F451128

General Info

Members Datasets Scaffolds Average Seq Length
474 200 948 191

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10491825|Ga0065715_104918251
Length 206
Sequence MARDLATLPGTFNEILAWLNSDRDVAGQMYVQLRHDLAKIFTWNRCSDPEGLTDEVFDRVSRKVHRLRQTFSGDPRLFFYGVARNLIKEESKKIRAQVSLEQIDLAAANESAQNDNHPGMMRSDCLELCLQKISSDKRDLILDYYAKEKQAKIDHRAEIARRFGVSVEVLRVRIYRIRSKLEQCIESCLDAKRMTNERNQENFHSE

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
149 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
160 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
161 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
162 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
165 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
168 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
169 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
170 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
171 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
172 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
179 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
180 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
181 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
184 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
185 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
186 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
187 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
188 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
189 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
190 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
191 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 97.68
Stem 0
Stem Tuber 0
Unclassified 24.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10491825 3300005293 Bacteria 787
2 SwRhRL2b_contig_2894145 2162886007 Bacteria 1583
3 SwRhRL2b_contig_711571 2162886007 Unclassified 1121
4 MBSR1b_contig_10984612 2162886012 Bacteria 1195
5 MBSR1b_contig_6021763 2162886012 Bacteria 1227
6 MBSR1b_contig_6374553 2162886012 Unclassified 1435
7 MBSR1b_contig_8253416 2162886012 Bacteria 1172
8 CNAas_1000648 3300000532 Unclassified 3345
9 JGI24737J22298_10058043 3300001990 Bacteria 1167
10 JGI24751J29686_10000001 3300002459 Bacteria 210953
11 JGI25406J46586_10008895 3300003203 Bacteria 4519
12 rootL2_10141266 3300003322 Unclassified 3283
13 Ga0065704_10002322 3300005289 Bacteria 5523
14 Ga0065704_10121453 3300005289 Bacteria 1766
15 Ga0065712_10012221 3300005290 Bacteria 1944
16 Ga0065715_10094226 3300005293 Bacteria 4401
17 Ga0065715_10107544 3300005293 Bacteria 2763
18 Ga0065715_10156752 3300005293 Unclassified 1629
19 Ga0065715_10249536 3300005293 Bacteria 1172
20 Ga0065707_10084420 3300005295 Bacteria 7217
21 Ga0065707_10395918 3300005295 Unclassified 859
22 Ga0070670_100000023 3300005331 Bacteria 194438
23 Ga0070670_100029503 3300005331 Unclassified 4723
24 Ga0070670_100099763 3300005331 Bacteria 2499
25 Ga0070670_100164185 3300005331 Bacteria 1925
26 Ga0070670_100165783 3300005331 Unclassified 1915
27 Ga0070670_100410316 3300005331 Bacteria 1197
28 Ga0070670_100919065 3300005331 Unclassified 794
29 Ga0068869_100143470 3300005334 Bacteria 1846
30 Ga0068869_100434290 3300005334 Unclassified 1086
31 Ga0070680_100002066 3300005336 Bacteria 14811
32 Ga0070680_100006593 3300005336 Bacteria 8829
33 Ga0070680_100189106 3300005336 Bacteria 1735
34 Ga0070682_100018251 3300005337 Bacteria 4098
35 Ga0070682_100572919 3300005337 Unclassified 887
36 Ga0070689_100000267 3300005340 Bacteria 30132
37 Ga0070689_100008451 3300005340 Bacteria 7253
38 Ga0070689_100068991 3300005340 Bacteria 2758
39 Ga0070689_100109874 3300005340 Bacteria 2192
40 Ga0070691_10350408 3300005341 Unclassified 820
41 Ga0070691_10354629 3300005341 Unclassified 815
42 Ga0070687_100130971 3300005343 Bacteria 1448
43 Ga0070661_100062157 3300005344 Bacteria 2742
44 Ga0070661_100195699 3300005344 Bacteria 1543
45 Ga0070692_10003038 3300005345 Bacteria 6698
46 Ga0070692_10028970 3300005345 Bacteria 2757
47 Ga0070692_10043953 3300005345 Bacteria 2299
48 Ga0070692_10057355 3300005345 Bacteria 2042
49 Ga0070692_10077087 3300005345 Bacteria 1788
50 Ga0070669_100003677 3300005353 Bacteria 11066
51 Ga0070669_100003806 3300005353 Bacteria 10903
52 Ga0070669_100063221 3300005353 Unclassified 2724
53 Ga0070669_100482596 3300005353 Bacteria 1026
54 Ga0070675_100874054 3300005354 Bacteria 823
55 Ga0070673_100312972 3300005364 Bacteria 1385
56 Ga0070673_100376576 3300005364 Unclassified 1265
57 Ga0070673_100899184 3300005364 Bacteria 821
58 Ga0070688_100059851 3300005365 Bacteria 2404
59 Ga0070688_100282400 3300005365 Bacteria 1193
60 Ga0070659_100009956 3300005366 Bacteria 6994
61 Ga0070701_10071627 3300005438 Bacteria 1854
62 Ga0070701_10284322 3300005438 Unclassified 1011
63 Ga0070705_100009981 3300005440 Bacteria 4740
64 Ga0070705_100092178 3300005440 Bacteria 1891
65 Ga0070705_100144976 3300005440 Unclassified 1568
66 Ga0070705_100468980 3300005440 Bacteria 949
67 Ga0070705_100527204 3300005440 Unclassified 901
68 Ga0070700_100000097 3300005441 Bacteria 58031
69 Ga0070700_100000144 3300005441 Bacteria 42369
70 Ga0070700_100067429 3300005441 Bacteria 2273
71 Ga0070700_100158744 3300005441 Bacteria 1554
72 Ga0070700_100568667 3300005441 Unclassified 883
73 Ga0070694_100001539 3300005444 Bacteria 13559
74 Ga0070694_100002176 3300005444 Bacteria 11619
75 Ga0070694_100023821 3300005444 Bacteria 3943
76 Ga0070694_100399688 3300005444 Bacteria 1075
77 Ga0070681_10000360 3300005458 Bacteria 36760
78 Ga0070681_10000750 3300005458 Bacteria 26974
79 Ga0070681_10007635 3300005458 Bacteria 10576
80 Ga0070681_10392296 3300005458 Unclassified 1299
81 Ga0070685_10672880 3300005466 Unclassified 752
82 Ga0070685_10869435 3300005466 Bacteria 669
83 Ga0070706_100000050 3300005467 Bacteria 140240
84 Ga0070706_100448909 3300005467 Unclassified 1200
85 Ga0070707_100152349 3300005468 Bacteria 2251
86 Ga0070707_100388476 3300005468 Bacteria 1355
87 Ga0070699_100008795 3300005518 Bacteria 8752
88 Ga0070679_100000041 3300005530 Bacteria 96201
89 Ga0070679_100000154 3300005530 Bacteria 55597
90 Ga0070679_100039176 3300005530 Bacteria 4711
91 Ga0070697_100288565 3300005536 Unclassified 1409
92 Ga0068853_100076549 3300005539 Bacteria 2922
93 Ga0070695_100029236 3300005545 Unclassified 3423
94 Ga0070695_100034224 3300005545 Bacteria 3183
95 Ga0070695_100052955 3300005545 Bacteria 2610
96 Ga0070695_100074585 3300005545 Unclassified 2230
97 Ga0070695_100329780 3300005545 Bacteria 1137
98 Ga0070695_100417112 3300005545 Bacteria 1021
99 Ga0070696_100110519 3300005546 Bacteria 1979
100 Ga0070696_100244184 3300005546 Unclassified 1356
101 Ga0070696_100371034 3300005546 Bacteria 1113
102 Ga0070696_100451006 3300005546 Bacteria 1015
103 Ga0070696_100657283 3300005546 Bacteria 850
104 Ga0070696_100723218 3300005546 Unclassified 813
105 Ga0070693_100007342 3300005547 Bacteria 5384
106 Ga0070693_100013423 3300005547 Unclassified 4173
107 Ga0070693_100013919 3300005547 Bacteria 4108
108 Ga0070693_100015623 3300005547 Bacteria 3911
109 Ga0070693_100032625 3300005547 Bacteria 2866
110 Ga0070693_100042419 3300005547 Bacteria 2563
111 Ga0070693_100088341 3300005547 Unclassified 1863
112 Ga0070693_100126781 3300005547 Bacteria 1590
113 Ga0070693_100291972 3300005547 Unclassified 1096
114 Ga0070704_100133278 3300005549 Bacteria 1929
115 Ga0070704_100323313 3300005549 Unclassified 1293
116 Ga0070704_100341733 3300005549 Unclassified 1261
117 Ga0068855_100114683 3300005563 Bacteria 3089
118 Ga0070664_100002783 3300005564 Bacteria 14113
119 Ga0070664_100095745 3300005564 Bacteria 2575
120 Ga0070664_100576540 3300005564 Unclassified 1042
121 Ga0068857_100001080 3300005577 Bacteria 21110
122 Ga0068857_100031555 3300005577 Unclassified 4683
123 Ga0068857_100588752 3300005577 Bacteria 1051
124 Ga0068857_100627320 3300005577 Bacteria 1017
125 Ga0068857_100733998 3300005577 Unclassified 940
126 Ga0068854_100011963 3300005578 Bacteria 5671
127 Ga0068854_100159799 3300005578 Unclassified 1744
128 Ga0068856_100009899 3300005614 Bacteria 9258
129 Ga0070702_100013205 3300005615 Bacteria 4164
130 Ga0070702_100081314 3300005615 Bacteria 1941
131 Ga0070702_100280580 3300005615 Bacteria 1144
132 Ga0068852_100537862 3300005616 Unclassified 1167
133 Ga0068859_100003243 3300005617 Bacteria 16556
134 Ga0068859_100015708 3300005617 Bacteria 7608
135 Ga0068859_100021133 3300005617 Bacteria 6531
136 Ga0068859_100069183 3300005617 Bacteria 3565
137 Ga0068859_100084241 3300005617 Unclassified 3224
138 Ga0068859_100285978 3300005617 Bacteria 1742
139 Ga0068859_100297989 3300005617 Bacteria 1706
140 Ga0068859_100404308 3300005617 Bacteria 1461
141 Ga0068859_100863909 3300005617 Bacteria 990
142 Ga0068859_100961995 3300005617 Unclassified 937
143 Ga0068864_100000966 3300005618 Bacteria 24106
144 Ga0068864_100027229 3300005618 Bacteria 4825
145 Ga0068864_100038016 3300005618 Unclassified 4109
146 Ga0068864_100094859 3300005618 Bacteria 2638
147 Ga0068864_100154348 3300005618 Bacteria 2083
148 Ga0068864_100233933 3300005618 Unclassified 1700
149 Ga0068864_100263152 3300005618 Bacteria 1605
150 Ga0068864_100357316 3300005618 Bacteria 1380
151 Ga0068864_100410385 3300005618 Bacteria 1289
152 Ga0068864_100672107 3300005618 Unclassified 1010
153 Ga0068864_101442336 3300005618 Unclassified 691
154 Ga0068861_100001223 3300005719 Bacteria 15984
155 Ga0068861_100019497 3300005719 Bacteria 4844
156 Ga0068851_10082342 3300005834 Bacteria 1682
157 Ga0068870_10001689 3300005840 Bacteria 9015
158 Ga0068870_10005278 3300005840 Bacteria 5627
159 Ga0068870_10075305 3300005840 Bacteria 1851
160 Ga0068870_10080982 3300005840 Bacteria 1795
161 Ga0068870_10340686 3300005840 Bacteria 959
162 Ga0068863_100009378 3300005841 Bacteria 9551
163 Ga0068863_100144255 3300005841 Bacteria 2277
164 Ga0068863_100163648 3300005841 Bacteria 2133
165 Ga0068863_100218424 3300005841 Bacteria 1836
166 Ga0068863_100539150 3300005841 Unclassified 1151
167 Ga0068863_100849059 3300005841 Bacteria 912
168 Ga0068863_101154204 3300005841 Unclassified 780
169 Ga0068858_100016616 3300005842 Bacteria 6912
170 Ga0068858_100095959 3300005842 Bacteria 2763
171 Ga0068860_100112178 3300005843 Bacteria 2607
172 Ga0068860_100169408 3300005843 Unclassified 2109
173 Ga0068860_100245846 3300005843 Bacteria 1741
174 Ga0068860_100282322 3300005843 Bacteria 1623
175 Ga0068862_100682476 3300005844 Bacteria 993
176 Ga0081539_10000043 3300005985 Bacteria 288108
177 Ga0097621_100002258 3300006237 Bacteria 13174
178 Ga0097621_100797863 3300006237 Unclassified 875
179 Ga0068871_100014016 3300006358 Bacteria 5965
180 Ga0068871_100065168 3300006358 Bacteria 2983
181 Ga0075430_100053182 3300006846 Bacteria 3410
182 Ga0075431_100127946 3300006847 Bacteria 2621
183 Ga0075431_100208719 3300006847 Bacteria 1996
184 Ga0075433_10015684 3300006852 Bacteria 6223
185 Ga0075433_10032791 3300006852 Bacteria 4451
186 Ga0075433_10047151 3300006852 Bacteria 3748
187 Ga0075433_10064971 3300006852 Bacteria 3200
188 Ga0075433_10112187 3300006852 Bacteria 2418
189 Ga0075433_10119635 3300006852 Bacteria 2338
190 Ga0075434_100052772 3300006871 Unclassified 4041
191 Ga0075434_100077694 3300006871 Unclassified 3314
192 Ga0075434_100132539 3300006871 Bacteria 2512
193 Ga0075434_100654174 3300006871 Unclassified 1069
194 Ga0075434_101190717 3300006871 Unclassified 774
195 Ga0075429_100676623 3300006880 Unclassified 904
196 Ga0068865_101037683 3300006881 Unclassified 719
197 Ga0097620_100003243 3300006931 Bacteria 16556
198 Ga0097620_100015708 3300006931 Bacteria 7608
199 Ga0097620_100021133 3300006931 Bacteria 6531
200 Ga0097620_100069185 3300006931 Bacteria 3565
201 Ga0097620_100084240 3300006931 Unclassified 3224
202 Ga0097620_100285986 3300006931 Bacteria 1742
203 Ga0097620_100297994 3300006931 Bacteria 1706
204 Ga0097620_100404316 3300006931 Bacteria 1461
205 Ga0097620_100863920 3300006931 Bacteria 990
206 Ga0097620_100961944 3300006931 Unclassified 937
207 Ga0075435_100168954 3300007076 Unclassified 1845
208 Ga0075435_100326548 3300007076 Bacteria 1314
209 Ga0105240_11293611 3300009093 Bacteria 769
210 Ga0111539_10007631 3300009094 Bacteria 13823
211 Ga0111539_10019559 3300009094 Bacteria 8354
212 Ga0111539_10097945 3300009094 Bacteria 3445
213 Ga0105247_10030979 3300009101 Bacteria 3244
214 Ga0105247_10106041 3300009101 Bacteria 1802
215 Ga0114129_10004867 3300009147 Bacteria 18954
216 Ga0114129_10037578 3300009147 Bacteria 6836
217 Ga0114129_10045592 3300009147 Bacteria 6163
218 Ga0114129_10262178 3300009147 Bacteria 2315
219 Ga0114129_10711011 3300009147 Bacteria 1290
220 Ga0105243_10002519 3300009148 Bacteria 15296
221 Ga0105243_10043300 3300009148 Bacteria 3528
222 Ga0105243_10081572 3300009148 Unclassified 2641
223 Ga0105243_10153377 3300009148 Bacteria 1979
224 Ga0105243_10319865 3300009148 Unclassified 1413
225 Ga0105241_10102695 3300009174 Bacteria 2275
226 Ga0105241_10170885 3300009174 Bacteria 1795
227 Ga0105241_10379347 3300009174 Unclassified 1235
228 Ga0105241_10525959 3300009174 Bacteria 1058
229 Ga0105241_10764610 3300009174 Unclassified 887
230 Ga0105241_11185979 3300009174 Unclassified 723
231 Ga0105242_10078453 3300009176 Unclassified 2757
232 Ga0105242_10115496 3300009176 Bacteria 2295
233 Ga0105248_10000448 3300009177 Bacteria 46852
234 Ga0105248_10002570 3300009177 Bacteria 20171
235 Ga0105248_10089682 3300009177 Bacteria 3461
236 Ga0105248_10115050 3300009177 Bacteria 3034
237 Ga0105248_11573637 3300009177 Unclassified 744
238 Ga0105237_10002238 3300009545 Bacteria 24156
239 Ga0105238_10001288 3300009551 Bacteria 25197
240 Ga0105238_10026289 3300009551 Bacteria 5932
241 Ga0105249_10150215 3300009553 Bacteria 2242
242 Ga0105249_10420585 3300009553 Bacteria 1370
243 Ga0105249_10507486 3300009553 Unclassified 1252
244 Ga0099796_10144276 3300010159 Unclassified 933
245 Ga0105239_10534686 3300010375 Bacteria 1334
246 Ga0105239_10689367 3300010375 Bacteria 1168
247 Ga0105239_11046659 3300010375 Unclassified 939
248 Ga0105239_11261364 3300010375 Bacteria 852
249 Ga0105246_10035089 3300011119 Bacteria 3349
250 Ga0105246_10055012 3300011119 Bacteria 2745
251 Ga0105246_10212294 3300011119 Bacteria 1511
252 Ga0105246_10351044 3300011119 Bacteria 1209
253 Ga0157373_10013562 3300013100 Bacteria 5979
254 Ga0157373_10016546 3300013100 Bacteria 5377
255 Ga0157373_10034204 3300013100 Bacteria 3650
256 Ga0157378_10355171 3300013297 Unclassified 1433
257 Ga0157378_10366434 3300013297 Unclassified 1411
258 Ga0163162_10071303 3300013306 Bacteria 3527
259 Ga0163162_10091733 3300013306 Bacteria 3121
260 Ga0157372_10012112 3300013307 Bacteria 9186
261 Ga0157372_10015217 3300013307 Bacteria 8240
262 Ga0157372_10021056 3300013307 Bacteria 7041
263 Ga0157372_10040919 3300013307 Bacteria 5122
264 Ga0163163_10000152 3300014325 Bacteria 72037
265 Ga0163163_10004436 3300014325 Bacteria 11967
266 Ga0163163_10036348 3300014325 Bacteria 4784
267 Ga0163163_10199940 3300014325 Unclassified 2047
268 Ga0163163_10320615 3300014325 Unclassified 1603
269 Ga0163163_11842868 3300014325 Bacteria 665
270 Ga0157380_10239654 3300014326 Unclassified 1634
271 Ga0157380_10308596 3300014326 Bacteria 1461
272 Ga0157377_10030171 3300014745 Bacteria 2935
273 Ga0157377_10541263 3300014745 Bacteria 821
274 Ga0207710_10038221 3300025900 Bacteria 2122
275 Ga0207647_10001949 3300025904 Bacteria 15768
276 Ga0207699_10058933 3300025906 Bacteria 2299
277 Ga0207643_10001859 3300025908 Bacteria 11672
278 Ga0207643_10008168 3300025908 Bacteria 5617
279 Ga0207643_10055912 3300025908 Bacteria 2244
280 Ga0207643_10546816 3300025908 Bacteria 743
281 Ga0207684_10000131 3300025910 Bacteria 137508
282 Ga0207684_10375180 3300025910 Unclassified 1224
283 Ga0207684_10794767 3300025910 Unclassified 800
284 Ga0207654_10035720 3300025911 Bacteria 2771
285 Ga0207654_10184850 3300025911 Bacteria 1362
286 Ga0207654_10684310 3300025911 Bacteria 736
287 Ga0207707_10000012 3300025912 Bacteria 280486
288 Ga0207707_10000013 3300025912 Bacteria 264517
289 Ga0207707_10060512 3300025912 Unclassified 3294
290 Ga0207671_10016131 3300025914 Bacteria 5819
291 Ga0207660_10001123 3300025917 Bacteria 17909
292 Ga0207649_10051028 3300025920 Bacteria 2561
293 Ga0207649_10571577 3300025920 Bacteria 867
294 Ga0207652_10000259 3300025921 Bacteria 55289
295 Ga0207652_10000268 3300025921 Bacteria 54182
296 Ga0207652_10505926 3300025921 Bacteria 1087
297 Ga0207646_10814738 3300025922 Bacteria 831
298 Ga0207681_10005171 3300025923 Bacteria 8012
299 Ga0207681_10007812 3300025923 Bacteria 6551
300 Ga0207694_10043068 3300025924 Bacteria 3484
301 Ga0207650_10000005 3300025925 Bacteria 663190
302 Ga0207650_10000556 3300025925 Bacteria 30289
303 Ga0207650_10066599 3300025925 Bacteria 2701
304 Ga0207659_10198715 3300025926 Bacteria 1600
305 Ga0207690_10008806 3300025932 Bacteria 5990
306 Ga0207690_10128023 3300025932 Bacteria 1854
307 Ga0207686_10321926 3300025934 Unclassified 1155
308 Ga0207709_10016777 3300025935 Bacteria 4078
309 Ga0207709_10143710 3300025935 Bacteria 1643
310 Ga0207709_10200066 3300025935 Bacteria 1426
311 Ga0207709_10363326 3300025935 Unclassified 1097
312 Ga0207670_10003415 3300025936 Bacteria 8428
313 Ga0207670_10039474 3300025936 Bacteria 3092
314 Ga0207670_10206108 3300025936 Bacteria 1497
315 Ga0207670_10514612 3300025936 Bacteria 974
316 Ga0207704_10500359 3300025938 Bacteria 979
317 Ga0207711_10003232 3300025941 Bacteria 14202
318 Ga0207711_10011614 3300025941 Bacteria 7318
319 Ga0207711_10096733 3300025941 Bacteria 2606
320 Ga0207711_10136483 3300025941 Unclassified 2204
321 Ga0207689_10017242 3300025942 Bacteria 6111
322 Ga0207689_10126767 3300025942 Bacteria 2100
323 Ga0207689_10438359 3300025942 Unclassified 1091
324 Ga0207689_10717437 3300025942 Bacteria 843
325 Ga0207679_10061930 3300025945 Unclassified 2787
326 Ga0207679_10300149 3300025945 Bacteria 1384
327 Ga0207679_11072137 3300025945 Unclassified 739
328 Ga0207667_10188389 3300025949 Unclassified 2117
329 Ga0207667_10779361 3300025949 Unclassified 954
330 Ga0207651_10657376 3300025960 Unclassified 920
331 Ga0207651_10941201 3300025960 Bacteria 770
332 Ga0207712_10338122 3300025961 Bacteria 1247
333 Ga0207640_10047314 3300025981 Bacteria 2773
334 Ga0207640_10103337 3300025981 Bacteria 2003
335 Ga0207640_10582373 3300025981 Bacteria 945
336 Ga0207703_10032474 3300026035 Bacteria 4132
337 Ga0207703_10160478 3300026035 Bacteria 1969
338 Ga0207639_10381152 3300026041 Bacteria 1266
339 Ga0207678_10862470 3300026067 Unclassified 800
340 Ga0207708_10000016 3300026075 Bacteria 193989
341 Ga0207708_10000272 3300026075 Bacteria 40430
342 Ga0207708_10003056 3300026075 Bacteria 12329
343 Ga0207708_10045914 3300026075 Bacteria 3328
344 Ga0207708_10049697 3300026075 Bacteria 3194
345 Ga0207708_10130396 3300026075 Bacteria 1965
346 Ga0207708_10934892 3300026075 Unclassified 751
347 Ga0207702_10096098 3300026078 Bacteria 2605
348 Ga0207641_10047392 3300026088 Bacteria 3624
349 Ga0207641_10058645 3300026088 Bacteria 3277
350 Ga0207641_10292467 3300026088 Bacteria 1536
351 Ga0207641_10338364 3300026088 Bacteria 1431
352 Ga0207641_10944782 3300026088 Unclassified 857
353 Ga0207676_10001637 3300026095 Bacteria 16504
354 Ga0207676_10202854 3300026095 Bacteria 1754
355 Ga0207676_10214990 3300026095 Bacteria 1708
356 Ga0207676_10224232 3300026095 Unclassified 1676
357 Ga0207676_10296285 3300026095 Bacteria 1475
358 Ga0207676_10394494 3300026095 Bacteria 1292
359 Ga0207676_10504933 3300026095 Bacteria 1149
360 Ga0207676_10777831 3300026095 Unclassified 932
361 Ga0207676_11015940 3300026095 Bacteria 817
362 Ga0207674_10001238 3300026116 Bacteria 33319
363 Ga0207674_10023021 3300026116 Bacteria 6681
364 Ga0207674_10117045 3300026116 Unclassified 2636
365 Ga0207674_11012522 3300026116 Bacteria 800
366 Ga0207675_100004020 3300026118 Bacteria 14264
367 Ga0207675_100074022 3300026118 Bacteria 3187
368 Ga0207675_100660828 3300026118 Bacteria 1052
369 Ga0207698_10125674 3300026142 Bacteria 2180
370 Ga0207698_10392554 3300026142 Bacteria 1324
371 Ga0207428_10017332 3300027907 Bacteria 6183
372 Ga0207428_10043327 3300027907 Bacteria 3635
373 Ga0268266_10442354 3300028379 Bacteria 1235
374 Ga0268264_10094166 3300028381 Bacteria 2589
375 Ga0268264_10361653 3300028381 Bacteria 1384
376 Ga0268264_10525132 3300028381 Unclassified 1158
377 Ga0307408_100013187 3300031548 Bacteria 5486
378 Ga0307405_10094656 3300031731 Bacteria 1987
379 Ga0307413_10012403 3300031824 Unclassified 4242
380 Ga0307410_10110886 3300031852 Bacteria 1985
381 Ga0307406_10000699 3300031901 Bacteria 18981
382 Ga0307407_10226301 3300031903 Bacteria 1267
383 Ga0307412_10022114 3300031911 Bacteria 3893
384 Ga0307416_100376168 3300032002 Bacteria 1448
385 Ga0307414_10017532 3300032004 Unclassified 4383
386 Ga0307411_10018185 3300032005 Bacteria 4027
387 Ga0307415_100004263 3300032126 Bacteria 7397
388 Ga0373959_0077884 3300034820 Unclassified 759
389 Ga0373951_0000681 3300035091 Bacteria 9352
390 Ga0373941_0006283 3300035115 Bacteria 2854
391 Ga0373961_0014435 3300035241 Bacteria 2007
392 Ga0395898_0166694 3300037466 Bacteria 2106
393 Ga0395898_0257577 3300037466 Unclassified 1664
394 Ga0395901_0158315 3300038443 Bacteria 2378
395 Ga0242420_003197 3300038996 Unclassified 2413
396 Ga0439437_007941 3300042000 Bacteria 1188
397 Ga0439458_0007764 3300042157 Bacteria 2389
398 Ga0451576_1288419 3300045051 Unclassified 762
399 Ga0495672_0258463 3300047320 Unclassified 842
400 Ga0496102_0325352 3300048905 Bacteria 1448
401 Ga0496102_0493048 3300048905 Unclassified 1147
402 Ga0496103_0071887 3300048906 Bacteria 2166
403 Ga0496104_0049198 3300048907 Bacteria 3976
404 Ga0496109_0295619 3300048912 Bacteria 1527
405 Ga0496112_0190709 3300048915 Bacteria 2012
406 Ga0496112_0313794 3300048915 Bacteria 1513
407 Ga0496112_0632479 3300048915 Bacteria 1001
408 Ga0496112_1183787 3300048915 Viruses 681
409 Ga0496113_0032973 3300048916 Bacteria 3768
410 Ga0501291_020630 3300049514 Bacteria 1044
411 Ga0501296_048235 3300049519 Bacteria 618
412 Ga0501298_068056 3300049521 Unclassified 765
413 Ga0501299_034372 3300049522 Bacteria 992
414 Ga0501038_0014076 3300049574 Bacteria 7287
415 Ga0501202_004260 3300049652 Bacteria 2500
416 Ga0501207_000260 3300049654 Bacteria 5455
417 Ga0501209_000740 3300049656 Bacteria 4139
418 Ga0501216_011469 3300049660 Bacteria 1440
419 Ga0501217_000388 3300049661 Bacteria 7075
420 Ga0501217_030750 3300049661 Unclassified 1320
421 Ga0501223_001066 3300049663 Bacteria 6483
422 Ga0501224_000584 3300049664 Bacteria 4489
423 Ga0501227_008915 3300049665 Bacteria 2157
424 Ga0501230_015029 3300049667 Bacteria 1279
425 Ga0501235_000442 3300049669 Bacteria 8068
426 Ga0501236_002918 3300049670 Bacteria 1982
427 Ga0501240_002724 3300049673 Bacteria 1903
428 Ga0501240_051053 3300049673 Unclassified 709
429 Ga0501243_031292 3300049675 Bacteria 909
430 Ga0501249_015982 3300049679 Bacteria 1608
431 Ga0501253_028989 3300049683 Bacteria 1041
432 Ga0501256_000412 3300049685 Bacteria 2711
433 Ga0501259_003645 3300049688 Bacteria 2445
434 Ga0501221_001244 3300049704 Bacteria 4215
435 Ga0501225_0001104 3300049705 Bacteria 8462
436 Ga0501225_0032950 3300049705 Bacteria 1425
437 Ga0501225_0078538 3300049705 Unclassified 945
438 Ga0501229_000444 3300049706 Bacteria 4667
439 Ga0501234_000452 3300049707 Bacteria 6206
440 Ga0501234_020996 3300049707 Unclassified 1039
441 Ga0501245_023369 3300049708 Bacteria 981
442 Ga0501268_015302 3300049765 Bacteria 1259
443 Ga0501270_017440 3300049767 Unclassified 1051
444 Ga0501273_022812 3300049770 Bacteria 856
445 Ga0501283_005597 3300049779 Bacteria 1733
446 Ga0501283_032941 3300049779 Unclassified 876
447 Ga0501212_000815 3300049851 Bacteria 3269
448 Ga0501226_000677 3300049853 Bacteria 4620
449 nmdc:mga05p37_121879_c1 3300050507 Bacteria 3202
450 nmdc:mga05p37_161709_c1 3300050507 Bacteria 2734
451 nmdc:mga05p37_5513_c1 3300050507 Bacteria 14860
452 nmdc:mga09592_103082_c1 3300050508 Bacteria 2444
453 nmdc:mga09592_1206521_c1 3300050508 Bacteria 625
454 nmdc:mga0qj67_237403_c1 3300050509 Bacteria 1479
455 nmdc:mga06r32_345999_c1 3300050510 Bacteria 1471
456 nmdc:mga08y16_1353026_c1 3300050511 Unclassified 677
457 nmdc:mga08y16_1877_c1 3300050511 Bacteria 12673
458 nmdc:mga08y16_32853_c1 3300050511 Bacteria 5454
459 nmdc:mga08y16_59064_c1 3300050511 Unclassified 4007
460 nmdc:mga0n895_1154027_c1 3300050512 Unclassified 750
461 nmdc:mga0n895_116675_c1 3300050512 Bacteria 2688
462 nmdc:mga0n895_386661_c1 3300050512 Bacteria 1415
463 nmdc:mga0n895_387477_c1 3300050512 Bacteria 1414
464 nmdc:mga0n895_53297_c1 3300050512 Unclassified 3974
465 nmdc:mga0n895_795076_c1 3300050512 Unclassified 937
466 nmdc:mga0rr50_17092_c1 3300050513 Unclassified 4833
467 nmdc:mga0rr50_356965_c1 3300050513 Bacteria 1230
468 nmdc:mga0a205_103352_c1 3300050515 Unclassified 2748
469 nmdc:mga0a205_16083_c1 3300050515 Bacteria 7003
470 nmdc:mga0a205_214454_c1 3300050515 Bacteria 1812
471 nmdc:mga0a205_251810_c1 3300050515 Unclassified 1645
472 nmdc:mga0a205_302290_c1 3300050515 Unclassified 1473
473 nmdc:mga0a205_75328_c1 3300050515 Bacteria 3261
474 Ga0530510_0056573 3300061734 Bacteria 2834
475 Ga0065715_10491825
476 SwRhRL2b_contig_2894145
477 SwRhRL2b_contig_711571
478 MBSR1b_contig_10984612
479 MBSR1b_contig_6021763
480 MBSR1b_contig_6374553
481 MBSR1b_contig_8253416
482 CNAas_1000648
483 JGI24737J22298_10058043
484 JGI24751J29686_10000001
485 JGI25406J46586_10008895
486 rootL2_10141266
487 Ga0065704_10002322
488 Ga0065704_10121453
489 Ga0065712_10012221
490 Ga0065715_10094226
491 Ga0065715_10107544
492 Ga0065715_10156752
493 Ga0065715_10249536
494 Ga0065707_10084420
495 Ga0065707_10395918
496 Ga0070670_100000023
497 Ga0070670_100029503
498 Ga0070670_100099763
499 Ga0070670_100164185
500 Ga0070670_100165783
501 Ga0070670_100410316
502 Ga0070670_100919065
503 Ga0068869_100143470
504 Ga0068869_100434290
505 Ga0070680_100002066
506 Ga0070680_100006593
507 Ga0070680_100189106
508 Ga0070682_100018251
509 Ga0070682_100572919
510 Ga0070689_100000267
511 Ga0070689_100008451
512 Ga0070689_100068991
513 Ga0070689_100109874
514 Ga0070691_10350408
515 Ga0070691_10354629
516 Ga0070687_100130971
517 Ga0070661_100062157
518 Ga0070661_100195699
519 Ga0070692_10003038
520 Ga0070692_10028970
521 Ga0070692_10043953
522 Ga0070692_10057355
523 Ga0070692_10077087
524 Ga0070669_100003677
525 Ga0070669_100003806
526 Ga0070669_100063221
527 Ga0070669_100482596
528 Ga0070675_100874054
529 Ga0070673_100312972
530 Ga0070673_100376576
531 Ga0070673_100899184
532 Ga0070688_100059851
533 Ga0070688_100282400
534 Ga0070659_100009956
535 Ga0070701_10071627
536 Ga0070701_10284322
537 Ga0070705_100009981
538 Ga0070705_100092178
539 Ga0070705_100144976
540 Ga0070705_100468980
541 Ga0070705_100527204
542 Ga0070700_100000097
543 Ga0070700_100000144
544 Ga0070700_100067429
545 Ga0070700_100158744
546 Ga0070700_100568667
547 Ga0070694_100001539
548 Ga0070694_100002176
549 Ga0070694_100023821
550 Ga0070694_100399688
551 Ga0070681_10000360
552 Ga0070681_10000750
553 Ga0070681_10007635
554 Ga0070681_10392296
555 Ga0070685_10672880
556 Ga0070685_10869435
557 Ga0070706_100000050
558 Ga0070706_100448909
559 Ga0070707_100152349
560 Ga0070707_100388476
561 Ga0070699_100008795
562 Ga0070679_100000041
563 Ga0070679_100000154
564 Ga0070679_100039176
565 Ga0070697_100288565
566 Ga0068853_100076549
567 Ga0070695_100029236
568 Ga0070695_100034224
569 Ga0070695_100052955
570 Ga0070695_100074585
571 Ga0070695_100329780
572 Ga0070695_100417112
573 Ga0070696_100110519
574 Ga0070696_100244184
575 Ga0070696_100371034
576 Ga0070696_100451006
577 Ga0070696_100657283
578 Ga0070696_100723218
579 Ga0070693_100007342
580 Ga0070693_100013423
581 Ga0070693_100013919
582 Ga0070693_100015623
583 Ga0070693_100032625
584 Ga0070693_100042419
585 Ga0070693_100088341
586 Ga0070693_100126781
587 Ga0070693_100291972
588 Ga0070704_100133278
589 Ga0070704_100323313
590 Ga0070704_100341733
591 Ga0068855_100114683
592 Ga0070664_100002783
593 Ga0070664_100095745
594 Ga0070664_100576540
595 Ga0068857_100001080
596 Ga0068857_100031555
597 Ga0068857_100588752
598 Ga0068857_100627320
599 Ga0068857_100733998
600 Ga0068854_100011963
601 Ga0068854_100159799
602 Ga0068856_100009899
603 Ga0070702_100013205
604 Ga0070702_100081314
605 Ga0070702_100280580
606 Ga0068852_100537862
607 Ga0068859_100003243
608 Ga0068859_100015708
609 Ga0068859_100021133
610 Ga0068859_100069183
611 Ga0068859_100084241
612 Ga0068859_100285978
613 Ga0068859_100297989
614 Ga0068859_100404308
615 Ga0068859_100863909
616 Ga0068859_100961995
617 Ga0068864_100000966
618 Ga0068864_100027229
619 Ga0068864_100038016
620 Ga0068864_100094859
621 Ga0068864_100154348
622 Ga0068864_100233933
623 Ga0068864_100263152
624 Ga0068864_100357316
625 Ga0068864_100410385
626 Ga0068864_100672107
627 Ga0068864_101442336
628 Ga0068861_100001223
629 Ga0068861_100019497
630 Ga0068851_10082342
631 Ga0068870_10001689
632 Ga0068870_10005278
633 Ga0068870_10075305
634 Ga0068870_10080982
635 Ga0068870_10340686
636 Ga0068863_100009378
637 Ga0068863_100144255
638 Ga0068863_100163648
639 Ga0068863_100218424
640 Ga0068863_100539150
641 Ga0068863_100849059
642 Ga0068863_101154204
643 Ga0068858_100016616
644 Ga0068858_100095959
645 Ga0068860_100112178
646 Ga0068860_100169408
647 Ga0068860_100245846
648 Ga0068860_100282322
649 Ga0068862_100682476
650 Ga0081539_10000043
651 Ga0097621_100002258
652 Ga0097621_100797863
653 Ga0068871_100014016
654 Ga0068871_100065168
655 Ga0075430_100053182
656 Ga0075431_100127946
657 Ga0075431_100208719
658 Ga0075433_10015684
659 Ga0075433_10032791
660 Ga0075433_10047151
661 Ga0075433_10064971
662 Ga0075433_10112187
663 Ga0075433_10119635
664 Ga0075434_100052772
665 Ga0075434_100077694
666 Ga0075434_100132539
667 Ga0075434_100654174
668 Ga0075434_101190717
669 Ga0075429_100676623
670 Ga0068865_101037683
671 Ga0097620_100003243
672 Ga0097620_100015708
673 Ga0097620_100021133
674 Ga0097620_100069185
675 Ga0097620_100084240
676 Ga0097620_100285986
677 Ga0097620_100297994
678 Ga0097620_100404316
679 Ga0097620_100863920
680 Ga0097620_100961944
681 Ga0075435_100168954
682 Ga0075435_100326548
683 Ga0105240_11293611
684 Ga0111539_10007631
685 Ga0111539_10019559
686 Ga0111539_10097945
687 Ga0105247_10030979
688 Ga0105247_10106041
689 Ga0114129_10004867
690 Ga0114129_10037578
691 Ga0114129_10045592
692 Ga0114129_10262178
693 Ga0114129_10711011
694 Ga0105243_10002519
695 Ga0105243_10043300
696 Ga0105243_10081572
697 Ga0105243_10153377
698 Ga0105243_10319865
699 Ga0105241_10102695
700 Ga0105241_10170885
701 Ga0105241_10379347
702 Ga0105241_10525959
703 Ga0105241_10764610
704 Ga0105241_11185979
705 Ga0105242_10078453
706 Ga0105242_10115496
707 Ga0105248_10000448
708 Ga0105248_10002570
709 Ga0105248_10089682
710 Ga0105248_10115050
711 Ga0105248_11573637
712 Ga0105237_10002238
713 Ga0105238_10001288
714 Ga0105238_10026289
715 Ga0105249_10150215
716 Ga0105249_10420585
717 Ga0105249_10507486
718 Ga0099796_10144276
719 Ga0105239_10534686
720 Ga0105239_10689367
721 Ga0105239_11046659
722 Ga0105239_11261364
723 Ga0105246_10035089
724 Ga0105246_10055012
725 Ga0105246_10212294
726 Ga0105246_10351044
727 Ga0157373_10013562
728 Ga0157373_10016546
729 Ga0157373_10034204
730 Ga0157378_10355171
731 Ga0157378_10366434
732 Ga0163162_10071303
733 Ga0163162_10091733
734 Ga0157372_10012112
735 Ga0157372_10015217
736 Ga0157372_10021056
737 Ga0157372_10040919
738 Ga0163163_10000152
739 Ga0163163_10004436
740 Ga0163163_10036348
741 Ga0163163_10199940
742 Ga0163163_10320615
743 Ga0163163_11842868
744 Ga0157380_10239654
745 Ga0157380_10308596
746 Ga0157377_10030171
747 Ga0157377_10541263
748 Ga0207710_10038221
749 Ga0207647_10001949
750 Ga0207699_10058933
751 Ga0207643_10001859
752 Ga0207643_10008168
753 Ga0207643_10055912
754 Ga0207643_10546816
755 Ga0207684_10000131
756 Ga0207684_10375180
757 Ga0207684_10794767
758 Ga0207654_10035720
759 Ga0207654_10184850
760 Ga0207654_10684310
761 Ga0207707_10000012
762 Ga0207707_10000013
763 Ga0207707_10060512
764 Ga0207671_10016131
765 Ga0207660_10001123
766 Ga0207649_10051028
767 Ga0207649_10571577
768 Ga0207652_10000259
769 Ga0207652_10000268
770 Ga0207652_10505926
771 Ga0207646_10814738
772 Ga0207681_10005171
773 Ga0207681_10007812
774 Ga0207694_10043068
775 Ga0207650_10000005
776 Ga0207650_10000556
777 Ga0207650_10066599
778 Ga0207659_10198715
779 Ga0207690_10008806
780 Ga0207690_10128023
781 Ga0207686_10321926
782 Ga0207709_10016777
783 Ga0207709_10143710
784 Ga0207709_10200066
785 Ga0207709_10363326
786 Ga0207670_10003415
787 Ga0207670_10039474
788 Ga0207670_10206108
789 Ga0207670_10514612
790 Ga0207704_10500359
791 Ga0207711_10003232
792 Ga0207711_10011614
793 Ga0207711_10096733
794 Ga0207711_10136483
795 Ga0207689_10017242
796 Ga0207689_10126767
797 Ga0207689_10438359
798 Ga0207689_10717437
799 Ga0207679_10061930
800 Ga0207679_10300149
801 Ga0207679_11072137
802 Ga0207667_10188389
803 Ga0207667_10779361
804 Ga0207651_10657376
805 Ga0207651_10941201
806 Ga0207712_10338122
807 Ga0207640_10047314
808 Ga0207640_10103337
809 Ga0207640_10582373
810 Ga0207703_10032474
811 Ga0207703_10160478
812 Ga0207639_10381152
813 Ga0207678_10862470
814 Ga0207708_10000016
815 Ga0207708_10000272
816 Ga0207708_10003056
817 Ga0207708_10045914
818 Ga0207708_10049697
819 Ga0207708_10130396
820 Ga0207708_10934892
821 Ga0207702_10096098
822 Ga0207641_10047392
823 Ga0207641_10058645
824 Ga0207641_10292467
825 Ga0207641_10338364
826 Ga0207641_10944782
827 Ga0207676_10001637
828 Ga0207676_10202854
829 Ga0207676_10214990
830 Ga0207676_10224232
831 Ga0207676_10296285
832 Ga0207676_10394494
833 Ga0207676_10504933
834 Ga0207676_10777831
835 Ga0207676_11015940
836 Ga0207674_10001238
837 Ga0207674_10023021
838 Ga0207674_10117045
839 Ga0207674_11012522
840 Ga0207675_100004020
841 Ga0207675_100074022
842 Ga0207675_100660828
843 Ga0207698_10125674
844 Ga0207698_10392554
845 Ga0207428_10017332
846 Ga0207428_10043327
847 Ga0268266_10442354
848 Ga0268264_10094166
849 Ga0268264_10361653
850 Ga0268264_10525132
851 Ga0307408_100013187
852 Ga0307405_10094656
853 Ga0307413_10012403
854 Ga0307410_10110886
855 Ga0307406_10000699
856 Ga0307407_10226301
857 Ga0307412_10022114
858 Ga0307416_100376168
859 Ga0307414_10017532
860 Ga0307411_10018185
861 Ga0307415_100004263
862 Ga0373959_0077884
863 Ga0373951_0000681
864 Ga0373941_0006283
865 Ga0373961_0014435
866 Ga0395898_0166694
867 Ga0395898_0257577
868 Ga0395901_0158315
869 Ga0242420_003197
870 Ga0439437_007941
871 Ga0439458_0007764
872 Ga0451576_1288419
873 Ga0495672_0258463
874 Ga0496102_0325352
875 Ga0496102_0493048
876 Ga0496103_0071887
877 Ga0496104_0049198
878 Ga0496109_0295619
879 Ga0496112_0190709
880 Ga0496112_0313794
881 Ga0496112_0632479
882 Ga0496112_1183787
883 Ga0496113_0032973
884 Ga0501291_020630
885 Ga0501296_048235
886 Ga0501298_068056
887 Ga0501299_034372
888 Ga0501038_0014076
889 Ga0501202_004260
890 Ga0501207_000260
891 Ga0501209_000740
892 Ga0501216_011469
893 Ga0501217_000388
894 Ga0501217_030750
895 Ga0501223_001066
896 Ga0501224_000584
897 Ga0501227_008915
898 Ga0501230_015029
899 Ga0501235_000442
900 Ga0501236_002918
901 Ga0501240_002724
902 Ga0501240_051053
903 Ga0501243_031292
904 Ga0501249_015982
905 Ga0501253_028989
906 Ga0501256_000412
907 Ga0501259_003645
908 Ga0501221_001244
909 Ga0501225_0001104
910 Ga0501225_0032950
911 Ga0501225_0078538
912 Ga0501229_000444
913 Ga0501234_000452
914 Ga0501234_020996
915 Ga0501245_023369
916 Ga0501268_015302
917 Ga0501270_017440
918 Ga0501273_022812
919 Ga0501283_005597
920 Ga0501283_032941
921 Ga0501212_000815
922 Ga0501226_000677
923 nmdc:mga05p37_121879_c1
924 nmdc:mga05p37_161709_c1
925 nmdc:mga05p37_5513_c1
926 nmdc:mga09592_103082_c1
927 nmdc:mga09592_1206521_c1
928 nmdc:mga0qj67_237403_c1
929 nmdc:mga06r32_345999_c1
930 nmdc:mga08y16_1353026_c1
931 nmdc:mga08y16_1877_c1
932 nmdc:mga08y16_32853_c1
933 nmdc:mga08y16_59064_c1
934 nmdc:mga0n895_1154027_c1
935 nmdc:mga0n895_116675_c1
936 nmdc:mga0n895_386661_c1
937 nmdc:mga0n895_387477_c1
938 nmdc:mga0n895_53297_c1
939 nmdc:mga0n895_795076_c1
940 nmdc:mga0rr50_17092_c1
941 nmdc:mga0rr50_356965_c1
942 nmdc:mga0a205_103352_c1
943 nmdc:mga0a205_16083_c1
944 nmdc:mga0a205_214454_c1
945 nmdc:mga0a205_251810_c1
946 nmdc:mga0a205_302290_c1
947 nmdc:mga0a205_75328_c1
948 Ga0530510_0056573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map