F451052

General Info

Members Datasets Scaffolds Average Seq Length
473 300 424 349

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0111990|Ga0395905_0111990_755_1822
Length 340
Sequence MTDTHDNPMGLDGFEFAEFTSPDPEHMTGLIEQLGFVATHRHPTKDILRYKQGDISLLVNRDPSGQAAAFRAEHGAFDMAVERGAKPADAASGALGPDSYVLQGIGGSLLYLIDRYGAKGTIYDGWTAIPGAAEAEAKNAVGLQVLDHLTHNVRRGEMRTWSSFYNRVFGFEEQKYFDIKGKATGLFSQAMIAPDRQIRIPLNESQDENSQIEEFIRQYNGEGIQHLALTTDDIYGTIEKLKARGVVFQDTIETYYELVDKRLPGHGEDLERMKQNRILIDGSQEEGLLLQIFTENLFGPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRGVIKVDA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
8 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
9 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
10 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
11 2643221583 Caulobacter sp. Root655 Isolate Unclassified
12 2643221584 Caulobacter sp. Root656 Isolate Unclassified
13 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
14 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
15 2643221640 Caulobacter sp. Root342 Isolate Unclassified
16 2643221642 Caulobacter sp. Root343 Isolate Unclassified
17 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
18 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
19 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
20 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
21 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
22 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
23 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
24 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
25 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
26 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
27 2818991435 Caulobacter henricii 536 Isolate Unclassified
28 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
29 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
30 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
31 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
32 2849560528 Caulobacter zeae 410 Isolate Unclassified
33 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
34 2851153111 Caulobacter radicis 736 Isolate Unclassified
35 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
36 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
37 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
38 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
39 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
40 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
41 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
42 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
43 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
44 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
45 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
46 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
47 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
48 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
49 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
54 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
131 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
230 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
261 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
262 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
263 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
274 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
277 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
278 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
281 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
282 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
283 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
284 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
285 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
286 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
290 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
291 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
295 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
296 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
297 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.64
Metatranscriptomes 0
Isolates 10.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.63
Bulb 0
Endosphere 31.92
Nodule 0
Rhizoplane 1.48
Rhizosphere 55.81
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010391 3300001979 Bacteria 3591
2 JGI24739J22299_10014357 3300001989 Bacteria 2882
3 JGI24737J22298_10001020 3300001990 Bacteria 9922
4 JGI24737J22298_10001106 3300001990 Bacteria 9485
5 JGI24737J22298_10039714 3300001990 Bacteria 1446
6 JGI24735J21928_10000344 3300002067 Bacteria 16234
7 JGI24735J21928_10018710 3300002067 Bacteria 2135
8 JGI24735J21928_10035210 3300002067 Bacteria 1473
9 JGI24738J21930_10000317 3300002075 Bacteria 13341
10 JGI24738J21930_10002550 3300002075 Bacteria 4730
11 JGI25150J39212_1000946 3300002774 Bacteria 9298
12 JGI25151J46595_10008598 3300003187 Bacteria 4895
13 JGI25165J46597_1000145 3300003214 Bacteria 116948
14 JGI25153J46596_10000036 3300003215 Bacteria 182205
15 JGI25153J46596_10013839 3300003215 Bacteria 3388
16 Ga0055542_1003517 3300003762 Bacteria 4202
17 Ga0055526_1006904 3300003771 Bacteria 6043
18 Ga0055537_1001008 3300003773 Bacteria 12763
19 Ga0055537_1004951 3300003773 Bacteria 3677
20 Ga0055537_1006445 3300003773 Bacteria 2979
21 Ga0055524_1000351 3300003775 Bacteria 41918
22 Ga0055524_1009750 3300003775 Bacteria 3876
23 Ga0055524_1014523 3300003775 Bacteria 2915
24 Ga0055536_1000580 3300003781 Bacteria 24917
25 Ga0055536_1001430 3300003781 Bacteria 14396
26 Ga0055536_1019001 3300003781 Bacteria 2177
27 Ga0055528_1018686 3300003790 Bacteria 2338
28 Ga0055530_10000017 3300003791 Bacteria 144027
29 Ga0055530_10000144 3300003791 Bacteria 63595
30 Ga0055530_10002385 3300003791 Bacteria 12178
31 Ga0055530_10003953 3300003791 Bacteria 8016
32 Ga0055540_1000701 3300003792 Bacteria 23049
33 Ga0055531_10000129 3300003794 Bacteria 85460
34 Ga0055531_10000188 3300003794 Bacteria 68777
35 Ga0055531_10002101 3300003794 Bacteria 13686
36 Ga0055531_10006456 3300003794 Bacteria 6657
37 Ga0055531_10011261 3300003794 Bacteria 4339
38 Ga0055543_1015833 3300004625 Bacteria 1444
39 Ga0065165_1001046 3300005262 Bacteria 33350
40 Ga0065165_1002946 3300005262 Bacteria 12963
41 Ga0065707_10004435 3300005295 Bacteria 6895
42 Ga0070658_10000082 3300005327 Bacteria 89656
43 Ga0070658_10008508 3300005327 Bacteria 8250
44 Ga0070658_10022356 3300005327 Bacteria 5073
45 Ga0070658_10312622 3300005327 Bacteria 1341
46 Ga0070676_10008767 3300005328 Bacteria 5457
47 Ga0068869_100001291 3300005334 Bacteria 14827
48 Ga0070666_10027492 3300005335 Bacteria 3726
49 Ga0068868_100003545 3300005338 Bacteria 10880
50 Ga0070660_100000641 3300005339 Bacteria 23186
51 Ga0070660_100002098 3300005339 Bacteria 13750
52 Ga0070668_100000923 3300005347 Bacteria 20489
53 Ga0070668_100001054 3300005347 Bacteria 19371
54 Ga0070674_100060625 3300005356 Bacteria 2638
55 Ga0070673_100000003 3300005364 Bacteria 216759
56 Ga0070667_100000024 3300005367 Bacteria 191216
57 Ga0070667_100010837 3300005367 Bacteria 7538
58 Ga0070663_100002030 3300005455 Bacteria 11311
59 Ga0070662_100032500 3300005457 Bacteria 3667
60 Ga0070662_100037789 3300005457 Bacteria 3425
61 Ga0068867_100000001 3300005459 Bacteria 427563
62 Ga0068853_100009163 3300005539 Bacteria 7973
63 Ga0070693_100090451 3300005547 Bacteria 1844
64 Ga0070665_100000767 3300005548 Bacteria 42433
65 Ga0068855_100000273 3300005563 Bacteria 63616
66 Ga0068855_100208631 3300005563 Bacteria 2196
67 Ga0068854_100000559 3300005578 Bacteria 22307
68 Ga0068854_100052860 3300005578 Bacteria 2915
69 Ga0068856_100029115 3300005614 Bacteria 5395
70 Ga0068852_100013658 3300005616 Bacteria 6221
71 Ga0068859_100004856 3300005617 Bacteria 13679
72 Ga0068866_10054116 3300005718 Bacteria 2055
73 Ga0068861_100000036 3300005719 Bacteria 60355
74 Ga0068863_100000082 3300005841 Bacteria 105688
75 Ga0068858_100000260 3300005842 Bacteria 56470
76 Ga0068860_100220937 3300005843 Bacteria 1840
77 Ga0068862_100006887 3300005844 Bacteria 9427
78 Ga0081540_1042864 3300005983 Bacteria 2328
79 Ga0081539_10019079 3300005985 Bacteria 4715
80 Ga0075368_10000225 3300006042 Bacteria 15895
81 Ga0075368_10000346 3300006042 Bacteria 13571
82 Ga0075363_100025234 3300006048 Bacteria 3029
83 Ga0075364_10040294 3300006051 Bacteria 3029
84 Ga0075362_10007630 3300006177 Bacteria 4108
85 Ga0075367_10001261 3300006178 Bacteria 10679
86 Ga0075369_10039279 3300006186 Bacteria 2021
87 Ga0097621_100037492 3300006237 Bacteria 3884
88 Ga0075370_10002969 3300006353 Bacteria 7971
89 Ga0075370_10008165 3300006353 Bacteria 5373
90 Ga0075370_10029084 3300006353 Bacteria 3075
91 Ga0075370_10065936 3300006353 Bacteria 2065
92 Ga0068865_100000306 3300006881 Bacteria 27093
93 Ga0097620_100004857 3300006931 Bacteria 13679
94 Ga0105240_10009750 3300009093 Bacteria 13561
95 Ga0105245_10002236 3300009098 Bacteria 17525
96 Ga0105243_10000042 3300009148 Bacteria 159276
97 Ga0105241_10009470 3300009174 Bacteria 7156
98 Ga0105242_10004833 3300009176 Bacteria 10430
99 Ga0105248_10000315 3300009177 Bacteria 57362
100 Ga0105248_10002271 3300009177 Bacteria 21272
101 Ga0105248_10044023 3300009177 Bacteria 5006
102 Ga0105248_10066044 3300009177 Bacteria 4062
103 Ga0105237_10002575 3300009545 Bacteria 22351
104 Ga0105237_10270715 3300009545 Bacteria 1701
105 Ga0105249_10183191 3300009553 Bacteria 2039
106 Ga0105148_100052 3300009978 Bacteria 17846
107 Ga0105239_10000131 3300010375 Bacteria 105796
108 Ga0105239_10011679 3300010375 Bacteria 9802
109 Ga0105246_10008547 3300011119 Bacteria 6297
110 Ga0157373_10130270 3300013100 Bacteria 1769
111 Ga0157370_10000008 3300013104 Bacteria 240668
112 Ga0157369_10011793 3300013105 Bacteria 9925
113 Ga0157369_10103977 3300013105 Bacteria 3025
114 Ga0157369_10285306 3300013105 Bacteria 1719
115 Ga0157374_10014130 3300013296 Bacteria 6979
116 Ga0157374_10075852 3300013296 Bacteria 3177
117 Ga0157378_10011556 3300013297 Bacteria 7731
118 Ga0157372_10027326 3300013307 Bacteria 6213
119 Ga0157372_10094385 3300013307 Bacteria 3406
120 Ga0157375_10001871 3300013308 Bacteria 18131
121 Ga0157380_10027469 3300014326 Bacteria 4329
122 Ga0157376_10000072 3300014969 Bacteria 77631
123 Ga0183365_10001 3300015684 Bacteria 2090444
124 Ga0183363_1003 3300015690 Bacteria 421263
125 Ga0163161_10203205 3300017792 Bacteria 1528
126 Ga0213872_10004938 3300021361 Bacteria 6935
127 Ga0209674_106850 3300025226 Bacteria 1499
128 Ga0209147_101472 3300025229 Bacteria 8441
129 Ga0207427_100395 3300025231 Bacteria 25928
130 Ga0207425_1000037 3300025245 Bacteria 224645
131 Ga0209026_1001380 3300025250 Bacteria 10846
132 Ga0209148_1000441 3300025254 Bacteria 45707
133 Ga0209148_1004388 3300025254 Bacteria 3487
134 Ga0209129_1014866 3300025258 Bacteria 1634
135 Ga0209233_1000207 3300025261 Bacteria 117152
136 Ga0209565_1000012 3300025263 Bacteria 606500
137 Ga0209565_1000118 3300025263 Bacteria 113196
138 Ga0209565_1000314 3300025263 Bacteria 44878
139 Ga0209455_1000772 3300025272 Bacteria 17958
140 Ga0209673_1008474 3300025273 Bacteria 4571
141 Ga0209673_1012955 3300025273 Bacteria 3320
142 Ga0209675_1000089 3300025291 Bacteria 146897
143 Ga0209675_1002824 3300025291 Bacteria 8660
144 Ga0209675_1013585 3300025291 Bacteria 2534
145 Ga0209676_1000128 3300025292 Bacteria 188099
146 Ga0209676_1000151 3300025292 Bacteria 167307
147 Ga0209676_1000212 3300025292 Bacteria 128606
148 Ga0209676_1019332 3300025292 Bacteria 2345
149 Ga0209025_1000117 3300025294 Bacteria 215073
150 Ga0209564_1002594 3300025295 Bacteria 13866
151 Ga0209564_1004400 3300025295 Bacteria 8636
152 Ga0209564_1007705 3300025295 Bacteria 5488
153 Ga0209564_1010025 3300025295 Bacteria 4420
154 Ga0209758_1000103 3300025297 Bacteria 223968
155 Ga0209758_1002847 3300025297 Bacteria 16797
156 Ga0209758_1005117 3300025297 Bacteria 10364
157 Ga0209758_1014215 3300025297 Bacteria 4255
158 Ga0209050_1000001 3300025298 Bacteria 3563507
159 Ga0209050_1000010 3300025298 Bacteria 980454
160 Ga0209050_1000068 3300025298 Bacteria 298849
161 Ga0209050_1000817 3300025298 Bacteria 43485
162 Ga0209050_1001306 3300025298 Bacteria 28018
163 Ga0209050_1005775 3300025298 Bacteria 7617
164 Ga0209050_1006599 3300025298 Bacteria 6814
165 Ga0209050_1009072 3300025298 Bacteria 5167
166 Ga0209256_1000012 3300025299 Bacteria 790371
167 Ga0209256_1004048 3300025299 Bacteria 9537
168 Ga0209256_1006244 3300025299 Bacteria 6412
169 Ga0209256_1010053 3300025299 Bacteria 4033
170 Ga0209051_1000296 3300025303 Bacteria 79427
171 Ga0209051_1001480 3300025303 Bacteria 19758
172 Ga0209257_1000009 3300025304 Bacteria 1205047
173 Ga0209257_1000140 3300025304 Bacteria 201515
174 Ga0209257_1000193 3300025304 Bacteria 151777
175 Ga0209257_1002098 3300025304 Bacteria 20912
176 Ga0209257_1002149 3300025304 Bacteria 20520
177 Ga0209257_1002618 3300025304 Bacteria 17382
178 Ga0209257_1006971 3300025304 Bacteria 7038
179 Ga0209257_1007742 3300025304 Bacteria 6395
180 Ga0209257_1008265 3300025304 Bacteria 5979
181 Ga0209257_1008681 3300025304 Bacteria 5684
182 Ga0207680_10045798 3300025903 Bacteria 2582
183 Ga0207647_10000788 3300025904 Bacteria 24607
184 Ga0207647_10001451 3300025904 Bacteria 18199
185 Ga0207647_10022355 3300025904 Bacteria 4201
186 Ga0207647_10035726 3300025904 Bacteria 3164
187 Ga0207645_10000454 3300025907 Bacteria 34064
188 Ga0207705_10000027 3300025909 Bacteria 248863
189 Ga0207705_10000256 3300025909 Bacteria 51644
190 Ga0207705_10002705 3300025909 Bacteria 13560
191 Ga0207705_10191742 3300025909 Bacteria 1546
192 Ga0207695_10027218 3300025913 Bacteria 6370
193 Ga0207695_10073539 3300025913 Bacteria 3482
194 Ga0207671_10001065 3300025914 Bacteria 33324
195 Ga0207671_10161648 3300025914 Bacteria 1734
196 Ga0207671_10173240 3300025914 Bacteria 1676
197 Ga0207657_10000949 3300025919 Bacteria 30720
198 Ga0207657_10005009 3300025919 Bacteria 13911
199 Ga0207657_10078655 3300025919 Bacteria 2776
200 Ga0207657_10205931 3300025919 Bacteria 1580
201 Ga0207687_10007684 3300025927 Bacteria 7082
202 Ga0207690_10014878 3300025932 Bacteria 4709
203 Ga0207706_10014749 3300025933 Bacteria 7075
204 Ga0207706_10015554 3300025933 Bacteria 6875
205 Ga0207706_10134537 3300025933 Bacteria 2174
206 Ga0207706_10232695 3300025933 Bacteria 1612
207 Ga0207686_10004829 3300025934 Bacteria 7241
208 Ga0207709_10000547 3300025935 Bacteria 32231
209 Ga0207669_10016205 3300025937 Bacteria 3781
210 Ga0207704_10000001 3300025938 Bacteria 716296
211 Ga0207691_10021769 3300025940 Bacteria 6051
212 Ga0207711_10000838 3300025941 Bacteria 29705
213 Ga0207711_10001460 3300025941 Bacteria 22085
214 Ga0207711_10014888 3300025941 Bacteria 6461
215 Ga0207711_10044378 3300025941 Bacteria 3795
216 Ga0207689_10001948 3300025942 Bacteria 19544
217 Ga0207667_10000109 3300025949 Bacteria 132054
218 Ga0207651_10000002 3300025960 Bacteria 427663
219 Ga0207712_10108887 3300025961 Bacteria 2074
220 Ga0207668_10000033 3300025972 Bacteria 121080
221 Ga0207668_10000647 3300025972 Bacteria 21409
222 Ga0207640_10000202 3300025981 Bacteria 42596
223 Ga0207658_10000022 3300025986 Bacteria 191235
224 Ga0207658_10016149 3300025986 Bacteria 5130
225 Ga0207677_10001269 3300026023 Bacteria 13574
226 Ga0207703_10000113 3300026035 Bacteria 96214
227 Ga0207639_10006534 3300026041 Bacteria 7929
228 Ga0207639_10028364 3300026041 Bacteria 4086
229 Ga0207639_10031492 3300026041 Bacteria 3899
230 Ga0207678_10315774 3300026067 Bacteria 1344
231 Ga0207641_10000139 3300026088 Bacteria 105740
232 Ga0207648_10000001 3300026089 Bacteria 427499
233 Ga0207676_10340742 3300026095 Bacteria 1383
234 Ga0207675_100000154 3300026118 Bacteria 60483
235 Ga0207683_10258433 3300026121 Bacteria 1590
236 Ga0207698_10000077 3300026142 Bacteria 65551
237 Ga0209813_10000180 3300027866 Bacteria 20487
238 Ga0209813_10000872 3300027866 Bacteria 6798
239 Ga0268266_10001064 3300028379 Bacteria 34416
240 Ga0268265_10004230 3300028380 Bacteria 10025
241 Ga0307515_10001181 3300028794 Bacteria 59747
242 Ga0307515_10027226 3300028794 Bacteria 9785
243 Ga0307515_10036427 3300028794 Bacteria 7958
244 Ga0307515_10077216 3300028794 Bacteria 4402
245 Ga0265338_10078372 3300028800 Bacteria 2787
246 Ga0307413_10056680 3300031824 Bacteria 2391
247 Ga0395899_0000004 3300037312 Bacteria 874267
248 Ga0395899_0002774 3300037312 Bacteria 14132
249 Ga0395900_0057711 3300037418 Bacteria 3997
250 Ga0395905_0089031 3300037471 Bacteria 2893
251 Ga0395905_0111990 3300037471 Bacteria 2563
252 Ga0436361_0211876 3300039447 Bacteria 15693
253 Ga0439436_0019842 3300041404 Bacteria 2004
254 Ga0439465_0008744 3300041413 Bacteria 3191
255 Ga0451806_171803 3300041462 Bacteria 1699
256 Ga0439431_0000643 3300041997 Bacteria 7429
257 Ga0439448_0007380 3300042005 Bacteria 3186
258 Ga0439448_0033139 3300042005 Bacteria 1647
259 Ga0439432_000868 3300042006 Bacteria 11320
260 Ga0439455_0004366 3300042012 Bacteria 2797
261 Ga0439455_0049004 3300042012 Bacteria 1099
262 Ga0439458_0000341 3300042157 Bacteria 11672
263 Ga0439458_0001444 3300042157 Bacteria 5980
264 Ga0439435_0013963 3300042436 Bacteria 1977
265 Ga0466969_0021314 3300044656 Bacteria 3351
266 Ga0466966_0011188 3300044684 Bacteria 5952
267 Ga0466961_0002957 3300044693 Bacteria 10556
268 Ga0466963_0174661 3300044694 Bacteria 1498
269 Ga0466971_0005983 3300044719 Bacteria 5293
270 Ga0466970_0053442 3300044765 Bacteria 2157
271 Ga0466959_0000280 3300045049 Bacteria 31145
272 Ga0466959_0098465 3300045049 Bacteria 2095
273 Ga0451576_0284798 3300045051 Bacteria 1728
274 Ga0466958_0008065 3300045836 Bacteria 5826
275 Ga0495627_000113 3300046453 Bacteria 100542
276 Ga0495627_001065 3300046453 Bacteria 18144
277 Ga0495590_0002574 3300046457 Bacteria 7496
278 Ga0495638_0000012 3300046460 Bacteria 435577
279 Ga0495638_0000892 3300046460 Bacteria 30611
280 Ga0495638_0001021 3300046460 Bacteria 27811
281 Ga0495638_0005532 3300046460 Bacteria 9374
282 Ga0495650_0000237 3300046471 Bacteria 110872
283 Ga0495650_0006604 3300046471 Bacteria 7201
284 Ga0495607_0057711 3300046501 Bacteria 2223
285 Ga0495583_0000001 3300046506 Bacteria 811973
286 Ga0495583_0001160 3300046506 Bacteria 28668
287 Ga0495606_0005233 3300046507 Bacteria 12524
288 Ga0495610_0000407 3300046512 Bacteria 44093
289 Ga0495610_0005272 3300046512 Bacteria 9247
290 Ga0495610_0028782 3300046512 Bacteria 2934
291 Ga0495616_0000109 3300046513 Bacteria 71495
292 Ga0495616_0000162 3300046513 Bacteria 58625
293 Ga0495620_0028407 3300046515 Bacteria 2601
294 Ga0495632_0000001 3300046519 Bacteria 873295
295 Ga0495632_0000773 3300046519 Bacteria 28703
296 Ga0495632_0008096 3300046519 Bacteria 6507
297 Ga0495637_0000809 3300046520 Bacteria 20718
298 Ga0495637_0018613 3300046520 Bacteria 3220
299 Ga0495643_0000006 3300046522 Bacteria 419524
300 Ga0495643_0052495 3300046522 Bacteria 2189
301 Ga0495648_0000295 3300046524 Bacteria 55574
302 Ga0495648_0001990 3300046524 Bacteria 19425
303 Ga0495648_0041808 3300046524 Bacteria 2891
304 Ga0495663_0000002 3300046525 Bacteria 495384
305 Ga0495654_0000249 3300046530 Bacteria 49711
306 Ga0495654_0005404 3300046530 Bacteria 7426
307 Ga0495609_0064419 3300046538 Bacteria 1617
308 Ga0495597_0047739 3300046542 Bacteria 1895
309 Ga0495633_0000053 3300046558 Bacteria 152374
310 Ga0495633_0000160 3300046558 Bacteria 88116
311 Ga0495633_0005525 3300046558 Bacteria 7696
312 Ga0495633_0019075 3300046558 Bacteria 3471
313 Ga0495668_0000037 3300046616 Bacteria 233981
314 Ga0495668_0026028 3300046616 Bacteria 3321
315 Ga0495625_0000143 3300046660 Bacteria 110121
316 Ga0495625_0007323 3300046660 Bacteria 9636
317 Ga0495625_0080372 3300046660 Bacteria 2270
318 Ga0495670_0000004 3300046691 Bacteria 310086
319 Ga0495671_0000008 3300046692 Bacteria 419524
320 Ga0495671_0000111 3300046692 Bacteria 72744
321 Ga0495589_0010961 3300046794 Bacteria 4706
322 Ga0495672_0001838 3300047320 Bacteria 20264
323 Ga0495679_022557 3300047446 Bacteria 2152
324 Ga0495673_0000013 3300047469 Bacteria 612902
325 Ga0495673_0000139 3300047469 Bacteria 130652
326 Ga0495673_0000156 3300047469 Bacteria 118831
327 Ga0495673_0003688 3300047469 Bacteria 9981
328 Ga0495681_0002650 3300047470 Bacteria 12688
329 Ga0495686_0000103 3300047472 Bacteria 176842
330 Ga0495686_0008083 3300047472 Bacteria 7783
331 Ga0495686_0012360 3300047472 Bacteria 5975
332 Ga0495686_0049988 3300047472 Bacteria 2628
333 Ga0495686_0213902 3300047472 Bacteria 1100
334 Ga0496102_0394321 3300048905 Bacteria 1302
335 Ga0496107_0004682 3300048910 Bacteria 9288
336 Ga0496111_0008505 3300048914 Bacteria 6798
337 Ga0496115_0003128 3300048918 Bacteria 11899
338 Ga0496117_0036372 3300048920 Bacteria 3685
339 Ga0496118_0007932 3300048921 Bacteria 11108
340 Ga0496118_0029840 3300048921 Bacteria 4564
341 Ga0496118_0038504 3300048921 Bacteria 3831
342 Ga0496119_0015637 3300048922 Bacteria 5825
343 Ga0496120_0071001 3300048923 Bacteria 1913
344 Ga0496121_0000272 3300048924 Bacteria 108051
345 Ga0496121_0003298 3300048924 Bacteria 23176
346 Ga0496121_0004371 3300048924 Bacteria 19103
347 Ga0496121_0005379 3300048924 Bacteria 16450
348 Ga0496121_0025027 3300048924 Bacteria 5684
349 Ga0496121_0063896 3300048924 Bacteria 3004
350 Ga0496123_0012290 3300048926 Bacteria 7316
351 Ga0496124_0007621 3300048927 Bacteria 11470
352 Ga0496124_0010185 3300048927 Bacteria 9561
353 Ga0496124_0126722 3300048927 Bacteria 2033
354 Ga0496125_0000953 3300048928 Bacteria 45480
355 Ga0496125_0004150 3300048928 Bacteria 16894
356 Ga0496125_0038735 3300048928 Bacteria 4118
357 Ga0496125_0216078 3300048928 Bacteria 1240
358 Ga0496126_0000733 3300048929 Bacteria 59621
359 Ga0495678_003643 3300049459 Bacteria 9359
360 Ga0501034_0003784 3300049571 Bacteria 17076
361 Ga0501034_0305381 3300049571 Bacteria 1527
362 Ga0501043_0257737 3300049579 Bacteria 1342
363 Ga0501211_003579 3300049658 Bacteria 1598
364 Ga0501223_000006 3300049663 Bacteria 133378
365 Ga0501235_000453 3300049669 Bacteria 8013
366 Ga0501246_000655 3300049676 Bacteria 2532
367 Ga0501225_0000032 3300049705 Bacteria 47166
368 nmdc:mga03683_1401_c1 3300050489 Bacteria 7178
369 nmdc:mga03n38_87624_c1 3300050490 Bacteria 1476
370 nmdc:mga00v17_2932_c1 3300050491 Bacteria 3259
371 nmdc:mga00v17_9340_c1 3300050491 Bacteria 5302
372 nmdc:mga0k408_110641_c1 3300050493 Bacteria 1624
373 nmdc:mga0k408_79126_c1 3300050493 Bacteria 1924
374 nmdc:mga06z11_100_c1 3300050494 Bacteria 36184
375 nmdc:mga04h51_11_c1 3300050495 Bacteria 101578
376 nmdc:mga04h51_181_c1 3300050495 Bacteria 17738
377 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
378 nmdc:mga07m45_163116_c1 3300050496 Bacteria 1294
379 nmdc:mga07m45_18591_c1 3300050496 Bacteria 2064
380 nmdc:mga07m45_29388_c1 3300050496 Bacteria 3039
381 nmdc:mga07m45_4041_c1 3300050496 Bacteria 7146
382 nmdc:mga0sz30_109_c1 3300050516 Bacteria 31084
383 Ga0500635_0000408 3300053080 Bacteria 12879
384 Ga0500578_0000023 3300053086 Bacteria 153470
385 Ga0500643_000098 3300053087 Bacteria 91878
386 Ga0500643_000110 3300053087 Bacteria 85114
387 Ga0500643_001047 3300053087 Bacteria 16790
388 Ga0500643_007636 3300053087 Bacteria 4333
389 Ga0500644_0000174 3300053088 Bacteria 41140
390 Ga0500646_0007632 3300053090 Bacteria 2764
391 Ga0500554_001270 3300053102 Bacteria 4890
392 Ga0500555_001428 3300053103 Bacteria 7329
393 Ga0500556_0001361 3300053104 Bacteria 10781
394 Ga0500592_000143 3300053116 Bacteria 14793
395 Ga0500594_0001447 3300053118 Bacteria 5154
396 Ga0500595_003892 3300053119 Bacteria 6851
397 Ga0500607_000065 3300053121 Bacteria 74437
398 Ga0500608_000276 3300053122 Bacteria 19915
399 Ga0500608_005116 3300053122 Bacteria 5167
400 Ga0500618_000305 3300053125 Bacteria 36613
401 Ga0500642_0148779 3300053130 Bacteria 1099
402 Ga0500559_0000007 3300053136 Bacteria 226236
403 Ga0500559_0000031 3300053136 Bacteria 114782
404 Ga0500559_0000668 3300053136 Bacteria 22938
405 Ga0500559_0002474 3300053136 Bacteria 9532
406 Ga0500559_0004363 3300053136 Bacteria 6740
407 Ga0500564_005036 3300053138 Bacteria 5363
408 Ga0500573_0000016 3300053140 Bacteria 182675
409 Ga0500604_0052938 3300053151 Bacteria 1257
410 Ga0500616_0034837 3300053153 Bacteria 2741
411 Ga0500616_0047096 3300053153 Bacteria 2290
412 Ga0500622_0003664 3300053156 Bacteria 10092
413 Ga0500622_0038553 3300053156 Bacteria 2492
414 Ga0500624_000018 3300053157 Bacteria 131677
415 Ga0500627_0000442 3300053158 Bacteria 11255
416 Ga0500627_0022815 3300053158 Bacteria 2543
417 Ga0500634_0158092 3300053161 Bacteria 1050
418 Ga0500637_0008072 3300053178 Bacteria 5289
419 Ga0500645_001900 3300053730 Bacteria 9932
420 Ga0500645_015614 3300053730 Bacteria 2404
421 Ga0500609_002319 3300053731 Bacteria 2717
422 Ga0466962_0006711 3300061719 Bacteria 5518
423 Ga0466962_0087607 3300061719 Bacteria 1491
424 Ga0466962_0130885 3300061719 Bacteria 1212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053161 Ga0500634_0158092 Ga0500634_0158092_11_934 300
2 3300042012 Ga0439455_0049004 Ga0439455_0049004_18_959 313
3 3300046522 Ga0495643_0052495 Ga0495643_0052495_1002_2051 327
4 3300037471 Ga0395905_0111990 Ga0395905_0111990_755_1822 329
5 3300044656 Ga0466969_0021314 Ga0466969_0021314_151_1200 329
6 3300044684 Ga0466966_0011188 Ga0466966_0011188_4769_5818 329
7 3300044693 Ga0466961_0002957 Ga0466961_0002957_8679_9728 329
8 3300044719 Ga0466971_0005983 Ga0466971_0005983_146_1195 329
9 3300044765 Ga0466970_0053442 Ga0466970_0053442_956_2005 329
10 3300045049 Ga0466959_0000280 Ga0466959_0000280_25455_26504 329
11 3300045836 Ga0466958_0008065 Ga0466958_0008065_4633_5682 329
12 3300061719 Ga0466962_0006711 Ga0466962_0006711_2312_3361 329
13 3300046524 Ga0495648_0041808 Ga0495648_0041808_932_1981 331
14 3300053080 Ga0500635_0000408 Ga0500635_0000408_11799_12842 334
15 3300053130 Ga0500642_0148779 Ga0500642_0148779_27_1049 338
16 3300015684 Ga0183365_10001 Ga0183365_100011513 339
17 3300045051 Ga0451576_0284798 Ga0451576_0284798_492_1535 339
18 3300049571 Ga0501034_0003784 Ga0501034_0003784_729_1772 339
19 3300049571 Ga0501034_0305381 Ga0501034_0305381_424_1467 339
20 3300053122 Ga0500608_005116 Ga0500608_005116_2051_3094 339
21 3300005842 Ga0068858_100000260 Ga0068858_10000026013 340
22 3300026035 Ga0207703_10000113 Ga0207703_1000011338 340
23 3300026121 Ga0207683_10258433 Ga0207683_102584332 340
24 iso_pu_bacteria 2599185359 2600224887 340
25 iso_pu_bacteria 2775507255 2778126990 340
26 iso_pu_bacteria 2830075706 2830076061 340
27 iso_pu_bacteria 2879163058 2879165674 340
28 iso_pu_bacteria 2928526807 2928527620 340
29 3300003781 Ga0055536_1000580 Ga0055536_100058015 341
30 3300003791 Ga0055530_10000017 Ga0055530_1000001750 341
31 3300003794 Ga0055531_10000129 Ga0055531_1000012922 341
32 3300005985 Ga0081539_10019079 Ga0081539_100190792 341
33 3300025291 Ga0209675_1000089 Ga0209675_100008975 341
34 3300025292 Ga0209676_1000212 Ga0209676_100021240 341
35 3300025298 Ga0209050_1000068 Ga0209050_100006895 341
36 3300025304 Ga0209257_1000193 Ga0209257_100019395 341
37 3300025304 Ga0209257_1008265 Ga0209257_10082655 341
38 3300025904 Ga0207647_10035726 Ga0207647_100357262 341
39 3300028800 Ga0265338_10078372 Ga0265338_100783722 341
40 3300053087 Ga0500643_001047 Ga0500643_001047_12910_13956 341
41 iso_pu_bacteria 2510917020 2511121174 341
42 iso_pu_bacteria 2512564014 2512644268 341
43 iso_pu_bacteria 2582581279 2585147395 341
44 iso_pu_bacteria 2582581280 2585155316 341
45 iso_pu_bacteria 2582581293 2585198879 341
46 iso_pu_bacteria 2643221545 2643748011 341
47 iso_pu_bacteria 2643221552 2643779119 341
48 iso_pu_bacteria 2643221583 2643923667 341
49 iso_pu_bacteria 2643221584 2643927684 341
50 iso_pu_bacteria 2643221598 2644001179 341
51 iso_pu_bacteria 2643221614 2644086125 341
52 iso_pu_bacteria 2643221661 2644345208 341
53 iso_pu_bacteria 2643221666 2644369482 341
54 iso_pu_bacteria 2643221691 2644508054 341
55 iso_pu_bacteria 2739367756 2739791768 341
56 iso_pu_bacteria 2791355048 2792458809 341
57 iso_pu_bacteria 2808606401 2809062646 341
58 iso_pu_bacteria 2808606404 2809078670 341
59 iso_pu_bacteria 2808606405 2809083035 341
60 iso_pu_bacteria 2818991435 2819540406 341
61 iso_pu_bacteria 2818991454 2819649534 341
62 iso_pu_bacteria 2843744320 2843747039 341
63 iso_pu_bacteria 2849560528 2849565447 341
64 iso_pu_bacteria 2849573788 2849575399 341
65 iso_pu_bacteria 2851153111 2851154838 341
66 iso_pu_bacteria 2880518877 2880521548 341
67 iso_pu_bacteria 2884960567 2884960812 341
68 iso_pu_bacteria 2885429604 2885432415 341
69 iso_pu_bacteria 2896429255 2896429586 341
70 iso_pu_bacteria 2898329390 2898333089 341
71 iso_pu_bacteria 2928027323 2928027491 341
72 iso_pu_bacteria 2941485952 2941488167 341
73 iso_pu_bacteria 2984555340 2984558208 341
74 iso_pu_bacteria 2984564862 2984567413 341
75 iso_pu_bacteria 2993356040 2993358478 341
76 3300005347 Ga0070668_100000923 Ga0070668_10000092313 342
77 3300005367 Ga0070667_100010837 Ga0070667_1000108376 342
78 3300005548 Ga0070665_100000767 Ga0070665_10000076742 342
79 3300005844 Ga0068862_100006887 Ga0068862_1000068875 342
80 3300009177 Ga0105248_10000315 Ga0105248_1000031532 342
81 3300009177 Ga0105248_10044023 Ga0105248_100440234 342
82 3300009177 Ga0105248_10066044 Ga0105248_100660443 342
83 3300025226 Ga0209674_106850 Ga0209674_1068501 342
84 3300025941 Ga0207711_10000838 Ga0207711_1000083820 342
85 3300025941 Ga0207711_10014888 Ga0207711_100148884 342
86 3300025941 Ga0207711_10044378 Ga0207711_100443782 342
87 3300025972 Ga0207668_10000033 Ga0207668_100000336 342
88 3300025986 Ga0207658_10016149 Ga0207658_100161493 342
89 3300028379 Ga0268266_10001064 Ga0268266_1000106431 342
90 3300028380 Ga0268265_10004230 Ga0268265_100042308 342
91 3300046501 Ga0495607_0057711 Ga0495607_0057711_899_1966 342
92 3300046530 Ga0495654_0005404 Ga0495654_0005404_3901_4950 342
93 3300047472 Ga0495686_0000103 Ga0495686_0000103_76915_77964 342
94 3300047472 Ga0495686_0213902 Ga0495686_0213902_22_1071 342
95 3300048924 Ga0496121_0000272 Ga0496121_0000272_85934_86986 342
96 3300048927 Ga0496124_0010185 Ga0496124_0010185_4694_5725 342
97 3300049579 Ga0501043_0257737 Ga0501043_0257737_201_1250 342
98 3300053087 Ga0500643_000110 Ga0500643_000110_78928_79977 342
99 3300053087 Ga0500643_007636 Ga0500643_007636_2491_3543 342
100 3300053116 Ga0500592_000143 Ga0500592_000143_8990_10039 342
101 3300053136 Ga0500559_0002474 Ga0500559_0002474_718_1767 342
102 3300053151 Ga0500604_0052938 Ga0500604_0052938_145_1194 342
103 3300053158 Ga0500627_0000442 Ga0500627_0000442_5883_6932 342
104 iso_pu_bacteria 2585428106 2587919278 342
105 iso_pu_bacteria 2643221640 2644225106 342
106 iso_pu_bacteria 2643221642 2644232414 342
107 iso_pu_bacteria 2848297114 2848298393 342
108 iso_pu_bacteria 2928531327 2928532970 342
109 3300005295 Ga0065707_10004435 Ga0065707_100044358 343
110 3300005335 Ga0070666_10027492 Ga0070666_100274922 343
111 3300005347 Ga0070668_100001054 Ga0070668_10000105413 343
112 3300005367 Ga0070667_100000024 Ga0070667_10000002489 343
113 3300005617 Ga0068859_100004856 Ga0068859_1000048564 343
114 3300005719 Ga0068861_100000036 Ga0068861_10000003623 343
115 3300005841 Ga0068863_100000082 Ga0068863_10000008214 343
116 3300005843 Ga0068860_100220937 Ga0068860_1002209371 343
117 3300006931 Ga0097620_100004857 Ga0097620_1000048574 343
118 3300009177 Ga0105248_10002271 Ga0105248_1000227115 343
119 3300009978 Ga0105148_100052 Ga0105148_10005218 343
120 3300014326 Ga0157380_10027469 Ga0157380_100274695 343
121 3300025941 Ga0207711_10001460 Ga0207711_100014605 343
122 3300025972 Ga0207668_10000647 Ga0207668_1000064713 343
123 3300025986 Ga0207658_10000022 Ga0207658_1000002291 343
124 3300026088 Ga0207641_10000139 Ga0207641_1000013990 343
125 3300026095 Ga0207676_10340742 Ga0207676_103407421 343
126 3300026118 Ga0207675_100000154 Ga0207675_10000015423 343
127 3300037471 Ga0395905_0089031 Ga0395905_0089031_1051_2115 343
128 3300046457 Ga0495590_0002574 Ga0495590_0002574_4548_5612 343
129 3300046471 Ga0495650_0006604 Ga0495650_0006604_3845_4915 343
130 3300048924 Ga0496121_0004371 Ga0496121_0004371_17442_18494 343
131 3300048927 Ga0496124_0007621 Ga0496124_0007621_8039_9106 343
132 3300049658 Ga0501211_003579 Ga0501211_003579_355_1395 343
133 3300049663 Ga0501223_000006 Ga0501223_000006_54420_55457 343
134 3300049669 Ga0501235_000453 Ga0501235_000453_10_1050 343
135 3300049676 Ga0501246_000655 Ga0501246_000655_1361_2398 343
136 3300049705 Ga0501225_0000032 Ga0501225_0000032_30212_31249 343
137 3300002774 JGI25150J39212_1000946 JGI25150J39212_10009468 344
138 3300003187 JGI25151J46595_10008598 JGI25151J46595_100085983 344
139 3300003215 JGI25153J46596_10000036 JGI25153J46596_100000368 344
140 3300003215 JGI25153J46596_10013839 JGI25153J46596_100138392 344
141 3300003771 Ga0055526_1006904 Ga0055526_10069042 344
142 3300003773 Ga0055537_1001008 Ga0055537_10010082 344
143 3300003773 Ga0055537_1006445 Ga0055537_10064452 344
144 3300003775 Ga0055524_1000351 Ga0055524_100035121 344
145 3300003775 Ga0055524_1014523 Ga0055524_10145231 344
146 3300003781 Ga0055536_1019001 Ga0055536_10190012 344
147 3300003792 Ga0055540_1000701 Ga0055540_10007017 344
148 3300003794 Ga0055531_10006456 Ga0055531_100064566 344
149 3300004625 Ga0055543_1015833 Ga0055543_10158331 344
150 3300005262 Ga0065165_1002946 Ga0065165_10029466 344
151 3300005578 Ga0068854_100052860 Ga0068854_1000528604 344
152 3300005983 Ga0081540_1042864 Ga0081540_10428642 344
153 3300009093 Ga0105240_10009750 Ga0105240_100097507 344
154 3300009545 Ga0105237_10002575 Ga0105237_100025752 344
155 3300010375 Ga0105239_10000131 Ga0105239_1000013193 344
156 3300017792 Ga0163161_10203205 Ga0163161_102032051 344
157 3300025229 Ga0209147_101472 Ga0209147_1014725 344
158 3300025245 Ga0207425_1000037 Ga0207425_1000037146 344
159 3300025258 Ga0209129_1014866 Ga0209129_10148662 344
160 3300025263 Ga0209565_1000012 Ga0209565_1000012140 344
161 3300025263 Ga0209565_1000314 Ga0209565_100031418 344
162 3300025273 Ga0209673_1008474 Ga0209673_10084742 344
163 3300025291 Ga0209675_1013585 Ga0209675_10135852 344
164 3300025292 Ga0209676_1019332 Ga0209676_10193322 344
165 3300025294 Ga0209025_1000117 Ga0209025_100011726 344
166 3300025295 Ga0209564_1002594 Ga0209564_10025941 344
167 3300025295 Ga0209564_1007705 Ga0209564_10077051 344
168 3300025297 Ga0209758_1000103 Ga0209758_1000103146 344
169 3300025297 Ga0209758_1014215 Ga0209758_10142152 344
170 3300025298 Ga0209050_1000001 Ga0209050_10000013300 344
171 3300025298 Ga0209050_1005775 Ga0209050_10057753 344
172 3300025298 Ga0209050_1006599 Ga0209050_10065994 344
173 3300025298 Ga0209050_1009072 Ga0209050_10090725 344
174 3300025299 Ga0209256_1000012 Ga0209256_1000012331 344
175 3300025303 Ga0209051_1000296 Ga0209051_100029637 344
176 3300025304 Ga0209257_1002098 Ga0209257_10020988 344
177 3300025304 Ga0209257_1002149 Ga0209257_10021498 344
178 3300025304 Ga0209257_1002618 Ga0209257_10026183 344
179 3300025304 Ga0209257_1008681 Ga0209257_10086814 344
180 3300025913 Ga0207695_10027218 Ga0207695_100272182 344
181 3300025914 Ga0207671_10001065 Ga0207671_100010652 344
182 3300031824 Ga0307413_10056680 Ga0307413_100566802 344
183 3300041404 Ga0439436_0019842 Ga0439436_0019842_919_1956 344
184 3300041413 Ga0439465_0008744 Ga0439465_0008744_972_2009 344
185 3300041997 Ga0439431_0000643 Ga0439431_0000643_1949_2986 344
186 3300042006 Ga0439432_000868 Ga0439432_000868_5058_6095 344
187 3300046453 Ga0495627_000113 Ga0495627_000113_28425_29462 344
188 3300046524 Ga0495648_0001990 Ga0495648_0001990_14887_15924 344
189 3300046691 Ga0495670_0000004 Ga0495670_0000004_34386_35423 344
190 3300048914 Ga0496111_0008505 Ga0496111_0008505_4794_5831 344
191 3300048918 Ga0496115_0003128 Ga0496115_0003128_5338_6375 344
192 3300048920 Ga0496117_0036372 Ga0496117_0036372_674_1732 344
193 3300048924 Ga0496121_0003298 Ga0496121_0003298_1464_2498 344
194 3300048927 Ga0496124_0126722 Ga0496124_0126722_874_1911 344
195 3300053119 Ga0500595_003892 Ga0500595_003892_5755_6801 344
196 3300053140 Ga0500573_0000016 Ga0500573_0000016_138302_139366 344
197 3300053153 Ga0500616_0047096 Ga0500616_0047096_655_1713 344
198 iso_pu_bacteria 2599185354 2600201677 344
199 iso_pu_bacteria 2857504554 2857507500 344
200 iso_pu_bacteria 2946787523 2946788639 344
201 3300001989 JGI24739J22299_10014357 JGI24739J22299_100143575 345
202 3300001990 JGI24737J22298_10001020 JGI24737J22298_100010201 345
203 3300001990 JGI24737J22298_10039714 JGI24737J22298_100397142 345
204 3300002067 JGI24735J21928_10000344 JGI24735J21928_100003441 345
205 3300002075 JGI24738J21930_10000317 JGI24738J21930_100003171 345
206 3300003773 Ga0055537_1004951 Ga0055537_10049511 345
207 3300003775 Ga0055524_1009750 Ga0055524_10097505 345
208 3300003781 Ga0055536_1001430 Ga0055536_10014307 345
209 3300003790 Ga0055528_1018686 Ga0055528_10186862 345
210 3300003791 Ga0055530_10000144 Ga0055530_100001444 345
211 3300003791 Ga0055530_10002385 Ga0055530_100023857 345
212 3300003791 Ga0055530_10003953 Ga0055530_100039536 345
213 3300003794 Ga0055531_10000188 Ga0055531_1000018818 345
214 3300003794 Ga0055531_10002101 Ga0055531_100021019 345
215 3300003794 Ga0055531_10011261 Ga0055531_100112612 345
216 3300005262 Ga0065165_1001046 Ga0065165_10010462 345
217 3300005457 Ga0070662_100032500 Ga0070662_1000325004 345
218 3300005457 Ga0070662_100037789 Ga0070662_1000377894 345
219 3300006042 Ga0075368_10000225 Ga0075368_100002255 345
220 3300006353 Ga0075370_10002969 Ga0075370_100029692 345
221 3300013100 Ga0157373_10130270 Ga0157373_101302702 345
222 3300013105 Ga0157369_10103977 Ga0157369_101039773 345
223 3300013307 Ga0157372_10094385 Ga0157372_100943852 345
224 3300015690 Ga0183363_1003 Ga0183363_1003380 345
225 3300021361 Ga0213872_10004938 Ga0213872_100049382 345
226 3300025263 Ga0209565_1000118 Ga0209565_100011849 345
227 3300025273 Ga0209673_1012955 Ga0209673_10129553 345
228 3300025291 Ga0209675_1002824 Ga0209675_10028244 345
229 3300025292 Ga0209676_1000128 Ga0209676_100012868 345
230 3300025292 Ga0209676_1000151 Ga0209676_100015180 345
231 3300025295 Ga0209564_1004400 Ga0209564_10044003 345
232 3300025295 Ga0209564_1010025 Ga0209564_10100252 345
233 3300025297 Ga0209758_1002847 Ga0209758_10028472 345
234 3300025297 Ga0209758_1005117 Ga0209758_10051177 345
235 3300025298 Ga0209050_1000010 Ga0209050_1000010206 345
236 3300025298 Ga0209050_1000817 Ga0209050_100081717 345
237 3300025298 Ga0209050_1001306 Ga0209050_10013067 345
238 3300025299 Ga0209256_1004048 Ga0209256_10040488 345
239 3300025299 Ga0209256_1006244 Ga0209256_10062447 345
240 3300025299 Ga0209256_1010053 Ga0209256_10100531 345
241 3300025303 Ga0209051_1001480 Ga0209051_100148014 345
242 3300025304 Ga0209257_1000009 Ga0209257_1000009909 345
243 3300025304 Ga0209257_1000140 Ga0209257_1000140195 345
244 3300025304 Ga0209257_1006971 Ga0209257_10069717 345
245 3300025304 Ga0209257_1007742 Ga0209257_10077422 345
246 3300025904 Ga0207647_10000788 Ga0207647_1000078819 345
247 3300025904 Ga0207647_10001451 Ga0207647_1000145121 345
248 3300025919 Ga0207657_10205931 Ga0207657_102059312 345
249 3300025932 Ga0207690_10014878 Ga0207690_100148785 345
250 3300025933 Ga0207706_10014749 Ga0207706_100147492 345
251 3300025933 Ga0207706_10015554 Ga0207706_100155542 345
252 3300026041 Ga0207639_10028364 Ga0207639_100283646 345
253 3300026067 Ga0207678_10315774 Ga0207678_103157741 345
254 3300027866 Ga0209813_10000180 Ga0209813_100001807 345
255 3300028794 Ga0307515_10001181 Ga0307515_100011817 345
256 3300028794 Ga0307515_10027226 Ga0307515_100272262 345
257 3300028794 Ga0307515_10036427 Ga0307515_100364272 345
258 3300028794 Ga0307515_10077216 Ga0307515_100772162 345
259 3300037312 Ga0395899_0000004 Ga0395899_0000004_21035_22105 345
260 3300039447 Ga0436361_0211876 Ga0436361_0211876_4871_5941 345
261 3300042005 Ga0439448_0007380 Ga0439448_0007380_413_1450 345
262 3300042012 Ga0439455_0004366 Ga0439455_0004366_114_1151 345
263 3300042157 Ga0439458_0000341 Ga0439458_0000341_10576_11613 345
264 3300042436 Ga0439435_0013963 Ga0439435_0013963_545_1606 345
265 3300045049 Ga0466959_0098465 Ga0466959_0098465_223_1293 345
266 3300046453 Ga0495627_001065 Ga0495627_001065_12153_13214 345
267 3300046460 Ga0495638_0000012 Ga0495638_0000012_229983_231026 345
268 3300046460 Ga0495638_0000892 Ga0495638_0000892_14883_15953 345
269 3300046460 Ga0495638_0001021 Ga0495638_0001021_2491_3564 345
270 3300046460 Ga0495638_0005532 Ga0495638_0005532_3949_5010 345
271 3300046471 Ga0495650_0000237 Ga0495650_0000237_19574_20635 345
272 3300046506 Ga0495583_0000001 Ga0495583_0000001_726980_728041 345
273 3300046506 Ga0495583_0001160 Ga0495583_0001160_21734_22777 345
274 3300046507 Ga0495606_0005233 Ga0495606_0005233_4924_5985 345
275 3300046512 Ga0495610_0000407 Ga0495610_0000407_21623_22684 345
276 3300046512 Ga0495610_0005272 Ga0495610_0005272_2246_3307 345
277 3300046512 Ga0495610_0028782 Ga0495610_0028782_102_1142 345
278 3300046513 Ga0495616_0000109 Ga0495616_0000109_4797_5858 345
279 3300046513 Ga0495616_0000162 Ga0495616_0000162_2100_3164 345
280 3300046515 Ga0495620_0028407 Ga0495620_0028407_379_1440 345
281 3300046519 Ga0495632_0000001 Ga0495632_0000001_361802_362848 345
282 3300046519 Ga0495632_0000773 Ga0495632_0000773_21616_22659 345
283 3300046519 Ga0495632_0008096 Ga0495632_0008096_1231_2292 345
284 3300046520 Ga0495637_0000809 Ga0495637_0000809_9147_10193 345
285 3300046520 Ga0495637_0018613 Ga0495637_0018613_755_1816 345
286 3300046522 Ga0495643_0000006 Ga0495643_0000006_51962_53008 345
287 3300046524 Ga0495648_0000295 Ga0495648_0000295_21749_22792 345
288 3300046525 Ga0495663_0000002 Ga0495663_0000002_360132_361178 345
289 3300046530 Ga0495654_0000249 Ga0495654_0000249_30292_31353 345
290 3300046538 Ga0495609_0064419 Ga0495609_0064419_315_1376 345
291 3300046542 Ga0495597_0047739 Ga0495597_0047739_329_1405 345
292 3300046558 Ga0495633_0000053 Ga0495633_0000053_37084_38130 345
293 3300046558 Ga0495633_0000160 Ga0495633_0000160_69703_70749 345
294 3300046558 Ga0495633_0005525 Ga0495633_0005525_2375_3418 345
295 3300046558 Ga0495633_0019075 Ga0495633_0019075_1623_2663 345
296 3300046616 Ga0495668_0000037 Ga0495668_0000037_142600_143661 345
297 3300046616 Ga0495668_0026028 Ga0495668_0026028_965_2041 345
298 3300046660 Ga0495625_0000143 Ga0495625_0000143_101253_102314 345
299 3300046660 Ga0495625_0007323 Ga0495625_0007323_5498_6559 345
300 3300046660 Ga0495625_0080372 Ga0495625_0080372_114_1175 345
301 3300046692 Ga0495671_0000008 Ga0495671_0000008_51962_53008 345
302 3300046692 Ga0495671_0000111 Ga0495671_0000111_38367_39410 345
303 3300046794 Ga0495589_0010961 Ga0495589_0010961_3345_4406 345
304 3300047446 Ga0495679_022557 Ga0495679_022557_413_1474 345
305 3300047469 Ga0495673_0000013 Ga0495673_0000013_33326_34369 345
306 3300047469 Ga0495673_0000139 Ga0495673_0000139_122424_123485 345
307 3300047469 Ga0495673_0000156 Ga0495673_0000156_22465_23526 345
308 3300047469 Ga0495673_0003688 Ga0495673_0003688_4135_5196 345
309 3300047470 Ga0495681_0002650 Ga0495681_0002650_2701_3747 345
310 3300047472 Ga0495686_0008083 Ga0495686_0008083_1861_2931 345
311 3300047472 Ga0495686_0012360 Ga0495686_0012360_4140_5186 345
312 3300047472 Ga0495686_0049988 Ga0495686_0049988_1470_2531 345
313 3300048910 Ga0496107_0004682 Ga0496107_0004682_4219_5280 345
314 3300048921 Ga0496118_0029840 Ga0496118_0029840_2436_3479 345
315 3300048924 Ga0496121_0005379 Ga0496121_0005379_14812_15873 345
316 3300048928 Ga0496125_0000953 Ga0496125_0000953_337_1407 345
317 3300048928 Ga0496125_0004150 Ga0496125_0004150_1923_2999 345
318 3300048928 Ga0496125_0216078 Ga0496125_0216078_150_1220 345
319 3300048929 Ga0496126_0000733 Ga0496126_0000733_53934_55010 345
320 3300049459 Ga0495678_003643 Ga0495678_003643_3810_4880 345
321 3300050493 nmdc:mga0k408_79126_c1 nmdc:mga0k408_79126_c1_203_1276 345
322 3300050495 nmdc:mga04h51_11_c1 nmdc:mga04h51_11_c1_4453_5589 345
323 3300050496 nmdc:mga07m45_29388_c1 nmdc:mga07m45_29388_c1_784_1824 345
324 3300053086 Ga0500578_0000023 Ga0500578_0000023_140263_141333 345
325 3300053087 Ga0500643_000098 Ga0500643_000098_37195_38235 345
326 3300053088 Ga0500644_0000174 Ga0500644_0000174_8359_9420 345
327 3300053090 Ga0500646_0007632 Ga0500646_0007632_712_1749 345
328 3300053102 Ga0500554_001270 Ga0500554_001270_40_1101 345
329 3300053103 Ga0500555_001428 Ga0500555_001428_3120_4157 345
330 3300053104 Ga0500556_0001361 Ga0500556_0001361_4463_5524 345
331 3300053118 Ga0500594_0001447 Ga0500594_0001447_85_1155 345
332 3300053122 Ga0500608_000276 Ga0500608_000276_8205_9266 345
333 3300053125 Ga0500618_000305 Ga0500618_000305_23149_24210 345
334 3300053136 Ga0500559_0000007 Ga0500559_0000007_54819_55880 345
335 3300053136 Ga0500559_0000031 Ga0500559_0000031_29639_30700 345
336 3300053136 Ga0500559_0004363 Ga0500559_0004363_2343_3404 345
337 3300053138 Ga0500564_005036 Ga0500564_005036_2389_3450 345
338 3300053153 Ga0500616_0034837 Ga0500616_0034837_27_1088 345
339 3300053156 Ga0500622_0003664 Ga0500622_0003664_7205_8275 345
340 3300053156 Ga0500622_0038553 Ga0500622_0038553_263_1327 345
341 3300053157 Ga0500624_000018 Ga0500624_000018_52926_53966 345
342 3300053158 Ga0500627_0022815 Ga0500627_0022815_164_1225 345
343 3300053730 Ga0500645_001900 Ga0500645_001900_2467_3528 345
344 3300053731 Ga0500609_002319 Ga0500609_002319_1568_2629 345
345 iso_pu_bacteria 2751185897 2753767903 345
346 3300001979 JGI24740J21852_10010391 JGI24740J21852_100103913 346
347 3300001990 JGI24737J22298_10001106 JGI24737J22298_100011069 346
348 3300002067 JGI24735J21928_10018710 JGI24735J21928_100187102 346
349 3300002067 JGI24735J21928_10035210 JGI24735J21928_100352101 346
350 3300002075 JGI24738J21930_10002550 JGI24738J21930_100025507 346
351 3300003214 JGI25165J46597_1000145 JGI25165J46597_1000145103 346
352 3300003762 Ga0055542_1003517 Ga0055542_10035176 346
353 3300005327 Ga0070658_10000082 Ga0070658_100000829 346
354 3300005327 Ga0070658_10008508 Ga0070658_1000850810 346
355 3300005327 Ga0070658_10022356 Ga0070658_100223566 346
356 3300005327 Ga0070658_10312622 Ga0070658_103126221 346
357 3300005328 Ga0070676_10008767 Ga0070676_100087672 346
358 3300005334 Ga0068869_100001291 Ga0068869_1000012915 346
359 3300005338 Ga0068868_100003545 Ga0068868_1000035458 346
360 3300005339 Ga0070660_100000641 Ga0070660_1000006416 346
361 3300005339 Ga0070660_100002098 Ga0070660_1000020989 346
362 3300005356 Ga0070674_100060625 Ga0070674_1000606252 346
363 3300005364 Ga0070673_100000003 Ga0070673_10000000369 346
364 3300005455 Ga0070663_100002030 Ga0070663_10000203014 346
365 3300005459 Ga0068867_100000001 Ga0068867_10000000195 346
366 3300005539 Ga0068853_100009163 Ga0068853_1000091636 346
367 3300005547 Ga0070693_100090451 Ga0070693_1000904512 346
368 3300005563 Ga0068855_100000273 Ga0068855_10000027355 346
369 3300005563 Ga0068855_100208631 Ga0068855_1002086314 346
370 3300005578 Ga0068854_100000559 Ga0068854_1000005592 346
371 3300005614 Ga0068856_100029115 Ga0068856_1000291153 346
372 3300005616 Ga0068852_100013658 Ga0068852_1000136586 346
373 3300005718 Ga0068866_10054116 Ga0068866_100541161 346
374 3300006042 Ga0075368_10000346 Ga0075368_100003462 346
375 3300006048 Ga0075363_100025234 Ga0075363_1000252342 346
376 3300006051 Ga0075364_10040294 Ga0075364_100402942 346
377 3300006177 Ga0075362_10007630 Ga0075362_100076302 346
378 3300006178 Ga0075367_10001261 Ga0075367_100012615 346
379 3300006186 Ga0075369_10039279 Ga0075369_100392792 346
380 3300006237 Ga0097621_100037492 Ga0097621_1000374925 346
381 3300006353 Ga0075370_10008165 Ga0075370_100081651 346
382 3300006353 Ga0075370_10029084 Ga0075370_100290842 346
383 3300006353 Ga0075370_10065936 Ga0075370_100659362 346
384 3300006881 Ga0068865_100000306 Ga0068865_1000003067 346
385 3300009098 Ga0105245_10002236 Ga0105245_1000223615 346
386 3300009148 Ga0105243_10000042 Ga0105243_1000004298 346
387 3300009174 Ga0105241_10009470 Ga0105241_100094707 346
388 3300009176 Ga0105242_10004833 Ga0105242_1000483313 346
389 3300009545 Ga0105237_10270715 Ga0105237_102707151 346
390 3300009553 Ga0105249_10183191 Ga0105249_101831911 346
391 3300010375 Ga0105239_10011679 Ga0105239_100116798 346
392 3300011119 Ga0105246_10008547 Ga0105246_100085474 346
393 3300013104 Ga0157370_10000008 Ga0157370_10000008133 346
394 3300013105 Ga0157369_10011793 Ga0157369_1001179312 346
395 3300013105 Ga0157369_10285306 Ga0157369_102853061 346
396 3300013296 Ga0157374_10014130 Ga0157374_100141305 346
397 3300013296 Ga0157374_10075852 Ga0157374_100758522 346
398 3300013297 Ga0157378_10011556 Ga0157378_100115567 346
399 3300013307 Ga0157372_10027326 Ga0157372_100273265 346
400 3300013308 Ga0157375_10001871 Ga0157375_100018712 346
401 3300014969 Ga0157376_10000072 Ga0157376_1000007235 346
402 3300025231 Ga0207427_100395 Ga0207427_10039526 346
403 3300025250 Ga0209026_1001380 Ga0209026_10013809 346
404 3300025254 Ga0209148_1000441 Ga0209148_10004416 346
405 3300025254 Ga0209148_1004388 Ga0209148_10043885 346
406 3300025261 Ga0209233_1000207 Ga0209233_100020732 346
407 3300025272 Ga0209455_1000772 Ga0209455_100077223 346
408 3300025903 Ga0207680_10045798 Ga0207680_100457984 346
409 3300025904 Ga0207647_10022355 Ga0207647_100223553 346
410 3300025907 Ga0207645_10000454 Ga0207645_1000045429 346
411 3300025909 Ga0207705_10000027 Ga0207705_1000002743 346
412 3300025909 Ga0207705_10000256 Ga0207705_100002569 346
413 3300025909 Ga0207705_10002705 Ga0207705_100027054 346
414 3300025909 Ga0207705_10191742 Ga0207705_101917422 346
415 3300025913 Ga0207695_10073539 Ga0207695_100735392 346
416 3300025914 Ga0207671_10161648 Ga0207671_101616481 346
417 3300025914 Ga0207671_10173240 Ga0207671_101732402 346
418 3300025919 Ga0207657_10000949 Ga0207657_100009496 346
419 3300025919 Ga0207657_10005009 Ga0207657_100050099 346
420 3300025919 Ga0207657_10078655 Ga0207657_100786552 346
421 3300025927 Ga0207687_10007684 Ga0207687_100076845 346
422 3300025933 Ga0207706_10134537 Ga0207706_101345374 346
423 3300025933 Ga0207706_10232695 Ga0207706_102326951 346
424 3300025934 Ga0207686_10004829 Ga0207686_100048291 346
425 3300025935 Ga0207709_10000547 Ga0207709_1000054722 346
426 3300025937 Ga0207669_10016205 Ga0207669_100162052 346
427 3300025938 Ga0207704_10000001 Ga0207704_10000001686 346
428 3300025940 Ga0207691_10021769 Ga0207691_100217695 346
429 3300025942 Ga0207689_10001948 Ga0207689_1000194815 346
430 3300025949 Ga0207667_10000109 Ga0207667_1000010992 346
431 3300025960 Ga0207651_10000002 Ga0207651_10000002355 346
432 3300025961 Ga0207712_10108887 Ga0207712_101088871 346
433 3300025981 Ga0207640_10000202 Ga0207640_1000020221 346
434 3300026023 Ga0207677_10001269 Ga0207677_100012692 346
435 3300026041 Ga0207639_10006534 Ga0207639_100065346 346
436 3300026041 Ga0207639_10031492 Ga0207639_100314924 346
437 3300026089 Ga0207648_10000001 Ga0207648_10000001355 346
438 3300026142 Ga0207698_10000077 Ga0207698_1000007720 346
439 3300027866 Ga0209813_10000872 Ga0209813_100008722 346
440 3300037312 Ga0395899_0002774 Ga0395899_0002774_5486_6526 346
441 3300037418 Ga0395900_0057711 Ga0395900_0057711_2137_3177 346
442 3300041462 Ga0451806_171803 Ga0451806_171803_494_1549 346
443 3300042005 Ga0439448_0033139 Ga0439448_0033139_163_1203 346
444 3300042157 Ga0439458_0001444 Ga0439458_0001444_1405_2445 346
445 3300044694 Ga0466963_0174661 Ga0466963_0174661_405_1445 346
446 3300047320 Ga0495672_0001838 Ga0495672_0001838_4202_5275 346
447 3300048905 Ga0496102_0394321 Ga0496102_0394321_34_1074 346
448 3300048921 Ga0496118_0007932 Ga0496118_0007932_6679_7719 346
449 3300048921 Ga0496118_0038504 Ga0496118_0038504_1893_2945 346
450 3300048922 Ga0496119_0015637 Ga0496119_0015637_2777_3817 346
451 3300048923 Ga0496120_0071001 Ga0496120_0071001_50_1090 346
452 3300048924 Ga0496121_0025027 Ga0496121_0025027_4583_5623 346
453 3300048924 Ga0496121_0063896 Ga0496121_0063896_86_1138 346
454 3300048926 Ga0496123_0012290 Ga0496123_0012290_925_1977 346
455 3300048928 Ga0496125_0038735 Ga0496125_0038735_1106_2146 346
456 3300050489 nmdc:mga03683_1401_c1 nmdc:mga03683_1401_c1_436_1491 346
457 3300050490 nmdc:mga03n38_87624_c1 nmdc:mga03n38_87624_c1_51_1106 346
458 3300050491 nmdc:mga00v17_2932_c1 nmdc:mga00v17_2932_c1_535_1590 346
459 3300050491 nmdc:mga00v17_9340_c1 nmdc:mga00v17_9340_c1_3762_4817 346
460 3300050493 nmdc:mga0k408_110641_c1 nmdc:mga0k408_110641_c1_120_1175 346
461 3300050494 nmdc:mga06z11_100_c1 nmdc:mga06z11_100_c1_11365_12420 346
462 3300050495 nmdc:mga04h51_181_c1 nmdc:mga04h51_181_c1_14828_15883 346
463 3300050496 nmdc:mga07m45_15_c1 nmdc:mga07m45_15_c1_92371_93426 346
464 3300050496 nmdc:mga07m45_163116_c1 nmdc:mga07m45_163116_c1_200_1240 346
465 3300050496 nmdc:mga07m45_18591_c1 nmdc:mga07m45_18591_c1_377_1432 346
466 3300050496 nmdc:mga07m45_4041_c1 nmdc:mga07m45_4041_c1_5981_7048 346
467 3300050516 nmdc:mga0sz30_109_c1 nmdc:mga0sz30_109_c1_29565_30620 346
468 3300053121 Ga0500607_000065 Ga0500607_000065_43425_44492 346
469 3300053136 Ga0500559_0000668 Ga0500559_0000668_14900_15967 346
470 3300053178 Ga0500637_0008072 Ga0500637_0008072_786_1853 346
471 3300053730 Ga0500645_015614 Ga0500645_015614_821_1888 346
472 3300061719 Ga0466962_0087607 Ga0466962_0087607_89_1129 346
473 3300061719 Ga0466962_0130885 Ga0466962_0130885_91_1131 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14696

Glyoxalase_5

Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal

5

126

0.98

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

145

258

0.93

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

131

255

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cjx-assembly1.cif.gz_D crystal structure of pseudomonas fluorescens hppd 0.9063 7 343
7xnt-assembly1.cif.gz_G crystal structure of pfhppd-y13161 complex 0.8873 7 331
1cjx-assembly1.cif.gz_D crystal structure of pseudomonas fluorescens hppd 0.8813 7 343
2r5v-assembly1.cif.gz_A hydroxymandelate synthase crystal structure 0.8797 10 337
7xnt-assembly1.cif.gz_C crystal structure of pfhppd-y13161 complex 0.8752 7 331
ID Description Score Start End Superfamily
1cjxC02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9117 147 343 3.10.180.10
1cjxD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9048 7 136 3.10.180.10
1cjxC02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8862 147 343 3.10.180.10
3zgjA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8746 150 336 3.10.180.10
3zgjA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8568 150 336 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A519NUF8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9866 1 99 GO:0051213
AF-A0A528B2G0-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9702 2 78
AF-A0A4Q3APR0-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) 0.9697 2 317 GO:0003868
GO:0006572
GO:0046872
AF-A0A227J1H3-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9687 237 324 GO:0003868
GO:0006572
AF-A0A519NUF8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9673 1 99 GO:0051213

Feature Viewer

pLDDT pTM Quality
85.56 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map