga0n895_77732_c1 3300050512 Bacteria 3302
446 nmdc:mga0rr50_192279_c1 3300050513 Unclassified 1673
447 nmdc:mga0rr50_30991_c1 3300050513 Bacteria 3792
448 nmdc:mga0rr50_65905_c1 3300050513 Bacteria 2745
449 nmdc:mga0rr50_72020_c1 3300050513 Bacteria 2639
450 nmdc:mga0rr50_74423_c1 3300050513 Bacteria 2600
451 nmdc:mga08x19_22021_c1 3300050514 Bacteria 3942
452 nmdc:mga08x19_249725_c1 3300050514 Bacteria 1225
453 nmdc:mga08x19_673882_c1 3300050514 Bacteria 734
454 nmdc:mga08x19_97377_c1 3300050514 Bacteria 1948
455 nmdc:mga0a205_142887_c1 3300050515 Bacteria 2293
456 nmdc:mga0a205_390_c1 3300050515 Bacteria 33406
457 nmdc:mga0a205_5525_c2 3300050515 Bacteria 8852
458 nmdc:mga0a205_553_c1 3300050515 Bacteria 29648
459 nmdc:mga0a205_8227_c1 3300050515 Bacteria 9480
460 nmdc:mga0a205_98472_c1 3300050515 Bacteria 2823
461 Ga0500618_001890 3300053125 Bacteria 8668
462 Ga0501084_0000159 3300054114 Bacteria 52081
463 Ga0501084_0135098 3300054114 Bacteria 2077
464 Ga0501084_0275900 3300054114 Bacteria 1419
465 Ga0590077_005907 3300059426 Bacteria 2507
466 Ga0501082_0002410 3300060353 Bacteria 16410
467 Ga0501082_0197837 3300060353 Bacteria 1748
468 Ga0501082_0462373 3300060353 Bacteria 1109
469 Ga0530510_0002449 3300061734 Bacteria 12792
470 Ga0530510_0017289 3300061734 Bacteria 5109
471 Ga0530510_0061773 3300061734 Bacteria 2712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0967003 Ga0501034_0967003_41_535 156
2 3300049822 Ga0501035_1078706 Ga0501035_1078706_106_600 156
3 3300026116 Ga0207674_10311672 Ga0207674_103116721 159
4 3300006871 Ga0075434_100000038 Ga0075434_10000003821 176
5 3300007076 Ga0075435_100162807 Ga0075435_1001628072 176
6 3300035172 Ga0373955_0742098 Ga0373955_0742098_36_587 176
7 3300050514 nmdc:mga08x19_673882_c1 nmdc:mga08x19_673882_c1_85_636 176
8 3300005327 Ga0070658_10735428 Ga0070658_107354282 183
9 3300005329 Ga0070683_100867176 Ga0070683_1008671761 183
10 3300005334 Ga0068869_100018620 Ga0068869_1000186202 183
11 3300005356 Ga0070674_100166276 Ga0070674_1001662762 183
12 3300005366 Ga0070659_100404408 Ga0070659_1004044082 183
13 3300005456 Ga0070678_100041189 Ga0070678_1000411893 183
14 3300005535 Ga0070684_100762968 Ga0070684_1007629681 183
15 3300005983 Ga0081540_1015624 Ga0081540_10156242 183
16 3300005985 Ga0081539_10043683 Ga0081539_100436832 183
17 3300025942 Ga0207689_10020564 Ga0207689_100205649 183
18 3300026121 Ga0207683_10041023 Ga0207683_100410232 183
19 3300031691 Ga0316579_10000038 Ga0316579_1000003826 183
20 3300031901 Ga0307406_10140714 Ga0307406_101407142 183
21 3300031995 Ga0307409_100336095 Ga0307409_1003360952 183
22 3300032126 Ga0307415_100722641 Ga0307415_1007226412 183
23 3300048907 Ga0496104_1094120 Ga0496104_1094120_108_689 183
24 3300035398 Ga0316574_0011204 Ga0316574_0011204_4198_4761 185
25 3300005445 Ga0070708_100059463 Ga0070708_1000594633 186
26 3300009147 Ga0114129_10153422 Ga0114129_101534222 186
27 3300025915 Ga0207693_10131173 Ga0207693_101311734 186
28 3300025939 Ga0207665_10106710 Ga0207665_101067104 186
29 3300050512 nmdc:mga0n895_77732_c1 nmdc:mga0n895_77732_c1_1679_2299 186
30 3300050514 nmdc:mga08x19_249725_c1 nmdc:mga08x19_249725_c1_225_845 186
31 3300050515 nmdc:mga0a205_8227_c1 nmdc:mga0a205_8227_c1_5078_5698 186
32 3300005518 Ga0070699_100046351 Ga0070699_1000463512 188
33 3300005536 Ga0070697_100000351 Ga0070697_10000035144 188
34 3300006028 Ga0070717_10079844 Ga0070717_100798442 188
35 3300025910 Ga0207684_10293700 Ga0207684_102937002 188
36 3300025922 Ga0207646_10073859 Ga0207646_100738592 188
37 3300005337 Ga0070682_100006664 Ga0070682_10000666410 189
38 3300005339 Ga0070660_100983401 Ga0070660_1009834011 189
39 3300005347 Ga0070668_100782159 Ga0070668_1007821592 189
40 3300005366 Ga0070659_100243422 Ga0070659_1002434222 189
41 3300005406 Ga0070703_10024786 Ga0070703_100247862 189
42 3300005440 Ga0070705_100068087 Ga0070705_1000680872 189
43 3300005457 Ga0070662_100479626 Ga0070662_1004796262 189
44 3300005458 Ga0070681_10007681 Ga0070681_1000768117 189
45 3300005530 Ga0070679_100001504 Ga0070679_10000150423 189
46 3300005539 Ga0068853_100003417 Ga0068853_1000034179 189
47 3300005545 Ga0070695_100020500 Ga0070695_1000205006 189
48 3300005546 Ga0070696_100110182 Ga0070696_1001101824 189
49 3300005547 Ga0070693_100006749 Ga0070693_1000067495 189
50 3300005549 Ga0070704_100029812 Ga0070704_1000298122 189
51 3300005563 Ga0068855_100023808 Ga0068855_1000238087 189
52 3300005564 Ga0070664_101221532 Ga0070664_1012215322 189
53 3300005843 Ga0068860_100256456 Ga0068860_1002564562 189
54 3300006178 Ga0075367_10021499 Ga0075367_100214994 189
55 3300009174 Ga0105241_10012328 Ga0105241_100123289 189
56 3300013100 Ga0157373_10083075 Ga0157373_100830752 189
57 3300013104 Ga0157370_10030928 Ga0157370_100309287 189
58 3300013307 Ga0157372_10004056 Ga0157372_100040567 189
59 3300025917 Ga0207660_10087989 Ga0207660_100879895 189
60 3300025921 Ga0207652_10008500 Ga0207652_1000850012 189
61 3300025932 Ga0207690_10189783 Ga0207690_101897832 189
62 3300025933 Ga0207706_10301429 Ga0207706_103014291 189
63 3300025949 Ga0207667_10029278 Ga0207667_100292786 189
64 3300026041 Ga0207639_10030406 Ga0207639_100304066 189
65 3300028381 Ga0268264_10230286 Ga0268264_102302862 189
66 3300039437 Ga0436365_0021617 Ga0436365_0021617_691_1290 189
67 3300049569 Ga0501032_0024518 Ga0501032_0024518_3455_4048 189
68 3300049570 Ga0501033_0103416 Ga0501033_0103416_285_878 189
69 3300049572 Ga0501036_0023068 Ga0501036_0023068_218_811 189
70 3300049575 Ga0501039_0648080 Ga0501039_0648080_33_626 189
71 3300049581 Ga0501047_0050949 Ga0501047_0050949_3092_3685 189
72 3300049583 Ga0501067_0035889 Ga0501067_0035889_2068_2661 189
73 3300049586 Ga0501070_0541101 Ga0501070_0541101_32_625 189
74 3300049589 Ga0501073_0006041 Ga0501073_0006041_3020_3613 189
75 3300049742 Ga0501080_0015441 Ga0501080_0015441_2437_3030 189
76 3300049823 Ga0501044_0007893 Ga0501044_0007893_2961_3554 189
77 3300054114 Ga0501084_0135098 Ga0501084_0135098_184_777 189
78 3300060353 Ga0501082_0462373 Ga0501082_0462373_14_607 189
79 3300005436 Ga0070713_100311865 Ga0070713_1003118652 190
80 3300009174 Ga0105241_10170285 Ga0105241_101702852 190
81 3300009551 Ga0105238_10686799 Ga0105238_106867991 190
82 3300025928 Ga0207700_10357956 Ga0207700_103579562 190
83 3300035692 Ga0373935_0275685 Ga0373935_0275685_163_780 190
84 3300036401 Ga0373937_0240705 Ga0373937_0240705_1044_1661 190
85 3300046675 Ga0495657_0401227 Ga0495657_0401227_20_637 190
86 3300048907 Ga0496104_1217031 Ga0496104_1217031_28_645 190
87 3300049522 Ga0501299_022882 Ga0501299_022882_336_932 191
88 3300049652 Ga0501202_016994 Ga0501202_016994_14_610 191
89 3300049653 Ga0501206_015931 Ga0501206_015931_328_924 191
90 3300049656 Ga0501209_006011 Ga0501209_006011_1571_2167 191
91 3300049661 Ga0501217_007648 Ga0501217_007648_1150_1746 191
92 3300049669 Ga0501235_015959 Ga0501235_015959_1036_1632 191
93 3300049679 Ga0501249_006101 Ga0501249_006101_128_724 191
94 3300049705 Ga0501225_0004101 Ga0501225_0004101_3664_4260 191
95 3300049706 Ga0501229_002194 Ga0501229_002194_1491_2087 191
96 3300049761 Ga0501264_003202 Ga0501264_003202_833_1429 191
97 3300049768 Ga0501271_010680 Ga0501271_010680_306_902 191
98 3300049779 Ga0501283_018778 Ga0501283_018778_283_879 191
99 3300050508 nmdc:mga09592_217479_c1 nmdc:mga09592_217479_c1_938_1534 191
100 3300050510 nmdc:mga06r32_714677_c1 nmdc:mga06r32_714677_c1_297_893 191
101 3300013297 Ga0157378_10022529 Ga0157378_100225299 192
102 3300025912 Ga0207707_10014575 Ga0207707_1001457511 192
103 3300025933 Ga0207706_10005201 Ga0207706_1000520112 192
104 3300026078 Ga0207702_10036414 Ga0207702_100364141 192
105 3300048904 Ga0496101_0489619 Ga0496101_0489619_117_716 192
106 3300048905 Ga0496102_0065899 Ga0496102_0065899_767_1366 192
107 3300048912 Ga0496109_0291364 Ga0496109_0291364_918_1517 192
108 3300048913 Ga0496110_0125467 Ga0496110_0125467_1418_2017 192
109 3300048915 Ga0496112_0009585 Ga0496112_0009585_2140_2739 192
110 3300050510 nmdc:mga06r32_38783_c1 nmdc:mga06r32_38783_c1_2378_2977 192
111 3300050512 nmdc:mga0n895_266827_c1 nmdc:mga0n895_266827_c1_943_1542 192
112 3300050512 nmdc:mga0n895_3908_c1 nmdc:mga0n895_3908_c1_2252_2851 192
113 3300050515 nmdc:mga0a205_5525_c2 nmdc:mga0a205_5525_c2_2904_3503 192
114 3300007265 Ga0099794_10004600 Ga0099794_100046002 195
115 3300027671 Ga0209588_1016707 Ga0209588_10167072 195
116 3300005467 Ga0070706_100158025 Ga0070706_1001580252 204
117 3300005468 Ga0070707_100636040 Ga0070707_1006360402 204
118 3300005471 Ga0070698_100023059 Ga0070698_1000230593 204
119 3300005536 Ga0070697_100006235 Ga0070697_1000062353 206
120 3300046533 Ga0495640_0335540 Ga0495640_0335540_276_917 206
121 3300005445 Ga0070708_100075166 Ga0070708_1000751664 207
122 3300005290 Ga0065712_10067999 Ga0065712_1006799917 208
123 3300005293 Ga0065715_10093268 Ga0065715_100932683 208
124 3300005331 Ga0070670_100766759 Ga0070670_1007667592 208
125 3300007076 Ga0075435_100033637 Ga0075435_1000336372 208
126 3300025945 Ga0207679_10335446 Ga0207679_103354461 208
127 3300035115 Ga0373941_0066457 Ga0373941_0066457_109_756 208
128 3300042876 Ga0451577_0013304 Ga0451577_0013304_4952_5626 208
129 3300044712 Ga0453684_0215937 Ga0453684_0215937_313_987 208
130 3300050511 nmdc:mga08y16_161527_c1 nmdc:mga08y16_161527_c1_125_772 208
131 3300003322 rootL2_10197350 rootL2_101973502 209
132 3300003373 JGI25407J50210_10030373 JGI25407J50210_100303732 210
133 3300004801 Ga0058860_12218425 Ga0058860_122184253 210
134 3300004803 Ga0058862_12257618 Ga0058862_122576182 210
135 3300005290 Ga0065712_10001927 Ga0065712_100019279 210
136 3300005293 Ga0065715_10003991 Ga0065715_100039919 210
137 3300005295 Ga0065707_10010154 Ga0065707_100101543 210
138 3300005295 Ga0065707_10149563 Ga0065707_101495632 210
139 3300005328 Ga0070676_10016702 Ga0070676_100167026 210
140 3300005330 Ga0070690_100006446 Ga0070690_1000064464 210
141 3300005330 Ga0070690_100153221 Ga0070690_1001532212 210
142 3300005330 Ga0070690_100322935 Ga0070690_1003229352 210
143 3300005331 Ga0070670_100003499 Ga0070670_10000349912 210
144 3300005333 Ga0070677_10051626 Ga0070677_100516262 210
145 3300005335 Ga0070666_10110540 Ga0070666_101105402 210
146 3300005336 Ga0070680_100007166 Ga0070680_1000071666 210
147 3300005336 Ga0070680_100046777 Ga0070680_1000467776 210
148 3300005336 Ga0070680_100494618 Ga0070680_1004946181 210
149 3300005338 Ga0068868_100064796 Ga0068868_1000647962 210
150 3300005339 Ga0070660_100214439 Ga0070660_1002144392 210
151 3300005340 Ga0070689_100073566 Ga0070689_1000735663 210
152 3300005340 Ga0070689_100409160 Ga0070689_1004091601 210
153 3300005341 Ga0070691_10154398 Ga0070691_101543981 210
154 3300005344 Ga0070661_100007908 Ga0070661_10000790810 210
155 3300005347 Ga0070668_100045712 Ga0070668_1000457123 210
156 3300005354 Ga0070675_100151568 Ga0070675_1001515682 210
157 3300005355 Ga0070671_100134464 Ga0070671_1001344643 210
158 3300005364 Ga0070673_100029641 Ga0070673_1000296413 210
159 3300005366 Ga0070659_100406888 Ga0070659_1004068882 210
160 3300005434 Ga0070709_10079670 Ga0070709_100796702 210
161 3300005434 Ga0070709_10229790 Ga0070709_102297902 210
162 3300005435 Ga0070714_100318563 Ga0070714_1003185632 210
163 3300005435 Ga0070714_100387494 Ga0070714_1003874941 210
164 3300005435 Ga0070714_100657984 Ga0070714_1006579842 210
165 3300005436 Ga0070713_100000364 Ga0070713_10000036423 210
166 3300005436 Ga0070713_100030142 Ga0070713_1000301426 210
167 3300005436 Ga0070713_100512526 Ga0070713_1005125262 210
168 3300005437 Ga0070710_10031205 Ga0070710_100312053 210
169 3300005439 Ga0070711_100113461 Ga0070711_1001134612 210
170 3300005444 Ga0070694_100044357 Ga0070694_1000443574 210
171 3300005455 Ga0070663_100007805 Ga0070663_1000078054 210
172 3300005456 Ga0070678_100009325 Ga0070678_1000093254 210
173 3300005457 Ga0070662_100044501 Ga0070662_1000445015 210
174 3300005458 Ga0070681_10009423 Ga0070681_1000942313 210
175 3300005458 Ga0070681_10054241 Ga0070681_100542412 210
176 3300005467 Ga0070706_100104438 Ga0070706_1001044382 210
177 3300005467 Ga0070706_100343784 Ga0070706_1003437842 210
178 3300005518 Ga0070699_100000239 Ga0070699_10000023930 210
179 3300005530 Ga0070679_100064759 Ga0070679_1000647596 210
180 3300005530 Ga0070679_100613736 Ga0070679_1006137362 210
181 3300005536 Ga0070697_100099096 Ga0070697_1000990964 210
182 3300005539 Ga0068853_100254885 Ga0068853_1002548852 210
183 3300005543 Ga0070672_100026149 Ga0070672_1000261493 210
184 3300005544 Ga0070686_100026074 Ga0070686_1000260743 210
185 3300005545 Ga0070695_100488839 Ga0070695_1004888392 210
186 3300005546 Ga0070696_100015848 Ga0070696_1000158482 210
187 3300005546 Ga0070696_100048380 Ga0070696_1000483804 210
188 3300005547 Ga0070693_100016594 Ga0070693_1000165943 210
189 3300005563 Ga0068855_100140413 Ga0068855_1001404132 210
190 3300005564 Ga0070664_100077382 Ga0070664_1000773824 210
191 3300005564 Ga0070664_100195611 Ga0070664_1001956112 210
192 3300005577 Ga0068857_100379313 Ga0068857_1003793132 210
193 3300005577 Ga0068857_100447525 Ga0068857_1004475252 210
194 3300005578 Ga0068854_100004643 Ga0068854_1000046434 210
195 3300005614 Ga0068856_100036536 Ga0068856_1000365365 210
196 3300005614 Ga0068856_100382198 Ga0068856_1003821981 210
197 3300005616 Ga0068852_100559026 Ga0068852_1005590262 210
198 3300005618 Ga0068864_100473722 Ga0068864_1004737222 210
199 3300005718 Ga0068866_10041285 Ga0068866_100412852 210
200 3300005718 Ga0068866_10234946 Ga0068866_102349462 210
201 3300005719 Ga0068861_100012967 Ga0068861_1000129678 210
202 3300005842 Ga0068858_100204716 Ga0068858_1002047162 210
203 3300005843 Ga0068860_100029326 Ga0068860_1000293262 210
204 3300005843 Ga0068860_100158753 Ga0068860_1001587532 210
205 3300005843 Ga0068860_100779037 Ga0068860_1007790372 210
206 3300005844 Ga0068862_100557217 Ga0068862_1005572172 210
207 3300005937 Ga0081455_10211578 Ga0081455_102115782 210
208 3300005937 Ga0081455_10302081 Ga0081455_103020812 210
209 3300005981 Ga0081538_10001160 Ga0081538_1000116022 210
210 3300006028 Ga0070717_10024604 Ga0070717_100246045 210
211 3300006028 Ga0070717_10085848 Ga0070717_100858482 210
212 3300006028 Ga0070717_10349449 Ga0070717_103494492 210
213 3300006173 Ga0070716_100012088 Ga0070716_1000120885 210
214 3300006173 Ga0070716_100037411 Ga0070716_1000374113 210
215 3300006173 Ga0070716_100100797 Ga0070716_1001007972 210
216 3300006175 Ga0070712_100001135 Ga0070712_10000113511 210
217 3300006175 Ga0070712_100003022 Ga0070712_1000030229 210
218 3300006175 Ga0070712_100104753 Ga0070712_1001047532 210
219 3300006175 Ga0070712_100162837 Ga0070712_1001628372 210
220 3300006237 Ga0097621_100042897 Ga0097621_1000428975 210
221 3300006358 Ga0068871_100096200 Ga0068871_1000962004 210
222 3300006844 Ga0075428_100003811 Ga0075428_10000381114 210
223 3300006844 Ga0075428_100156236 Ga0075428_1001562361 210
224 3300006844 Ga0075428_100287815 Ga0075428_1002878152 210
225 3300006846 Ga0075430_100094222 Ga0075430_1000942222 210
226 3300006846 Ga0075430_100217290 Ga0075430_1002172902 210
227 3300006847 Ga0075431_100014254 Ga0075431_1000142543 210
228 3300006847 Ga0075431_100034379 Ga0075431_1000343798 210
229 3300006852 Ga0075433_10008452 Ga0075433_100084526 210
230 3300006852 Ga0075433_10015663 Ga0075433_100156634 210
231 3300006852 Ga0075433_10091411 Ga0075433_100914113 210
232 3300006852 Ga0075433_10096754 Ga0075433_100967544 210
233 3300006852 Ga0075433_10113510 Ga0075433_101135102 210
234 3300006852 Ga0075433_10540132 Ga0075433_105401322 210
235 3300006871 Ga0075434_100041556 Ga0075434_1000415562 210
236 3300006871 Ga0075434_100061457 Ga0075434_1000614573 210
237 3300006871 Ga0075434_100095665 Ga0075434_1000956652 210
238 3300006871 Ga0075434_100216663 Ga0075434_1002166632 210
239 3300006871 Ga0075434_100247198 Ga0075434_1002471982 210
240 3300006880 Ga0075429_100116218 Ga0075429_1001162181 210
241 3300006880 Ga0075429_100162903 Ga0075429_1001629032 210
242 3300006881 Ga0068865_100202199 Ga0068865_1002021992 210
243 3300006914 Ga0075436_100030268 Ga0075436_1000302685 210
244 3300006914 Ga0075436_100051763 Ga0075436_1000517633 210
245 3300007076 Ga0075435_100026527 Ga0075435_1000265272 210
246 3300007076 Ga0075435_100042123 Ga0075435_1000421235 210
247 3300007076 Ga0075435_100047535 Ga0075435_1000475353 210
248 3300007076 Ga0075435_100115423 Ga0075435_1001154232 210
249 3300007076 Ga0075435_100183588 Ga0075435_1001835882 210
250 3300007788 Ga0099795_10007913 Ga0099795_100079135 210
251 3300009093 Ga0105240_10029138 Ga0105240_1002913810 210
252 3300009093 Ga0105240_10089059 Ga0105240_100890592 210
253 3300009094 Ga0111539_10078466 Ga0111539_100784666 210
254 3300009094 Ga0111539_10902622 Ga0111539_109026222 210
255 3300009147 Ga0114129_10000332 Ga0114129_1000033272 210
256 3300009147 Ga0114129_10028924 Ga0114129_100289248 210
257 3300009147 Ga0114129_10042483 Ga0114129_100424838 210
258 3300009147 Ga0114129_10052015 Ga0114129_100520158 210
259 3300009147 Ga0114129_10057996 Ga0114129_100579968 210
260 3300009147 Ga0114129_10250012 Ga0114129_102500122 210
261 3300009147 Ga0114129_10385726 Ga0114129_103857262 210
262 3300009148 Ga0105243_10028697 Ga0105243_100286974 210
263 3300009177 Ga0105248_10673627 Ga0105248_106736272 210
264 3300009545 Ga0105237_10200065 Ga0105237_102000652 210
265 3300009553 Ga0105249_10130105 Ga0105249_101301052 210
266 3300010375 Ga0105239_10167092 Ga0105239_101670922 210
267 3300010375 Ga0105239_10334395 Ga0105239_103343952 210
268 3300013100 Ga0157373_10103159 Ga0157373_101031593 210
269 3300013102 Ga0157371_10041162 Ga0157371_100411622 210
270 3300013105 Ga0157369_10143163 Ga0157369_101431632 210
271 3300013296 Ga0157374_10089450 Ga0157374_100894502 210
272 3300013297 Ga0157378_10009854 Ga0157378_1000985413 210
273 3300013306 Ga0163162_10090029 Ga0163162_100900292 210
274 3300013307 Ga0157372_10117479 Ga0157372_101174795 210
275 3300013308 Ga0157375_11766482 Ga0157375_117664821 210
276 3300014325 Ga0163163_10178761 Ga0163163_101787613 210
277 3300014745 Ga0157377_10148564 Ga0157377_101485641 210
278 3300014968 Ga0157379_10197003 Ga0157379_101970032 210
279 3300015262 Ga0182007_10038385 Ga0182007_100383852 210
280 3300015262 Ga0182007_10096716 Ga0182007_100967162 210
281 3300020069 Ga0197907_10064221 Ga0197907_100642212 210
282 3300020070 Ga0206356_10164288 Ga0206356_101642882 210
283 3300020078 Ga0206352_10653387 Ga0206352_106533872 210
284 3300022467 Ga0224712_10017833 Ga0224712_100178332 210
285 3300025315 Ga0207697_10005586 Ga0207697_100055866 210
286 3300025898 Ga0207692_10020497 Ga0207692_100204973 210
287 3300025901 Ga0207688_10016663 Ga0207688_100166635 210
288 3300025903 Ga0207680_10022908 Ga0207680_100229087 210
289 3300025904 Ga0207647_10234807 Ga0207647_102348072 210
290 3300025906 Ga0207699_10014274 Ga0207699_100142745 210
291 3300025906 Ga0207699_10271114 Ga0207699_102711142 210
292 3300025907 Ga0207645_10004575 Ga0207645_1000457512 210
293 3300025912 Ga0207707_10000723 Ga0207707_1000072319 210
294 3300025912 Ga0207707_10007456 Ga0207707_100074566 210
295 3300025913 Ga0207695_10148753 Ga0207695_101487532 210
296 3300025915 Ga0207693_10000026 Ga0207693_1000002671 210
297 3300025915 Ga0207693_10004232 Ga0207693_100042326 210
298 3300025916 Ga0207663_10031788 Ga0207663_100317882 210
299 3300025917 Ga0207660_10020146 Ga0207660_100201466 210
300 3300025917 Ga0207660_10041447 Ga0207660_100414472 210
301 3300025919 Ga0207657_10024114 Ga0207657_100241144 210
302 3300025920 Ga0207649_10004988 Ga0207649_1000498811 210
303 3300025921 Ga0207652_10057221 Ga0207652_100572212 210
304 3300025921 Ga0207652_10201250 Ga0207652_102012502 210
305 3300025923 Ga0207681_10010269 Ga0207681_100102698 210
306 3300025925 Ga0207650_10000836 Ga0207650_1000083622 210
307 3300025926 Ga0207659_10318630 Ga0207659_103186302 210
308 3300025928 Ga0207700_10004902 Ga0207700_100049027 210
309 3300025928 Ga0207700_10042550 Ga0207700_100425502 210
310 3300025929 Ga0207664_10076602 Ga0207664_100766022 210
311 3300025929 Ga0207664_10458125 Ga0207664_104581252 210
312 3300025931 Ga0207644_10096639 Ga0207644_100966394 210
313 3300025932 Ga0207690_10115848 Ga0207690_101158484 210
314 3300025937 Ga0207669_10111099 Ga0207669_101110992 210
315 3300025938 Ga0207704_10225344 Ga0207704_102253442 210
316 3300025939 Ga0207665_10012476 Ga0207665_100124765 210
317 3300025939 Ga0207665_10019095 Ga0207665_100190952 210
318 3300025939 Ga0207665_10042405 Ga0207665_100424054 210
319 3300025940 Ga0207691_10001493 Ga0207691_100014939 210
320 3300025942 Ga0207689_10103370 Ga0207689_101033702 210
321 3300025944 Ga0207661_10168187 Ga0207661_101681872 210
322 3300025944 Ga0207661_10532595 Ga0207661_105325952 210
323 3300025945 Ga0207679_10007512 Ga0207679_100075122 210
324 3300025960 Ga0207651_10139963 Ga0207651_101399632 210
325 3300025972 Ga0207668_10904600 Ga0207668_109046001 210
326 3300026023 Ga0207677_10069873 Ga0207677_100698732 210
327 3300026035 Ga0207703_10168426 Ga0207703_101684262 210
328 3300026041 Ga0207639_10480670 Ga0207639_104806702 210
329 3300026067 Ga0207678_10003725 Ga0207678_1000372510 210
330 3300026078 Ga0207702_10003851 Ga0207702_1000385118 210
331 3300026089 Ga0207648_10222157 Ga0207648_102221573 210
332 3300026095 Ga0207676_10456882 Ga0207676_104568822 210
333 3300026116 Ga0207674_10153949 Ga0207674_101539492 210
334 3300026116 Ga0207674_10261288 Ga0207674_102612882 210
335 3300026118 Ga0207675_100043648 Ga0207675_1000436484 210
336 3300026121 Ga0207683_10000701 Ga0207683_100007014 210
337 3300026142 Ga0207698_10535644 Ga0207698_105356442 210
338 3300027682 Ga0209971_1003729 Ga0209971_10037294 210
339 3300027682 Ga0209971_1021907 Ga0209971_10219072 210
340 3300027695 Ga0209966_1006784 Ga0209966_10067842 210
341 3300027695 Ga0209966_1030667 Ga0209966_10306671 210
342 3300027907 Ga0207428_10012286 Ga0207428_100122865 210
343 3300027907 Ga0207428_10054402 Ga0207428_100544023 210
344 3300027907 Ga0207428_10100996 Ga0207428_101009963 210
345 3300028381 Ga0268264_10135512 Ga0268264_101355122 210
346 3300028381 Ga0268264_10397377 Ga0268264_103973771 210
347 3300031090 Ga0265760_10030054 Ga0265760_100300542 210
348 3300031824 Ga0307413_10043372 Ga0307413_100433722 210
349 3300031852 Ga0307410_10001864 Ga0307410_100018643 210
350 3300031903 Ga0307407_10017237 Ga0307407_100172373 210
351 3300031995 Ga0307409_100020188 Ga0307409_1000201886 210
352 3300032002 Ga0307416_100003252 Ga0307416_1000032522 210
353 3300032002 Ga0307416_100014469 Ga0307416_1000144692 210
354 3300032004 Ga0307414_10255117 Ga0307414_102551172 210
355 3300032005 Ga0307411_10017527 Ga0307411_100175274 210
356 3300032126 Ga0307415_100037262 Ga0307415_1000372622 210
357 3300035083 Ga0373926_0015853 Ga0373926_0015853_1218_1883 210
358 3300035116 Ga0373945_0021737 Ga0373945_0021737_1137_1802 210
359 3300035170 Ga0373943_0064760 Ga0373943_0064760_246_911 210
360 3300035170 Ga0373943_0157507 Ga0373943_0157507_269_973 210
361 3300035171 Ga0373946_0025317 Ga0373946_0025317_798_1463 210
362 3300035692 Ga0373935_0050100 Ga0373935_0050100_1760_2425 210
363 3300035725 Ga0373947_0010840 Ga0373947_0010840_1495_2160 210
364 3300036459 Ga0372808_000576 Ga0372808_000576_865_1518 210
365 3300037068 Ga0373925_0092661 Ga0373925_0092661_1532_2197 210
366 3300042876 Ga0451577_0044525 Ga0451577_0044525_283_939 210
367 3300044842 Ga0466957_0272950 Ga0466957_0272950_259_963 210
368 3300045051 Ga0451576_0203979 Ga0451576_0203979_470_1135 210
369 3300045051 Ga0451576_0509277 Ga0451576_0509277_589_1245 210
370 3300045051 Ga0451576_0517590 Ga0451576_0517590_460_1125 210
371 3300046472 Ga0495580_0011845 Ga0495580_0011845_1254_1919 210
372 3300046472 Ga0495580_0132061 Ga0495580_0132061_67_771 210
373 3300046491 Ga0495584_0327714 Ga0495584_0327714_89_754 210
374 3300046675 Ga0495657_0159629 Ga0495657_0159629_349_1053 210
375 3300046684 Ga0495669_0048878 Ga0495669_0048878_674_1339 210
376 3300048906 Ga0496103_0136887 Ga0496103_0136887_595_1260 210
377 3300048907 Ga0496104_0733659 Ga0496104_0733659_21_686 210
378 3300048909 Ga0496106_0128528 Ga0496106_0128528_1147_1812 210
379 3300048911 Ga0496108_0064962 Ga0496108_0064962_439_1104 210
380 3300048915 Ga0496112_0007275 Ga0496112_0007275_2171_2836 210
381 3300049572 Ga0501036_0024686 Ga0501036_0024686_1193_1855 210
382 3300049572 Ga0501036_0077659 Ga0501036_0077659_1459_2124 210
383 3300049573 Ga0501037_0010317 Ga0501037_0010317_879_1544 210
384 3300049574 Ga0501038_0000271 Ga0501038_0000271_17230_17892 210
385 3300049574 Ga0501038_0088249 Ga0501038_0088249_578_1243 210
386 3300049575 Ga0501039_0005553 Ga0501039_0005553_4405_5067 210
387 3300049575 Ga0501039_0117184 Ga0501039_0117184_1361_2026 210
388 3300049576 Ga0501040_0000757 Ga0501040_0000757_29_691 210
389 3300049576 Ga0501040_0191124 Ga0501040_0191124_687_1352 210
390 3300049577 Ga0501041_0000002 Ga0501041_0000002_76570_77232 210
391 3300049577 Ga0501041_0032080 Ga0501041_0032080_801_1466 210
392 3300049578 Ga0501042_0183284 Ga0501042_0183284_559_1224 210
393 3300049579 Ga0501043_0073036 Ga0501043_0073036_310_975 210
394 3300049579 Ga0501043_0180805 Ga0501043_0180805_89_751 210
395 3300049580 Ga0501046_0015293 Ga0501046_0015293_4145_4807 210
396 3300049580 Ga0501046_0066927 Ga0501046_0066927_1288_1953 210
397 3300049582 Ga0501048_0012610 Ga0501048_0012610_1165_1827 210
398 3300049582 Ga0501048_0082093 Ga0501048_0082093_1176_1841 210
399 3300049584 Ga0501068_0024373 Ga0501068_0024373_2577_3239 210
400 3300049587 Ga0501071_0001937 Ga0501071_0001937_10591_11253 210
401 3300049587 Ga0501071_0141669 Ga0501071_0141669_845_1510 210
402 3300049588 Ga0501072_0000128 Ga0501072_0000128_53633_54295 210
403 3300049590 Ga0501074_0054930 Ga0501074_0054930_959_1621 210
404 3300049591 Ga0501075_0086982 Ga0501075_0086982_440_1105 210
405 3300049592 Ga0501076_0000022 Ga0501076_0000022_76444_77106 210
406 3300049593 Ga0501077_0000017 Ga0501077_0000017_3816_4478 210
407 3300049593 Ga0501077_0060926 Ga0501077_0060926_1018_1683 210
408 3300049741 Ga0501079_0000549 Ga0501079_0000549_23771_24433 210
409 3300049741 Ga0501079_0034206 Ga0501079_0034206_1665_2330 210
410 3300049742 Ga0501080_0071318 Ga0501080_0071318_2073_2735 210
411 3300049742 Ga0501080_0173071 Ga0501080_0173071_599_1264 210
412 3300049743 Ga0501081_0000105 Ga0501081_0000105_28087_28749 210
413 3300049744 Ga0501083_0008408 Ga0501083_0008408_4710_5372 210
414 3300049822 Ga0501035_0002385 Ga0501035_0002385_4410_5072 210
415 3300049822 Ga0501035_0180009 Ga0501035_0180009_932_1597 210
416 3300049824 Ga0501045_0000113 Ga0501045_0000113_26841_27503 210
417 3300049824 Ga0501045_0209653 Ga0501045_0209653_687_1352 210
418 3300050507 nmdc:mga05p37_13853_c1 nmdc:mga05p37_13853_c1_5609_6277 210
419 3300050507 nmdc:mga05p37_173006_c1 nmdc:mga05p37_173006_c1_1386_2051 210
420 3300050507 nmdc:mga05p37_18111_c1 nmdc:mga05p37_18111_c1_730_1392 210
421 3300050507 nmdc:mga05p37_215554_c1 nmdc:mga05p37_215554_c1_1383_2048 210
422 3300050507 nmdc:mga05p37_26429_c1 nmdc:mga05p37_26429_c1_2004_2669 210
423 3300050507 nmdc:mga05p37_32209_c1 nmdc:mga05p37_32209_c1_2154_2819 210
424 3300050507 nmdc:mga05p37_421193_c1 nmdc:mga05p37_421193_c1_392_1057 210
425 3300050508 nmdc:mga09592_732473_c1 nmdc:mga09592_732473_c1_110_775 210
426 3300050509 nmdc:mga0qj67_12954_c1 nmdc:mga0qj67_12954_c1_1980_2642 210
427 3300050509 nmdc:mga0qj67_92603_c1 nmdc:mga0qj67_92603_c1_1468_2133 210
428 3300050510 nmdc:mga06r32_14318_c1 nmdc:mga06r32_14318_c1_947_1612 210
429 3300050511 nmdc:mga08y16_14411_c1 nmdc:mga08y16_14411_c1_5155_5820 210
430 3300050512 nmdc:mga0n895_16294_c1 nmdc:mga0n895_16294_c1_5265_5921 210
431 3300050512 nmdc:mga0n895_238574_c1 nmdc:mga0n895_238574_c1_414_1091 210
432 3300050512 nmdc:mga0n895_32155_c1 nmdc:mga0n895_32155_c1_3465_4127 210
433 3300050513 nmdc:mga0rr50_192279_c1 nmdc:mga0rr50_192279_c1_281_937 210
434 3300050513 nmdc:mga0rr50_30991_c1 nmdc:mga0rr50_30991_c1_946_1611 210
435 3300050513 nmdc:mga0rr50_65905_c1 nmdc:mga0rr50_65905_c1_1202_1858 210
436 3300050513 nmdc:mga0rr50_72020_c1 nmdc:mga0rr50_72020_c1_313_975 210
437 3300050513 nmdc:mga0rr50_74423_c1 nmdc:mga0rr50_74423_c1_1178_1834 210
438 3300050514 nmdc:mga08x19_22021_c1 nmdc:mga08x19_22021_c1_1447_2112 210
439 3300050514 nmdc:mga08x19_97377_c1 nmdc:mga08x19_97377_c1_558_1220 210
440 3300050515 nmdc:mga0a205_142887_c1 nmdc:mga0a205_142887_c1_71_736 210
441 3300050515 nmdc:mga0a205_390_c1 nmdc:mga0a205_390_c1_9080_9736 210
442 3300050515 nmdc:mga0a205_553_c1 nmdc:mga0a205_553_c1_28204_28869 210
443 3300050515 nmdc:mga0a205_98472_c1 nmdc:mga0a205_98472_c1_1951_2607 210
444 3300054114 Ga0501084_0000159 Ga0501084_0000159_33687_34349 210
445 3300054114 Ga0501084_0275900 Ga0501084_0275900_287_952 210
446 3300059426 Ga0590077_005907 Ga0590077_005907_235_900 210
447 3300060353 Ga0501082_0002410 Ga0501082_0002410_6827_7489 210
448 3300060353 Ga0501082_0197837 Ga0501082_0197837_616_1281 210
449 3300061734 Ga0530510_0002449 Ga0530510_0002449_3209_3871 210
450 3300061734 Ga0530510_0017289 Ga0530510_0017289_428_1090 210
451 3300061734 Ga0530510_0061773 Ga0530510_0061773_687_1352 210
452 iso_pu_bacteria 2881714928 2881716529 210
453 3300005337 Ga0070682_100237927 Ga0070682_1002379271 212
454 3300025932 Ga0207690_10072361 Ga0207690_100723612 212
455 3300049572 Ga0501036_0028965 Ga0501036_0028965_2221_2859 212
456 3300049573 Ga0501037_0123972 Ga0501037_0123972_678_1316 212
457 3300049574 Ga0501038_0338316 Ga0501038_0338316_26_664 212
458 3300049823 Ga0501044_0039472 Ga0501044_0039472_2182_2820 212
459 3300035241 Ga0373961_0021649 Ga0373961_0021649_384_1028 214
460 3300039062 Ga0400483_079270 Ga0400483_079270_3806_4450 214
461 3300050512 nmdc:mga0n895_401900_c1 nmdc:mga0n895_401900_c1_137_781 214
462 iso_pu_bacteria 2858950400 2858956024 214
463 iso_pu_bacteria 2904434214 2904438373 214
464 3300005545 Ga0070695_100136654 Ga0070695_1001366542 217
465 3300003187 JGI25151J46595_10000125 JGI25151J46595_1000012568 218
466 3300003763 Ga0055529_1001134 Ga0055529_100113410 218
467 3300005456 Ga0070678_100058796 Ga0070678_1000587962 218
468 3300031456 Ga0307513_10056337 Ga0307513_100563373 218
469 3300031665 Ga0316575_10000988 Ga0316575_100009883 218
470 3300031665 Ga0316575_10132345 Ga0316575_101323451 218
471 3300031691 Ga0316579_10171826 Ga0316579_101718261 218
472 3300031727 Ga0316576_10003103 Ga0316576_100031033 218
473 3300036647 Ga0316582_0245505 Ga0316582_0245505_458_1117 218
474 3300053125 Ga0500618_001890 Ga0500618_001890_4765_5430 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05191

ADK_lid

Adenylate kinase, active site lid

144

179

0.97

PF00406

ADK

Adenylate kinase

20

208

0.95

PF13207

AAA_17

AAA domain

21

152

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s36-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119k mutant 0.9345 1 216
6s36-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119k mutant 0.9262 1 216
6rze-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119a mutant 0.9256 1 216
6rze-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119a mutant 0.9175 1 216
4np6-assembly2.cif.gz_D crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor 0.9069 1 216
ID Description Score Start End Superfamily
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8775 3 217 3.40.50.300
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8637 1 218 3.40.50.300
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.86 1 218 3.40.50.300
3l0sA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8492 1 216 3.40.50.300
af_A4I9I1_1_215_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8471 1 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6D0IE52-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9852 1 114 GO:0004017
GO:0005524
GO:0005737
AF-A0A520G5U1-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9848 57 218 GO:0004017
GO:0005524
GO:0005737
AF-A0A355PGB4-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9838 82 216 GO:0004017
GO:0005524
GO:0005737
AF-A0A3D2AJ35-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9788 57 218 GO:0004017
GO:0005524
GO:0005737
AF-A0A520G5U1-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9788 57 218 GO:0004017
GO:0005524
GO:0005737

Feature Viewer

pLDDT pTM Quality
92.69 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map