F451022

General Info

Members Datasets Scaffolds Average Seq Length
473 253 946 93

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_11547309|Ga0207686_115473091
Length 102
Sequence VNRDGGQFDALLETLAGLAAANIVLVETLHEHRVLDKTHFAHAFGRALDGLSPEHRGGMIEHVLRNLRDRCMNLRGGADSDAQEWLRRKRGVEEPAGVPATV

Samples

Sample ID Description Type Environment
1 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
82 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.21
Rhizosphere 99.58
Stem 0
Stem Tuber 0
Unclassified 6.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207686_11547309 3300025934 Bacteria 547
2 JGI25406J46586_10023506 3300003203 Bacteria 2434
3 JGI26131J50246_103471 3300003400 Bacteria 526
4 Ga0065707_10023276 3300005295 Bacteria 1318
5 Ga0065707_10202229 3300005295 Unclassified 1305
6 Ga0070690_100032215 3300005330 Bacteria 3272
7 Ga0070690_100436843 3300005330 Bacteria 968
8 Ga0070690_100883339 3300005330 Bacteria 698
9 Ga0070670_101434805 3300005331 Unclassified 633
10 Ga0068869_100001704 3300005334 Bacteria 13134
11 Ga0068869_100449511 3300005334 Bacteria 1068
12 Ga0070680_100033607 3300005336 Bacteria 4135
13 Ga0070680_100125265 3300005336 Bacteria 2147
14 Ga0068868_100001119 3300005338 Bacteria 18328
15 Ga0070689_100028513 3300005340 Bacteria 4220
16 Ga0070689_100048534 3300005340 Bacteria 3274
17 Ga0070689_100115705 3300005340 Bacteria 2138
18 Ga0070689_100248305 3300005340 Bacteria 1468
19 Ga0070691_10026967 3300005341 Bacteria 2679
20 Ga0070691_10045842 3300005341 Bacteria 2075
21 Ga0070691_10641956 3300005341 Bacteria 631
22 Ga0070687_100000821 3300005343 Bacteria 10354
23 Ga0070687_100445742 3300005343 Bacteria 860
24 Ga0070687_101535385 3300005343 Bacteria 502
25 Ga0070692_10007031 3300005345 Bacteria 4933
26 Ga0070692_10419962 3300005345 Bacteria 849
27 Ga0070669_100928911 3300005353 Bacteria 744
28 Ga0070675_100759361 3300005354 Bacteria 885
29 Ga0070671_100027938 3300005355 Bacteria 4645
30 Ga0070671_100879797 3300005355 Bacteria 782
31 Ga0070674_102053657 3300005356 Bacteria 521
32 Ga0070673_100237053 3300005364 Bacteria 1585
33 Ga0070673_100438354 3300005364 Bacteria 1174
34 Ga0070673_100697379 3300005364 Bacteria 932
35 Ga0070688_100061820 3300005365 Bacteria 2369
36 Ga0070688_100431873 3300005365 Bacteria 981
37 Ga0070703_10009891 3300005406 Bacteria 2690
38 Ga0070714_100586473 3300005435 Bacteria 1069
39 Ga0070701_10002695 3300005438 Bacteria 6886
40 Ga0070701_10091066 3300005438 Bacteria 1671
41 Ga0070705_100061340 3300005440 Bacteria 2234
42 Ga0070705_100157994 3300005440 Bacteria 1512
43 Ga0070705_100372086 3300005440 Bacteria 1049
44 Ga0070705_100467622 3300005440 Bacteria 950
45 Ga0070705_100607200 3300005440 Bacteria 847
46 Ga0070705_101939360 3300005440 Bacteria 502
47 Ga0070700_100008844 3300005441 Bacteria 5502
48 Ga0070700_101307144 3300005441 Bacteria 610
49 Ga0070700_101521912 3300005441 Bacteria 569
50 Ga0070694_100004096 3300005444 Bacteria 8749
51 Ga0070694_100036037 3300005444 Bacteria 3274
52 Ga0070694_100297837 3300005444 Bacteria 1235
53 Ga0070694_100693338 3300005444 Bacteria 828
54 Ga0070694_101387020 3300005444 Unclassified 593
55 Ga0070708_100487462 3300005445 Bacteria 1163
56 Ga0070678_100516682 3300005456 Unclassified 1056
57 Ga0070681_10000720 3300005458 Bacteria 27395
58 Ga0070681_10029082 3300005458 Bacteria 5548
59 Ga0068867_100014406 3300005459 Bacteria 5603
60 Ga0070685_11097077 3300005466 Bacteria 601
61 Ga0070707_100717093 3300005468 Bacteria 963
62 Ga0070679_100027903 3300005530 Bacteria 5562
63 Ga0070679_100191674 3300005530 Bacteria 2013
64 Ga0070679_102082523 3300005530 Bacteria 517
65 Ga0070679_102195724 3300005530 Unclassified 502
66 Ga0070697_100150276 3300005536 Bacteria 1963
67 Ga0070697_100157662 3300005536 Bacteria 1917
68 Ga0070697_100633881 3300005536 Bacteria 941
69 Ga0070686_100007268 3300005544 Bacteria 6171
70 Ga0070686_100196042 3300005544 Bacteria 1444
71 Ga0070686_100418944 3300005544 Bacteria 1022
72 Ga0070695_100014536 3300005545 Bacteria 4746
73 Ga0070695_100029509 3300005545 Bacteria 3408
74 Ga0070695_100537207 3300005545 Bacteria 909
75 Ga0070695_101772884 3300005545 Bacteria 518
76 Ga0070696_100005142 3300005546 Bacteria 8744
77 Ga0070696_100007568 3300005546 Bacteria 7263
78 Ga0070696_100049473 3300005546 Bacteria 2920
79 Ga0070696_100049681 3300005546 Bacteria 2914
80 Ga0070696_100132551 3300005546 Bacteria 1814
81 Ga0070693_100007185 3300005547 Bacteria 5434
82 Ga0070693_100787189 3300005547 Bacteria 704
83 Ga0070704_100004949 3300005549 Bacteria 7734
84 Ga0070704_100358223 3300005549 Bacteria 1233
85 Ga0068855_100037610 3300005563 Bacteria 5754
86 Ga0068857_101314994 3300005577 Bacteria 702
87 Ga0068854_100072607 3300005578 Bacteria 2520
88 Ga0068856_100024274 3300005614 Bacteria 5900
89 Ga0068856_100187798 3300005614 Bacteria 2080
90 Ga0070702_100005844 3300005615 Bacteria 5769
91 Ga0070702_101643466 3300005615 Bacteria 533
92 Ga0068852_100135278 3300005616 Bacteria 2275
93 Ga0068859_100002851 3300005617 Bacteria 17533
94 Ga0068859_100498812 3300005617 Bacteria 1312
95 Ga0068859_100868616 3300005617 Bacteria 988
96 Ga0068864_100006524 3300005618 Bacteria 9559
97 Ga0068864_100561381 3300005618 Unclassified 1104
98 Ga0068864_100818723 3300005618 Bacteria 916
99 Ga0068866_10001148 3300005718 Bacteria 11632
100 Ga0068861_100013819 3300005719 Bacteria 5657
101 Ga0068870_10046172 3300005840 Bacteria 2283
102 Ga0068870_10393398 3300005840 Unclassified 900
103 Ga0068863_100269228 3300005841 Bacteria 1649
104 Ga0068863_100331801 3300005841 Bacteria 1479
105 Ga0068858_100263927 3300005842 Bacteria 1637
106 Ga0068858_100363405 3300005842 Bacteria 1387
107 Ga0068860_100025915 3300005843 Bacteria 5657
108 Ga0068862_100095913 3300005844 Bacteria 2588
109 Ga0068862_100589690 3300005844 Bacteria 1066
110 Ga0068862_100683551 3300005844 Bacteria 993
111 Ga0081539_10002158 3300005985 Bacteria 28978
112 Ga0070717_11237320 3300006028 Bacteria 679
113 Ga0070715_10067218 3300006163 Bacteria 1591
114 Ga0070716_100588735 3300006173 Bacteria 835
115 Ga0070712_100215055 3300006175 Bacteria 1518
116 Ga0097621_100023603 3300006237 Bacteria 4790
117 Ga0068871_100012503 3300006358 Bacteria 6262
118 Ga0068871_101362422 3300006358 Bacteria 668
119 Ga0075428_100005490 3300006844 Bacteria 14097
120 Ga0075428_100199509 3300006844 Bacteria 2163
121 Ga0075428_102161324 3300006844 Bacteria 575
122 Ga0075430_100301365 3300006846 Bacteria 1326
123 Ga0075430_100846830 3300006846 Bacteria 753
124 Ga0075431_100697012 3300006847 Unclassified 993
125 Ga0075431_100910537 3300006847 Bacteria 849
126 Ga0075433_10011646 3300006852 Bacteria 7084
127 Ga0075433_10034087 3300006852 Bacteria 4370
128 Ga0075434_100000492 3300006871 Bacteria 29773
129 Ga0075434_100016823 3300006871 Bacteria 7037
130 Ga0075434_100054115 3300006871 Bacteria 3987
131 Ga0075434_100068440 3300006871 Bacteria 3537
132 Ga0075434_100942427 3300006871 Bacteria 878
133 Ga0075429_100017765 3300006880 Bacteria 6151
134 Ga0075429_100306103 3300006880 Bacteria 1391
135 Ga0068865_100010465 3300006881 Bacteria 5774
136 Ga0075436_100001574 3300006914 Bacteria 15570
137 Ga0075436_100091325 3300006914 Bacteria 2117
138 Ga0075436_100262029 3300006914 Bacteria 1233
139 Ga0097620_100002852 3300006931 Bacteria 17533
140 Ga0097620_100498778 3300006931 Bacteria 1312
141 Ga0097620_100868607 3300006931 Bacteria 988
142 Ga0075435_100002302 3300007076 Bacteria 12625
143 Ga0075435_100032175 3300007076 Bacteria 4140
144 Ga0075435_100228578 3300007076 Bacteria 1580
145 Ga0099794_10015422 3300007265 Bacteria 3373
146 Ga0099794_10536916 3300007265 Bacteria 617
147 Ga0099795_10050307 3300007788 Bacteria 1515
148 Ga0111539_10022392 3300009094 Bacteria 7766
149 Ga0111539_10102481 3300009094 Bacteria 3360
150 Ga0111539_10343059 3300009094 Bacteria 1739
151 Ga0111539_13060125 3300009094 Bacteria 540
152 Ga0105245_10034275 3300009098 Bacteria 4502
153 Ga0114129_10013677 3300009147 Bacteria 11565
154 Ga0114129_10148659 3300009147 Bacteria 3207
155 Ga0114129_11213149 3300009147 Bacteria 939
156 Ga0105243_10001491 3300009148 Bacteria 20499
157 Ga0105243_12490506 3300009148 Bacteria 556
158 Ga0105241_10018581 3300009174 Bacteria 5115
159 Ga0105242_10076427 3300009176 Bacteria 2792
160 Ga0105242_11271151 3300009176 Bacteria 758
161 Ga0105249_10015268 3300009553 Bacteria 6798
162 Ga0099796_10324156 3300010159 Bacteria 658
163 Ga0157335_1002132 3300012492 Bacteria 1166
164 Ga0157342_1008157 3300012507 Unclassified 1031
165 Ga0157369_11298774 3300013105 Bacteria 742
166 Ga0157378_10024235 3300013297 Bacteria 5336
167 Ga0157375_10331746 3300013308 Unclassified 1686
168 Ga0157380_10066155 3300014326 Bacteria 2907
169 Ga0157377_10474878 3300014745 Bacteria 868
170 Ga0157379_10323049 3300014968 Unclassified 1409
171 Ga0157379_12562531 3300014968 Unclassified 510
172 Ga0157376_10019557 3300014969 Bacteria 5223
173 Ga0163161_10522303 3300017792 Bacteria 970
174 Ga0213871_10204954 3300021441 Bacteria 616
175 Ga0207653_10010154 3300025885 Bacteria 2936
176 Ga0207642_10004715 3300025899 Bacteria 4405
177 Ga0207688_10112603 3300025901 Bacteria 1581
178 Ga0207647_10115311 3300025904 Unclassified 1586
179 Ga0207685_10047866 3300025905 Bacteria 1635
180 Ga0207699_10755962 3300025906 Bacteria 713
181 Ga0207643_10044185 3300025908 Bacteria 2515
182 Ga0207643_10594902 3300025908 Unclassified 712
183 Ga0207643_11004181 3300025908 Unclassified 540
184 Ga0207654_10036160 3300025911 Bacteria 2757
185 Ga0207707_10021844 3300025912 Bacteria 5592
186 Ga0207707_10093567 3300025912 Bacteria 2625
187 Ga0207707_10931149 3300025912 Bacteria 717
188 Ga0207693_10374745 3300025915 Bacteria 1113
189 Ga0207663_10607201 3300025916 Bacteria 860
190 Ga0207660_10026148 3300025917 Bacteria 3972
191 Ga0207660_10074743 3300025917 Bacteria 2474
192 Ga0207662_10005606 3300025918 Bacteria 6711
193 Ga0207662_10338699 3300025918 Bacteria 1007
194 Ga0207662_10355753 3300025918 Bacteria 984
195 Ga0207652_10089210 3300025921 Bacteria 2707
196 Ga0207652_10135254 3300025921 Bacteria 2201
197 Ga0207652_11353898 3300025921 Unclassified 615
198 Ga0207646_10525726 3300025922 Bacteria 1065
199 Ga0207646_10610252 3300025922 Bacteria 979
200 Ga0207650_11194042 3300025925 Unclassified 648
201 Ga0207687_10013770 3300025927 Bacteria 5283
202 Ga0207700_11507868 3300025928 Bacteria 596
203 Ga0207664_10107860 3300025929 Bacteria 2311
204 Ga0207644_10679368 3300025931 Bacteria 858
205 Ga0207644_10736785 3300025931 Bacteria 823
206 Ga0207686_10015224 3300025934 Bacteria 4296
207 Ga0207709_10005807 3300025935 Bacteria 6973
208 Ga0207670_10027358 3300025936 Bacteria 3604
209 Ga0207670_10161428 3300025936 Bacteria 1673
210 Ga0207670_10269353 3300025936 Bacteria 1323
211 Ga0207670_10591087 3300025936 Bacteria 910
212 Ga0207670_10609952 3300025936 Bacteria 897
213 Ga0207704_10011600 3300025938 Bacteria 4344
214 Ga0207665_10035230 3300025939 Bacteria 3321
215 Ga0207665_10525602 3300025939 Bacteria 917
216 Ga0207689_10027189 3300025942 Bacteria 4790
217 Ga0207667_10052166 3300025949 Bacteria 4309
218 Ga0207651_10219071 3300025960 Bacteria 1537
219 Ga0207651_10793198 3300025960 Bacteria 839
220 Ga0207651_10816371 3300025960 Bacteria 827
221 Ga0207712_10094196 3300025961 Bacteria 2212
222 Ga0207640_10010202 3300025981 Bacteria 5281
223 Ga0207677_10009850 3300026023 Bacteria 5387
224 Ga0207703_10044940 3300026035 Bacteria 3551
225 Ga0207703_10095639 3300026035 Bacteria 2506
226 Ga0207708_10012791 3300026075 Bacteria 6259
227 Ga0207708_10120160 3300026075 Bacteria 2047
228 Ga0207708_10417317 3300026075 Bacteria 1112
229 Ga0207708_10915214 3300026075 Bacteria 759
230 Ga0207702_10150881 3300026078 Bacteria 2114
231 Ga0207702_10293590 3300026078 Bacteria 1541
232 Ga0207641_10625154 3300026088 Bacteria 1056
233 Ga0207648_10011337 3300026089 Bacteria 8402
234 Ga0207648_10856899 3300026089 Bacteria 847
235 Ga0207676_10021607 3300026095 Bacteria 4723
236 Ga0207675_100002264 3300026118 Bacteria 19135
237 Ga0207683_10803975 3300026121 Bacteria 873
238 Ga0207698_10110455 3300026142 Bacteria 2303
239 Ga0209967_1017024 3300027364 Bacteria 1047
240 Ga0209967_1046315 3300027364 Bacteria 665
241 Ga0209981_1007150 3300027378 Bacteria 1503
242 Ga0209981_1016468 3300027378 Bacteria 1039
243 Ga0209996_1009398 3300027395 Bacteria 1288
244 Ga0209996_1029816 3300027395 Bacteria 790
245 Ga0210000_1001984 3300027462 Bacteria 2890
246 Ga0210000_1007233 3300027462 Bacteria 1623
247 Ga0209995_1016607 3300027471 Bacteria 1210
248 Ga0209995_1041137 3300027471 Bacteria 780
249 Ga0209968_1025038 3300027526 Bacteria 981
250 Ga0209999_1005650 3300027543 Bacteria 2250
251 Ga0209999_1009840 3300027543 Bacteria 1726
252 Ga0209982_1011973 3300027552 Bacteria 1299
253 Ga0209998_10006783 3300027717 Bacteria 2375
254 Ga0209974_10010624 3300027876 Bacteria 3106
255 Ga0207428_10056997 3300027907 Bacteria 3103
256 Ga0207428_10273400 3300027907 Bacteria 1255
257 Ga0207428_10640791 3300027907 Bacteria 763
258 Ga0207428_10789505 3300027907 Bacteria 675
259 Ga0268265_10030242 3300028380 Bacteria 3897
260 Ga0268265_10696062 3300028380 Bacteria 981
261 Ga0268265_10809668 3300028380 Bacteria 914
262 Ga0268264_10008301 3300028381 Bacteria 8631
263 Ga0307405_10633481 3300031731 Bacteria 877
264 Ga0307409_100804363 3300031995 Bacteria 948
265 Ga0307416_100059783 3300032002 Bacteria 3099
266 Ga0307416_103191802 3300032002 Bacteria 548
267 Ga0373930_0080058 3300034816 Bacteria 754
268 Ga0373930_0195261 3300034816 Unclassified 525
269 Ga0373948_0021015 3300034817 Bacteria 1247
270 Ga0373950_0002354 3300034818 Bacteria 2594
271 Ga0373958_0041802 3300034819 Bacteria 939
272 Ga0373959_0016580 3300034820 Bacteria 1367
273 Ga0373926_0012983 3300035083 Bacteria 2820
274 Ga0373928_0047362 3300035084 Bacteria 1005
275 Ga0373928_0122283 3300035084 Unclassified 699
276 Ga0373928_0208628 3300035084 Bacteria 567
277 Ga0373929_0002616 3300035085 Bacteria 3297
278 Ga0373929_0254749 3300035085 Unclassified 510
279 Ga0373940_0077017 3300035088 Bacteria 980
280 Ga0373944_0016524 3300035089 Bacteria 2082
281 Ga0373949_0120794 3300035090 Bacteria 735
282 Ga0373949_0167691 3300035090 Unclassified 644
283 Ga0373951_0028231 3300035091 Bacteria 1314
284 Ga0373952_0015767 3300035092 Bacteria 1529
285 Ga0373923_0037634 3300035111 Bacteria 1980
286 Ga0373932_0013975 3300035112 Bacteria 2009
287 Ga0373932_0238589 3300035112 Bacteria 659
288 Ga0373932_0358554 3300035112 Bacteria 556
289 Ga0373936_0373169 3300035113 Bacteria 652
290 Ga0373939_0080883 3300035114 Bacteria 1078
291 Ga0373939_0114833 3300035114 Bacteria 943
292 Ga0373939_0157262 3300035114 Bacteria 832
293 Ga0373941_0036421 3300035115 Bacteria 1496
294 Ga0373941_0097469 3300035115 Bacteria 1018
295 Ga0373941_0113918 3300035115 Unclassified 956
296 Ga0373941_0168466 3300035115 Bacteria 815
297 Ga0373945_0010494 3300035116 Bacteria 3049
298 Ga0373960_0017936 3300035121 Bacteria 1840
299 Ga0373960_0050799 3300035121 Bacteria 1230
300 Ga0373943_0022340 3300035170 Bacteria 2930
301 Ga0373946_0018281 3300035171 Bacteria 2690
302 Ga0373955_0736589 3300035172 Bacteria 605
303 Ga0373942_0068616 3300035207 Bacteria 1030
304 Ga0373961_0027126 3300035241 Bacteria 1570
305 Ga0373931_0023313 3300035691 Bacteria 3123
306 Ga0373931_0078869 3300035691 Bacteria 1812
307 Ga0373931_0131214 3300035691 Bacteria 1442
308 Ga0373935_0038823 3300035692 Bacteria 2982
309 Ga0373927_1198920 3300035695 Bacteria 501
310 Ga0373933_0493228 3300035724 Bacteria 802
311 Ga0373947_0322921 3300035725 Bacteria 1032
312 Ga0373937_1231051 3300036401 Bacteria 697
313 Ga0436360_1058521 3300039438 Bacteria 1673
314 Ga0451807_1196575 3300041486 Bacteria 749
315 Ga0451839_0181141 3300041496 Bacteria 777
316 Ga0439462_0139687 3300042015 Bacteria 678
317 Ga0439446_0124128 3300042156 Bacteria 833
318 Ga0439458_0165567 3300042157 Bacteria 596
319 Ga0439434_0001350 3300042435 Bacteria 7070
320 Ga0439435_0007530 3300042436 Bacteria 2494
321 Ga0439435_0085394 3300042436 Bacteria 952
322 Ga0439444_0011517 3300042437 Bacteria 1433
323 Ga0439444_0025316 3300042437 Bacteria 1078
324 Ga0439460_0000878 3300042461 Bacteria 6875
325 Ga0466965_0760713 3300044683 Bacteria 559
326 Ga0466964_0555285 3300044706 Bacteria 624
327 Ga0466960_0397983 3300044901 Bacteria 793
328 Ga0451576_0002994 3300045051 Bacteria 23914
329 Ga0451576_0022507 3300045051 Bacteria 6833
330 Ga0451576_0104763 3300045051 Bacteria 2942
331 Ga0451576_0130912 3300045051 Bacteria 2615
332 Ga0451576_0306942 3300045051 Bacteria 1660
333 Ga0451576_0685083 3300045051 Bacteria 1077
334 Ga0451576_0751142 3300045051 Bacteria 1024
335 Ga0451576_1064948 3300045051 Unclassified 847
336 Ga0495603_0032130 3300046455 Bacteria 3159
337 Ga0495580_0015789 3300046472 Bacteria 5688
338 Ga0495628_0312208 3300046516 Bacteria 1162
339 Ga0495628_0562501 3300046516 Bacteria 818
340 Ga0495642_0123842 3300046528 Bacteria 1110
341 Ga0495586_0011221 3300046535 Bacteria 4763
342 Ga0495586_0065148 3300046535 Bacteria 1986
343 Ga0495621_0162468 3300046539 Bacteria 884
344 Ga0495622_0145949 3300046557 Bacteria 1072
345 Ga0495656_0067578 3300046615 Bacteria 1578
346 Ga0495635_0069270 3300046663 Bacteria 2419
347 Ga0495659_0032768 3300046664 Bacteria 1821
348 Ga0495659_0045489 3300046664 Bacteria 1582
349 Ga0495588_0237993 3300046674 Unclassified 960
350 Ga0495647_0043338 3300046681 Bacteria 1721
351 Ga0495647_0112390 3300046681 Bacteria 1138
352 Ga0495658_0003152 3300046683 Bacteria 8216
353 Ga0495658_0302691 3300046683 Bacteria 1011
354 Ga0495669_0113136 3300046684 Bacteria 1268
355 Ga0495581_0089541 3300047315 Bacteria 1785
356 Ga0495615_0307954 3300048090 Unclassified 515
357 Ga0501031_0055748 3300049568 Bacteria 2575
358 Ga0501032_0160299 3300049569 Bacteria 1477
359 Ga0501033_0036492 3300049570 Bacteria 3683
360 Ga0501034_0787258 3300049571 Bacteria 844
361 Ga0501036_0075359 3300049572 Bacteria 2853
362 Ga0501036_0185655 3300049572 Bacteria 1750
363 Ga0501036_0430364 3300049572 Unclassified 1100
364 Ga0501036_1339915 3300049572 Unclassified 581
365 Ga0501037_0039376 3300049573 Bacteria 3480
366 Ga0501037_0199988 3300049573 Bacteria 1412
367 Ga0501039_0005374 3300049575 Bacteria 9683
368 Ga0501039_0078465 3300049575 Bacteria 2569
369 Ga0501039_0798982 3300049575 Bacteria 736
370 Ga0501039_1228009 3300049575 Bacteria 579
371 Ga0501039_1329453 3300049575 Bacteria 554
372 Ga0501040_0028938 3300049576 Bacteria 3736
373 Ga0501040_0100130 3300049576 Bacteria 2020
374 Ga0501041_0028938 3300049577 Bacteria 3342
375 Ga0501041_0078461 3300049577 Bacteria 2032
376 Ga0501042_0030434 3300049578 Bacteria 3811
377 Ga0501042_0090974 3300049578 Bacteria 2190
378 Ga0501042_0156155 3300049578 Bacteria 1646
379 Ga0501042_1103467 3300049578 Bacteria 578
380 Ga0501043_0017278 3300049579 Bacteria 5660
381 Ga0501046_0009084 3300049580 Bacteria 8617
382 Ga0501046_0039078 3300049580 Bacteria 3803
383 Ga0501047_0759372 3300049581 Bacteria 785
384 Ga0501048_0009319 3300049582 Bacteria 7371
385 Ga0501048_0327613 3300049582 Bacteria 1091
386 Ga0501048_0897088 3300049582 Unclassified 637
387 Ga0501048_1317382 3300049582 Bacteria 519
388 Ga0501067_0039060 3300049583 Bacteria 2635
389 Ga0501068_0016917 3300049584 Bacteria 4211
390 Ga0501068_0155546 3300049584 Bacteria 1439
391 Ga0501069_0542369 3300049585 Bacteria 696
392 Ga0501070_0125275 3300049586 Bacteria 2123
393 Ga0501071_0063076 3300049587 Bacteria 2686
394 Ga0501071_0186832 3300049587 Bacteria 1553
395 Ga0501071_0858621 3300049587 Bacteria 700
396 Ga0501072_0005751 3300049588 Bacteria 9443
397 Ga0501072_0083378 3300049588 Bacteria 2534
398 Ga0501072_0144292 3300049588 Bacteria 1898
399 Ga0501072_0313944 3300049588 Bacteria 1246
400 Ga0501074_0041644 3300049590 Bacteria 3325
401 Ga0501074_0188629 3300049590 Bacteria 1470
402 Ga0501075_0009026 3300049591 Bacteria 6958
403 Ga0501075_0035614 3300049591 Bacteria 3712
404 Ga0501075_0191510 3300049591 Bacteria 1560
405 Ga0501075_0361589 3300049591 Bacteria 1106
406 Ga0501075_1331198 3300049591 Bacteria 544
407 Ga0501076_0006184 3300049592 Bacteria 8666
408 Ga0501076_0011751 3300049592 Bacteria 6536
409 Ga0501076_0397012 3300049592 Bacteria 1134
410 Ga0501076_1040924 3300049592 Bacteria 674
411 Ga0501077_0007144 3300049593 Bacteria 6885
412 Ga0501077_0028431 3300049593 Bacteria 3553
413 Ga0501077_0430256 3300049593 Bacteria 845
414 Ga0501216_139418 3300049660 Bacteria 569
415 Ga0501079_0010905 3300049741 Bacteria 6922
416 Ga0501079_0076722 3300049741 Bacteria 2584
417 Ga0501079_0139997 3300049741 Bacteria 1885
418 Ga0501080_0075061 3300049742 Bacteria 3145
419 Ga0501080_0114956 3300049742 Bacteria 2495
420 Ga0501081_0006055 3300049743 Bacteria 7835
421 Ga0501081_0016724 3300049743 Bacteria 4849
422 Ga0501083_0339231 3300049744 Bacteria 977
423 Ga0501083_0449825 3300049744 Bacteria 838
424 Ga0501270_070023 3300049767 Bacteria 676
425 Ga0501035_0012468 3300049822 Bacteria 7855
426 Ga0501035_0754849 3300049822 Bacteria 780
427 Ga0501045_0004736 3300049824 Bacteria 9386
428 Ga0501045_0031492 3300049824 Bacteria 3841
429 Ga0501212_118040 3300049851 Bacteria 512
430 nmdc:mga05p37_1139666_c1 3300050507 Bacteria 812
431 nmdc:mga05p37_23009_c1 3300050507 Bacteria 7560
432 nmdc:mga05p37_835855_c1 3300050507 Bacteria 1002
433 nmdc:mga09592_312961_c1 3300050508 Bacteria 1361
434 nmdc:mga09592_46145_c1 3300050508 Bacteria 3671
435 nmdc:mga09592_76992_c1 3300050508 Bacteria 2837
436 nmdc:mga0qj67_103916_c1 3300050509 Bacteria 2292
437 nmdc:mga0qj67_1426063_c1 3300050509 Bacteria 534
438 nmdc:mga0qj67_565296_c1 3300050509 Bacteria 911
439 nmdc:mga0qj67_698670_c1 3300050509 Bacteria 807
440 nmdc:mga06r32_135653_c1 3300050510 Bacteria 2436
441 nmdc:mga06r32_1466682_c1 3300050510 Unclassified 623
442 nmdc:mga06r32_392499_c1 3300050510 Bacteria 1370
443 nmdc:mga08y16_10893_c1 3300050511 Bacteria 9552
444 nmdc:mga08y16_12782_c1 3300050511 Bacteria 8834
445 nmdc:mga08y16_1844918_c1 3300050511 Bacteria 557
446 nmdc:mga08y16_87191_c1 3300050511 Bacteria 3252
447 nmdc:mga0n895_2433_c1 3300050512 Bacteria 14531
448 nmdc:mga0n895_34159_c1 3300050512 Bacteria 4894
449 nmdc:mga0n895_49153_c1 3300050512 Bacteria 4131
450 nmdc:mga0n895_550110_c1 3300050512 Bacteria 1160
451 nmdc:mga0n895_769263_c1 3300050512 Bacteria 955
452 nmdc:mga0n895_93231_c1 3300050512 Bacteria 3015
453 nmdc:mga0rr50_10677_c1 3300050513 Bacteria 5844
454 nmdc:mga0rr50_112796_c1 3300050513 Bacteria 2154
455 nmdc:mga0rr50_1284417_c1 3300050513 Bacteria 621
456 nmdc:mga0rr50_15189_c1 3300050513 Bacteria 5077
457 nmdc:mga08x19_10798_c1 3300050514 Bacteria 5492
458 nmdc:mga08x19_128843_c1 3300050514 Bacteria 1701
459 nmdc:mga08x19_221179_c1 3300050514 Bacteria 1301
460 nmdc:mga08x19_260400_c1 3300050514 Bacteria 1199
461 nmdc:mga08x19_57979_c1 3300050514 Bacteria 2504
462 nmdc:mga0a205_22117_c1 3300050515 Bacteria 6019
463 nmdc:mga0a205_39060_c1 3300050515 Bacteria 4568
464 nmdc:mga0a205_505660_c1 3300050515 Bacteria 1065
465 Ga0501084_0006739 3300054114 Bacteria 9444
466 Ga0501084_0008597 3300054114 Bacteria 8440
467 Ga0501084_0192864 3300054114 Bacteria 1719
468 Ga0590077_086097 3300059426 Bacteria 726
469 Ga0501082_0018087 3300060353 Bacteria 6069
470 Ga0501082_0035771 3300060353 Bacteria 4280
471 Ga0501082_0684800 3300060353 Bacteria 897
472 Ga0530510_0000803 3300061734 Bacteria 20450
473 Ga0530510_0009689 3300061734 Bacteria 6759
474 Ga0207686_11547309
475 JGI25406J46586_10023506
476 JGI26131J50246_103471
477 Ga0065707_10023276
478 Ga0065707_10202229
479 Ga0070690_100032215
480 Ga0070690_100436843
481 Ga0070690_100883339
482 Ga0070670_101434805
483 Ga0068869_100001704
484 Ga0068869_100449511
485 Ga0070680_100033607
486 Ga0070680_100125265
487 Ga0068868_100001119
488 Ga0070689_100028513
489 Ga0070689_100048534
490 Ga0070689_100115705
491 Ga0070689_100248305
492 Ga0070691_10026967
493 Ga0070691_10045842
494 Ga0070691_10641956
495 Ga0070687_100000821
496 Ga0070687_100445742
497 Ga0070687_101535385
498 Ga0070692_10007031
499 Ga0070692_10419962
500 Ga0070669_100928911
501 Ga0070675_100759361
502 Ga0070671_100027938
503 Ga0070671_100879797
504 Ga0070674_102053657
505 Ga0070673_100237053
506 Ga0070673_100438354
507 Ga0070673_100697379
508 Ga0070688_100061820
509 Ga0070688_100431873
510 Ga0070703_10009891
511 Ga0070714_100586473
512 Ga0070701_10002695
513 Ga0070701_10091066
514 Ga0070705_100061340
515 Ga0070705_100157994
516 Ga0070705_100372086
517 Ga0070705_100467622
518 Ga0070705_100607200
519 Ga0070705_101939360
520 Ga0070700_100008844
521 Ga0070700_101307144
522 Ga0070700_101521912
523 Ga0070694_100004096
524 Ga0070694_100036037
525 Ga0070694_100297837
526 Ga0070694_100693338
527 Ga0070694_101387020
528 Ga0070708_100487462
529 Ga0070678_100516682
530 Ga0070681_10000720
531 Ga0070681_10029082
532 Ga0068867_100014406
533 Ga0070685_11097077
534 Ga0070707_100717093
535 Ga0070679_100027903
536 Ga0070679_100191674
537 Ga0070679_102082523
538 Ga0070679_102195724
539 Ga0070697_100150276
540 Ga0070697_100157662
541 Ga0070697_100633881
542 Ga0070686_100007268
543 Ga0070686_100196042
544 Ga0070686_100418944
545 Ga0070695_100014536
546 Ga0070695_100029509
547 Ga0070695_100537207
548 Ga0070695_101772884
549 Ga0070696_100005142
550 Ga0070696_100007568
551 Ga0070696_100049473
552 Ga0070696_100049681
553 Ga0070696_100132551
554 Ga0070693_100007185
555 Ga0070693_100787189
556 Ga0070704_100004949
557 Ga0070704_100358223
558 Ga0068855_100037610
559 Ga0068857_101314994
560 Ga0068854_100072607
561 Ga0068856_100024274
562 Ga0068856_100187798
563 Ga0070702_100005844
564 Ga0070702_101643466
565 Ga0068852_100135278
566 Ga0068859_100002851
567 Ga0068859_100498812
568 Ga0068859_100868616
569 Ga0068864_100006524
570 Ga0068864_100561381
571 Ga0068864_100818723
572 Ga0068866_10001148
573 Ga0068861_100013819
574 Ga0068870_10046172
575 Ga0068870_10393398
576 Ga0068863_100269228
577 Ga0068863_100331801
578 Ga0068858_100263927
579 Ga0068858_100363405
580 Ga0068860_100025915
581 Ga0068862_100095913
582 Ga0068862_100589690
583 Ga0068862_100683551
584 Ga0081539_10002158
585 Ga0070717_11237320
586 Ga0070715_10067218
587 Ga0070716_100588735
588 Ga0070712_100215055
589 Ga0097621_100023603
590 Ga0068871_100012503
591 Ga0068871_101362422
592 Ga0075428_100005490
593 Ga0075428_100199509
594 Ga0075428_102161324
595 Ga0075430_100301365
596 Ga0075430_100846830
597 Ga0075431_100697012
598 Ga0075431_100910537
599 Ga0075433_10011646
600 Ga0075433_10034087
601 Ga0075434_100000492
602 Ga0075434_100016823
603 Ga0075434_100054115
604 Ga0075434_100068440
605 Ga0075434_100942427
606 Ga0075429_100017765
607 Ga0075429_100306103
608 Ga0068865_100010465
609 Ga0075436_100001574
610 Ga0075436_100091325
611 Ga0075436_100262029
612 Ga0097620_100002852
613 Ga0097620_100498778
614 Ga0097620_100868607
615 Ga0075435_100002302
616 Ga0075435_100032175
617 Ga0075435_100228578
618 Ga0099794_10015422
619 Ga0099794_10536916
620 Ga0099795_10050307
621 Ga0111539_10022392
622 Ga0111539_10102481
623 Ga0111539_10343059
624 Ga0111539_13060125
625 Ga0105245_10034275
626 Ga0114129_10013677
627 Ga0114129_10148659
628 Ga0114129_11213149
629 Ga0105243_10001491
630 Ga0105243_12490506
631 Ga0105241_10018581
632 Ga0105242_10076427
633 Ga0105242_11271151
634 Ga0105249_10015268
635 Ga0099796_10324156
636 Ga0157335_1002132
637 Ga0157342_1008157
638 Ga0157369_11298774
639 Ga0157378_10024235
640 Ga0157375_10331746
641 Ga0157380_10066155
642 Ga0157377_10474878
643 Ga0157379_10323049
644 Ga0157379_12562531
645 Ga0157376_10019557
646 Ga0163161_10522303
647 Ga0213871_10204954
648 Ga0207653_10010154
649 Ga0207642_10004715
650 Ga0207688_10112603
651 Ga0207647_10115311
652 Ga0207685_10047866
653 Ga0207699_10755962
654 Ga0207643_10044185
655 Ga0207643_10594902
656 Ga0207643_11004181
657 Ga0207654_10036160
658 Ga0207707_10021844
659 Ga0207707_10093567
660 Ga0207707_10931149
661 Ga0207693_10374745
662 Ga0207663_10607201
663 Ga0207660_10026148
664 Ga0207660_10074743
665 Ga0207662_10005606
666 Ga0207662_10338699
667 Ga0207662_10355753
668 Ga0207652_10089210
669 Ga0207652_10135254
670 Ga0207652_11353898
671 Ga0207646_10525726
672 Ga0207646_10610252
673 Ga0207650_11194042
674 Ga0207687_10013770
675 Ga0207700_11507868
676 Ga0207664_10107860
677 Ga0207644_10679368
678 Ga0207644_10736785
679 Ga0207686_10015224
680 Ga0207709_10005807
681 Ga0207670_10027358
682 Ga0207670_10161428
683 Ga0207670_10269353
684 Ga0207670_10591087
685 Ga0207670_10609952
686 Ga0207704_10011600
687 Ga0207665_10035230
688 Ga0207665_10525602
689 Ga0207689_10027189
690 Ga0207667_10052166
691 Ga0207651_10219071
692 Ga0207651_10793198
693 Ga0207651_10816371
694 Ga0207712_10094196
695 Ga0207640_10010202
696 Ga0207677_10009850
697 Ga0207703_10044940
698 Ga0207703_10095639
699 Ga0207708_10012791
700 Ga0207708_10120160
701 Ga0207708_10417317
702 Ga0207708_10915214
703 Ga0207702_10150881
704 Ga0207702_10293590
705 Ga0207641_10625154
706 Ga0207648_10011337
707 Ga0207648_10856899
708 Ga0207676_10021607
709 Ga0207675_100002264
710 Ga0207683_10803975
711 Ga0207698_10110455
712 Ga0209967_1017024
713 Ga0209967_1046315
714 Ga0209981_1007150
715 Ga0209981_1016468
716 Ga0209996_1009398
717 Ga0209996_1029816
718 Ga0210000_1001984
719 Ga0210000_1007233
720 Ga0209995_1016607
721 Ga0209995_1041137
722 Ga0209968_1025038
723 Ga0209999_1005650
724 Ga0209999_1009840
725 Ga0209982_1011973
726 Ga0209998_10006783
727 Ga0209974_10010624
728 Ga0207428_10056997
729 Ga0207428_10273400
730 Ga0207428_10640791
731 Ga0207428_10789505
732 Ga0268265_10030242
733 Ga0268265_10696062
734 Ga0268265_10809668
735 Ga0268264_10008301
736 Ga0307405_10633481
737 Ga0307409_100804363
738 Ga0307416_100059783
739 Ga0307416_103191802
740 Ga0373930_0080058
741 Ga0373930_0195261
742 Ga0373948_0021015
743 Ga0373950_0002354
744 Ga0373958_0041802
745 Ga0373959_0016580
746 Ga0373926_0012983
747 Ga0373928_0047362
748 Ga0373928_0122283
749 Ga0373928_0208628
750 Ga0373929_0002616
751 Ga0373929_0254749
752 Ga0373940_0077017
753 Ga0373944_0016524
754 Ga0373949_0120794
755 Ga0373949_0167691
756 Ga0373951_0028231
757 Ga0373952_0015767
758 Ga0373923_0037634
759 Ga0373932_0013975
760 Ga0373932_0238589
761 Ga0373932_0358554
762 Ga0373936_0373169
763 Ga0373939_0080883
764 Ga0373939_0114833
765 Ga0373939_0157262
766 Ga0373941_0036421
767 Ga0373941_0097469
768 Ga0373941_0113918
769 Ga0373941_0168466
770 Ga0373945_0010494
771 Ga0373960_0017936
772 Ga0373960_0050799
773 Ga0373943_0022340
774 Ga0373946_0018281
775 Ga0373955_0736589
776 Ga0373942_0068616
777 Ga0373961_0027126
778 Ga0373931_0023313
779 Ga0373931_0078869
780 Ga0373931_0131214
781 Ga0373935_0038823
782 Ga0373927_1198920
783 Ga0373933_0493228
784 Ga0373947_0322921
785 Ga0373937_1231051
786 Ga0436360_1058521
787 Ga0451807_1196575
788 Ga0451839_0181141
789 Ga0439462_0139687
790 Ga0439446_0124128
791 Ga0439458_0165567
792 Ga0439434_0001350
793 Ga0439435_0007530
794 Ga0439435_0085394
795 Ga0439444_0011517
796 Ga0439444_0025316
797 Ga0439460_0000878
798 Ga0466965_0760713
799 Ga0466964_0555285
800 Ga0466960_0397983
801 Ga0451576_0002994
802 Ga0451576_0022507
803 Ga0451576_0104763
804 Ga0451576_0130912
805 Ga0451576_0306942
806 Ga0451576_0685083
807 Ga0451576_0751142
808 Ga0451576_1064948
809 Ga0495603_0032130
810 Ga0495580_0015789
811 Ga0495628_0312208
812 Ga0495628_0562501
813 Ga0495642_0123842
814 Ga0495586_0011221
815 Ga0495586_0065148
816 Ga0495621_0162468
817 Ga0495622_0145949
818 Ga0495656_0067578
819 Ga0495635_0069270
820 Ga0495659_0032768
821 Ga0495659_0045489
822 Ga0495588_0237993
823 Ga0495647_0043338
824 Ga0495647_0112390
825 Ga0495658_0003152
826 Ga0495658_0302691
827 Ga0495669_0113136
828 Ga0495581_0089541
829 Ga0495615_0307954
830 Ga0501031_0055748
831 Ga0501032_0160299
832 Ga0501033_0036492
833 Ga0501034_0787258
834 Ga0501036_0075359
835 Ga0501036_0185655
836 Ga0501036_0430364
837 Ga0501036_1339915
838 Ga0501037_0039376
839 Ga0501037_0199988
840 Ga0501039_0005374
841 Ga0501039_0078465
842 Ga0501039_0798982
843 Ga0501039_1228009
844 Ga0501039_1329453
845 Ga0501040_0028938
846 Ga0501040_0100130
847 Ga0501041_0028938
848 Ga0501041_0078461
849 Ga0501042_0030434
850 Ga0501042_0090974
851 Ga0501042_0156155
852 Ga0501042_1103467
853 Ga0501043_0017278
854 Ga0501046_0009084
855 Ga0501046_0039078
856 Ga0501047_0759372
857 Ga0501048_0009319
858 Ga0501048_0327613
859 Ga0501048_0897088
860 Ga0501048_1317382
861 Ga0501067_0039060
862 Ga0501068_0016917
863 Ga0501068_0155546
864 Ga0501069_0542369
865 Ga0501070_0125275
866 Ga0501071_0063076
867 Ga0501071_0186832
868 Ga0501071_0858621
869 Ga0501072_0005751
870 Ga0501072_0083378
871 Ga0501072_0144292
872 Ga0501072_0313944
873 Ga0501074_0041644
874 Ga0501074_0188629
875 Ga0501075_0009026
876 Ga0501075_0035614
877 Ga0501075_0191510
878 Ga0501075_0361589
879 Ga0501075_1331198
880 Ga0501076_0006184
881 Ga0501076_0011751
882 Ga0501076_0397012
883 Ga0501076_1040924
884 Ga0501077_0007144
885 Ga0501077_0028431
886 Ga0501077_0430256
887 Ga0501216_139418
888 Ga0501079_0010905
889 Ga0501079_0076722
890 Ga0501079_0139997
891 Ga0501080_0075061
892 Ga0501080_0114956
893 Ga0501081_0006055
894 Ga0501081_0016724
895 Ga0501083_0339231
896 Ga0501083_0449825
897 Ga0501270_070023
898 Ga0501035_0012468
899 Ga0501035_0754849
900 Ga0501045_0004736
901 Ga0501045_0031492
902 Ga0501212_118040
903 nmdc:mga05p37_1139666_c1
904 nmdc:mga05p37_23009_c1
905 nmdc:mga05p37_835855_c1
906 nmdc:mga09592_312961_c1
907 nmdc:mga09592_46145_c1
908 nmdc:mga09592_76992_c1
909 nmdc:mga0qj67_103916_c1
910 nmdc:mga0qj67_1426063_c1
911 nmdc:mga0qj67_565296_c1
912 nmdc:mga0qj67_698670_c1
913 nmdc:mga06r32_135653_c1
914 nmdc:mga06r32_1466682_c1
915 nmdc:mga06r32_392499_c1
916 nmdc:mga08y16_10893_c1
917 nmdc:mga08y16_12782_c1
918 nmdc:mga08y16_1844918_c1
919 nmdc:mga08y16_87191_c1
920 nmdc:mga0n895_2433_c1
921 nmdc:mga0n895_34159_c1
922 nmdc:mga0n895_49153_c1
923 nmdc:mga0n895_550110_c1
924 nmdc:mga0n895_769263_c1
925 nmdc:mga0n895_93231_c1
926 nmdc:mga0rr50_10677_c1
927 nmdc:mga0rr50_112796_c1
928 nmdc:mga0rr50_1284417_c1
929 nmdc:mga0rr50_15189_c1
930 nmdc:mga08x19_10798_c1
931 nmdc:mga08x19_128843_c1
932 nmdc:mga08x19_221179_c1
933 nmdc:mga08x19_260400_c1
934 nmdc:mga08x19_57979_c1
935 nmdc:mga0a205_22117_c1
936 nmdc:mga0a205_39060_c1
937 nmdc:mga0a205_505660_c1
938 Ga0501084_0006739
939 Ga0501084_0008597
940 Ga0501084_0192864
941 Ga0590077_086097
942 Ga0501082_0018087
943 Ga0501082_0035771
944 Ga0501082_0684800
945 Ga0530510_0000803
946 Ga0530510_0009689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bcv-assembly1.cif.gz_F photosystem i assembly intermediate of avena sativa 0.7355 34 69
5l8g-assembly1.cif.gz_J crystal structure of rhodospirillum rubrum rru_a0973 mutant h65a 0.4641 14 84
6jqa-assembly1.cif.gz_B crystal structure of phyllogen, a phyllody inducing effector protein of phytoplasma. 0.4543 2 87
6s7o-assembly1.cif.gz_F cryo-em structure of human oligosaccharyltransferase complex ost-a 0.4456 1 70
6nyi-assembly1.cif.gz_C crystal structure of computationally designed protein xxa 0.4258 5 74
ID Description Score Start End Superfamily
2xtlB04 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7247 27 69 1.20.58.90
af_Q4DYR9_222_406_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6236 36 68 1.25.40.10
1zpyI00 Special;Helix non-globular;Helix Hairpins; 0.6233 26 84 6.10.140.1960
af_Q7JYY8_1_96_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6137 13 69 1.20.5.110
2b1eA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5733 9 69 1.20.58.1150
ID Description Score Start End GO Terms
AF-A0A844RRR8-F1-model_v4 deleted 0.7915 2 69
AF-A0A537NJU6-F1-model_v4 Uncharacterized protein 0.7675 2 76 GO:0016020
AF-A0A517CW23-F1-model_v4 deleted 0.7608 12 76
AF-A0A758BNY6-F1-model_v4 Uncharacterized protein 0.755 1 69
AF-A0A177QSS3-F1-model_v4 Uncharacterized protein 0.7453 5 87

Map