F450977

General Info

Members Datasets Scaffolds Average Seq Length
473 263 460 199

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100159616|Ga0068853_1001596162
Length 226
Sequence LHIFATDWFRKPLPTWRQHNKINTMRKIIVLEFITLDGVMQAPGGPEEDTSGSFEFGGWSAPYGEEVSGKLMKKQMEPADLLLGRKTFEIFANFWPEHKEVWPGIIDVNKYVLSNTIKDSDPVVSRWKNSNVLTSLAAIQKLKNSNGSDIKVWGSSKLVQLLLANDLVDELLLKIYPLTLGKGKKLFDNGPIPAAFTLTESAVTPGGVIFANYKRAGKVKTGTVGA

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
3 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
4 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
5 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
6 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
7 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
8 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
9 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
10 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
11 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
12 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
13 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
14 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
243 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
253 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
254 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
263 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 0.21
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 0.21
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 6.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c000802 3300000044 Bacteria 3174
2 JGI24736J21556_1002052 3300001904 Bacteria 3580
3 rootH1_10006979 3300003316 Bacteria 11870
4 rootH2_10020236 3300003320 Bacteria 15213
5 rootH2_10238081 3300003320 Bacteria 4396
6 rootH2_10294655 3300003320 Bacteria 1133
7 rootL2_10000502 3300003322 Bacteria 11249
8 rootL2_10362377 3300003322 Unclassified 1616
9 rootH1_10007354 3300003323 Bacteria 13643
10 rootH1_10013909 3300003323 Bacteria 31542
11 rootH1_10132622 3300003316 Bacteria 3387
12 rootH1_10132622 3300003323 Bacteria 1660
13 Ga0058862_12229543 3300004803 Unclassified 739
14 Ga0065714_10030687 3300005288 Bacteria 1001
15 Ga0065714_10075644 3300005288 Bacteria 2882
16 Ga0065714_10134041 3300005288 Bacteria 1225
17 Ga0065715_10198767 3300005293 Bacteria 1373
18 Ga0065707_10294338 3300005295 Bacteria 1018
19 Ga0070676_10043188 3300005328 Bacteria 2619
20 Ga0070683_100000340 3300005329 Bacteria 32130
21 Ga0070683_100012066 3300005329 Bacteria 7496
22 Ga0070683_100096310 3300005329 Bacteria 2783
23 Ga0070683_100197985 3300005329 Bacteria 1908
24 Ga0070683_100236006 3300005329 Unclassified 1739
25 Ga0070670_100104026 3300005331 Bacteria 2446
26 Ga0070670_100106716 3300005331 Unclassified 2413
27 Ga0070670_100178906 3300005331 Unclassified 1841
28 Ga0070670_100249667 3300005331 Bacteria 1546
29 Ga0070670_100300978 3300005331 Bacteria 1403
30 Ga0070670_100406950 3300005331 Bacteria 1202
31 Ga0068869_100024298 3300005334 Unclassified 4197
32 Ga0068869_100046970 3300005334 Bacteria 3116
33 Ga0068869_100099190 3300005334 Bacteria 2201
34 Ga0068869_100153019 3300005334 Bacteria 1790
35 Ga0068869_100217032 3300005334 Bacteria 1514
36 Ga0068869_100219053 3300005334 Bacteria 1508
37 Ga0070666_10061662 3300005335 Bacteria 2539
38 Ga0070666_10114338 3300005335 Bacteria 1868
39 Ga0070666_10350044 3300005335 Bacteria 1057
40 Ga0068868_100001285 3300005338 Bacteria 17285
41 Ga0068868_100031421 3300005338 Bacteria 4078
42 Ga0068868_100064364 3300005338 Bacteria 2911
43 Ga0070689_100030759 3300005340 Bacteria 4076
44 Ga0070689_100052889 3300005340 Unclassified 3142
45 Ga0070687_100094057 3300005343 Bacteria 1664
46 Ga0070668_100110564 3300005347 Bacteria 2187
47 Ga0070668_100496287 3300005347 Bacteria 1056
48 Ga0070669_100145364 3300005353 Bacteria 1832
49 Ga0070669_100827078 3300005353 Unclassified 788
50 Ga0070675_100025445 3300005354 Bacteria 4744
51 Ga0070675_100166416 3300005354 Bacteria 1899
52 Ga0070675_100406714 3300005354 Unclassified 1215
53 Ga0070671_100046144 3300005355 Bacteria 3623
54 Ga0070671_100221313 3300005355 Bacteria 1606
55 Ga0070671_100448258 3300005355 Bacteria 1107
56 Ga0070671_100654186 3300005355 Bacteria 910
57 Ga0070673_100117267 3300005364 Unclassified 2215
58 Ga0070673_100681809 3300005364 Bacteria 943
59 Ga0070673_101074356 3300005364 Bacteria 751
60 Ga0070688_100171800 3300005365 Unclassified 1497
61 Ga0070688_100984292 3300005365 Bacteria 669
62 Ga0070659_100479509 3300005366 Unclassified 1058
63 Ga0070667_100039817 3300005367 Bacteria 3940
64 Ga0070667_100099777 3300005367 Bacteria 2507
65 Ga0070667_100267779 3300005367 Bacteria 1531
66 Ga0070667_100403487 3300005367 Bacteria 1244
67 Ga0070667_100843996 3300005367 Bacteria 851
68 Ga0070705_100106905 3300005440 Bacteria 1780
69 Ga0070678_100398877 3300005456 Bacteria 1194
70 Ga0070662_100137834 3300005457 Bacteria 1888
71 Ga0070662_100287834 3300005457 Bacteria 1331
72 Ga0070681_10877185 3300005458 Unclassified 815
73 Ga0068867_100158285 3300005459 Bacteria 1784
74 Ga0068867_100794225 3300005459 Bacteria 843
75 Ga0070685_10184970 3300005466 Bacteria 1344
76 Ga0070685_10691762 3300005466 Bacteria 743
77 Ga0070707_100440696 3300005468 Bacteria 1263
78 Ga0070699_100007975 3300005518 Bacteria 9194
79 Ga0070699_100711733 3300005518 Bacteria 918
80 Ga0070684_100005785 3300005535 Bacteria 9509
81 Ga0070684_100506807 3300005535 Bacteria 1118
82 Ga0070684_100875760 3300005535 Bacteria 841
83 Ga0068853_100079545 3300005539 Bacteria 2867
84 Ga0068853_100159616 3300005539 Unclassified 2034
85 Ga0068853_100324770 3300005539 Unclassified 1427
86 Ga0068853_100341024 3300005539 Bacteria 1392
87 Ga0068853_100481559 3300005539 Bacteria 1170
88 Ga0070672_100039166 3300005543 Unclassified 3628
89 Ga0070672_100240053 3300005543 Bacteria 1524
90 Ga0070693_100356773 3300005547 Bacteria 1002
91 Ga0070665_100007019 3300005548 Bacteria 11445
92 Ga0070665_100087711 3300005548 Bacteria 3117
93 Ga0070665_100257547 3300005548 Bacteria 1746
94 Ga0070665_100334853 3300005548 Unclassified 1518
95 Ga0070665_100466524 3300005548 Bacteria 1273
96 Ga0070704_100024721 3300005549 Bacteria 3945
97 Ga0068855_100000093 3300005563 Bacteria 106968
98 Ga0068855_100522724 3300005563 Bacteria 1287
99 Ga0070664_100058151 3300005564 Unclassified 3288
100 Ga0070664_100341606 3300005564 Bacteria 1360
101 Ga0070664_100805314 3300005564 Unclassified 878
102 Ga0068857_100212892 3300005577 Bacteria 1764
103 Ga0068857_101068240 3300005577 Bacteria 779
104 Ga0068857_101575151 3300005577 Unclassified 641
105 Ga0068854_100026640 3300005578 Bacteria 3975
106 Ga0068854_100255844 3300005578 Bacteria 1400
107 Ga0068856_100029827 3300005614 Bacteria 5330
108 Ga0068852_100077385 3300005616 Bacteria 2940
109 Ga0068852_100099384 3300005616 Bacteria 2623
110 Ga0068859_100008618 3300005617 Bacteria 10305
111 Ga0068859_100073649 3300005617 Bacteria 3453
112 Ga0068859_100175113 3300005617 Bacteria 2227
113 Ga0068859_100622158 3300005617 Bacteria 1172
114 Ga0068859_100638587 3300005617 Unclassified 1157
115 Ga0068859_100717068 3300005617 Bacteria 1090
116 Ga0068864_100013566 3300005618 Bacteria 6756
117 Ga0068864_100496075 3300005618 Bacteria 1174
118 Ga0068864_100642277 3300005618 Bacteria 1033
119 Ga0068864_101356644 3300005618 Bacteria 712
120 Ga0068861_100061516 3300005719 Bacteria 2882
121 Ga0068851_10012120 3300005834 Bacteria 4059
122 Ga0068863_100150379 3300005841 Unclassified 2227
123 Ga0068858_100087206 3300005842 Bacteria 2903
124 Ga0068858_101139891 3300005842 Bacteria 766
125 Ga0068860_100180009 3300005843 Bacteria 2043
126 Ga0068860_100183061 3300005843 Bacteria 2025
127 Ga0068860_100305380 3300005843 Bacteria 1560
128 Ga0068862_100484726 3300005844 Bacteria 1171
129 Ga0081455_10096552 3300005937 Bacteria 2383
130 Ga0081539_10010847 3300005985 Bacteria 7319
131 Ga0081539_10217219 3300005985 Bacteria 872
132 Ga0070717_10050283 3300006028 Unclassified 3425
133 Ga0070712_100230837 3300006175 Bacteria 1470
134 Ga0097621_100116174 3300006237 Bacteria 2265
135 Ga0097621_100202765 3300006237 Bacteria 1723
136 Ga0068871_100052755 3300006358 Bacteria 3294
137 Ga0068871_100222067 3300006358 Bacteria 1637
138 Ga0068871_100317132 3300006358 Bacteria 1372
139 Ga0068871_100327647 3300006358 Bacteria 1350
140 Ga0068871_100409419 3300006358 Bacteria 1209
141 Ga0068871_100453614 3300006358 Bacteria 1150
142 Ga0075429_100043023 3300006880 Bacteria 3930
143 Ga0068865_100020273 3300006881 Bacteria 4312
144 Ga0068865_100033140 3300006881 Bacteria 3456
145 Ga0068865_100141563 3300006881 Unclassified 1814
146 Ga0075436_100027917 3300006914 Bacteria 3885
147 Ga0075436_100149028 3300006914 Bacteria 1645
148 Ga0097620_100008617 3300006931 Bacteria 10305
149 Ga0097620_100073651 3300006931 Bacteria 3453
150 Ga0097620_100175107 3300006931 Bacteria 2227
151 Ga0097620_100622106 3300006931 Bacteria 1172
152 Ga0097620_100638596 3300006931 Unclassified 1157
153 Ga0097620_100717070 3300006931 Bacteria 1090
154 Ga0105251_10080724 3300009011 Bacteria 1504
155 Ga0105240_10002821 3300009093 Bacteria 27478
156 Ga0105240_10070908 3300009093 Bacteria 4310
157 Ga0105240_10118102 3300009093 Bacteria 3197
158 Ga0105245_11250426 3300009098 Bacteria 791
159 Ga0105247_10001974 3300009101 Bacteria 14247
160 Ga0114129_10296970 3300009147 Bacteria 2154
161 Ga0105241_10115600 3300009174 Bacteria 2154
162 Ga0105241_10130192 3300009174 Bacteria 2036
163 Ga0105241_10423015 3300009174 Bacteria 1173
164 Ga0105242_10150326 3300009176 Bacteria 2030
165 Ga0105242_10200993 3300009176 Bacteria 1770
166 Ga0105242_10475687 3300009176 Unclassified 1183
167 Ga0105248_10029771 3300009177 Bacteria 6093
168 Ga0105237_10025376 3300009545 Bacteria 6061
169 Ga0105237_10028347 3300009545 Bacteria 5705
170 Ga0105249_10001743 3300009553 Bacteria 18966
171 Ga0105249_10024457 3300009553 Bacteria 5428
172 Ga0105249_10642942 3300009553 Unclassified 1118
173 Ga0105239_10007190 3300010375 Bacteria 12798
174 Ga0105239_10027092 3300010375 Bacteria 6309
175 Ga0105239_10066220 3300010375 Bacteria 3968
176 Ga0105239_10679272 3300010375 Bacteria 1177
177 Ga0105239_10689244 3300010375 Bacteria 1168
178 Ga0105246_10193776 3300011119 Bacteria 1575
179 Ga0105246_11004144 3300011119 Bacteria 756
180 Ga0157325_1000213 3300012485 Bacteria 2645
181 Ga0157373_10000001 3300013100 Bacteria 864756
182 Ga0157371_10430152 3300013102 Unclassified 968
183 Ga0157370_10000225 3300013104 Bacteria 71924
184 Ga0157374_10006784 3300013296 Bacteria 9735
185 Ga0157374_10082098 3300013296 Bacteria 3060
186 Ga0157374_10098690 3300013296 Unclassified 2797
187 Ga0157374_10144241 3300013296 Bacteria 2312
188 Ga0157374_10228259 3300013296 Bacteria 1828
189 Ga0157378_10101745 3300013297 Bacteria 2624
190 Ga0157378_10330928 3300013297 Bacteria 1482
191 Ga0157378_10351138 3300013297 Bacteria 1441
192 Ga0157378_10439851 3300013297 Bacteria 1292
193 Ga0157378_10595080 3300013297 Unclassified 1116
194 Ga0163162_10022971 3300013306 Bacteria 6152
195 Ga0163162_10179505 3300013306 Bacteria 2243
196 Ga0163162_10451885 3300013306 Bacteria 1417
197 Ga0163162_10579925 3300013306 Bacteria 1248
198 Ga0157372_11388953 3300013307 Unclassified 810
199 Ga0157375_10009836 3300013308 Bacteria 8410
200 Ga0157375_10145361 3300013308 Bacteria 2502
201 Ga0157375_10776770 3300013308 Bacteria 1108
202 Ga0163163_10020021 3300014325 Bacteria 6296
203 Ga0163163_10054610 3300014325 Unclassified 3947
204 Ga0163163_10159453 3300014325 Bacteria 2301
205 Ga0163163_10420029 3300014325 Bacteria 1396
206 Ga0163163_10443685 3300014325 Bacteria 1358
207 Ga0163163_10569837 3300014325 Unclassified 1195
208 Ga0157380_10000004 3300014326 Bacteria 212844
209 Ga0182008_10032885 3300014497 Bacteria 2604
210 Ga0157377_10004811 3300014745 Bacteria 6268
211 Ga0157377_10411338 3300014745 Unclassified 924
212 Ga0157377_10646020 3300014745 Bacteria 761
213 Ga0157379_10033211 3300014968 Bacteria 4601
214 Ga0157379_10064366 3300014968 Bacteria 3277
215 Ga0157379_10075205 3300014968 Bacteria 3024
216 Ga0157379_10476623 3300014968 Bacteria 1154
217 Ga0157376_10254141 3300014969 Bacteria 1643
218 Ga0157376_10358137 3300014969 Bacteria 1398
219 Ga0182006_1005750 3300015261 Bacteria 5853
220 Ga0182005_1050940 3300015265 Bacteria 1126
221 Ga0163161_10300625 3300017792 Bacteria 1264
222 Ga0209455_1007389 3300025272 Bacteria 3106
223 Ga0207656_10014551 3300025321 Bacteria 3034
224 Ga0207642_10619221 3300025899 Unclassified 675
225 Ga0207710_10001900 3300025900 Bacteria 10015
226 Ga0207680_10414255 3300025903 Bacteria 953
227 Ga0207647_10044422 3300025904 Bacteria 2776
228 Ga0207647_10046356 3300025904 Bacteria 2709
229 Ga0207647_10066109 3300025904 Unclassified 2193
230 Ga0207645_10125685 3300025907 Bacteria 1667
231 Ga0207705_10403139 3300025909 Unclassified 1058
232 Ga0207654_10259118 3300025911 Bacteria 1168
233 Ga0207707_10402066 3300025912 Bacteria 1176
234 Ga0207695_10036241 3300025913 Bacteria 5334
235 Ga0207695_10132875 3300025913 Bacteria 2445
236 Ga0207695_10133060 3300025913 Bacteria 2442
237 Ga0207695_10212954 3300025913 Bacteria 1842
238 Ga0207695_10443345 3300025913 Bacteria 1182
239 Ga0207671_10000318 3300025914 Bacteria 71076
240 Ga0207671_10070197 3300025914 Bacteria 2611
241 Ga0207662_10302114 3300025918 Bacteria 1064
242 Ga0207662_10891106 3300025918 Bacteria 630
243 Ga0207649_10030755 3300025920 Unclassified 3184
244 Ga0207652_10327598 3300025921 Bacteria 1383
245 Ga0207646_10236107 3300025922 Bacteria 1652
246 Ga0207681_10067706 3300025923 Bacteria 2477
247 Ga0207681_10252370 3300025923 Unclassified 1378
248 Ga0207650_10015135 3300025925 Bacteria 5368
249 Ga0207650_10081620 3300025925 Bacteria 2453
250 Ga0207650_10813216 3300025925 Bacteria 792
251 Ga0207659_10274829 3300025926 Bacteria 1375
252 Ga0207659_10277287 3300025926 Bacteria 1369
253 Ga0207687_10044376 3300025927 Bacteria 3067
254 Ga0207644_10552467 3300025931 Bacteria 953
255 Ga0207706_10010970 3300025933 Bacteria 8262
256 Ga0207706_10183880 3300025933 Bacteria 1835
257 Ga0207706_10270212 3300025933 Bacteria 1484
258 Ga0207706_10554728 3300025933 Bacteria 989
259 Ga0207670_10020079 3300025936 Bacteria 4097
260 Ga0207670_10033056 3300025936 Unclassified 3331
261 Ga0207704_10050801 3300025938 Bacteria 2503
262 Ga0207704_10163187 3300025938 Bacteria 1588
263 Ga0207704_10555631 3300025938 Unclassified 933
264 Ga0207691_10071386 3300025940 Bacteria 3133
265 Ga0207691_10271899 3300025940 Bacteria 1459
266 Ga0207711_10143756 3300025941 Bacteria 2148
267 Ga0207689_10015826 3300025942 Bacteria 6387
268 Ga0207689_10027918 3300025942 Bacteria 4722
269 Ga0207689_10034611 3300025942 Bacteria 4195
270 Ga0207689_10051857 3300025942 Bacteria 3382
271 Ga0207689_10243508 3300025942 Bacteria 1487
272 Ga0207661_10101784 3300025944 Bacteria 2414
273 Ga0207661_10193171 3300025944 Bacteria 1786
274 Ga0207661_10428693 3300025944 Bacteria 1202
275 Ga0207679_10049718 3300025945 Unclassified 3060
276 Ga0207679_10199430 3300025945 Bacteria 1671
277 Ga0207667_10000939 3300025949 Bacteria 37174
278 Ga0207667_10206768 3300025949 Bacteria 2012
279 Ga0207651_10136894 3300025960 Bacteria 1885
280 Ga0207712_10078029 3300025961 Unclassified 2402
281 Ga0207712_10222654 3300025961 Bacteria 1509
282 Ga0207668_10470377 3300025972 Bacteria 1076
283 Ga0207640_10043730 3300025981 Unclassified 2864
284 Ga0207658_10028055 3300025986 Bacteria 3962
285 Ga0207658_10045909 3300025986 Bacteria 3187
286 Ga0207658_10081393 3300025986 Bacteria 2483
287 Ga0207658_10182995 3300025986 Bacteria 1736
288 Ga0207677_10121764 3300026023 Bacteria 1964
289 Ga0207703_10036627 3300026035 Bacteria 3906
290 Ga0207703_11271264 3300026035 Bacteria 708
291 Ga0207639_10258999 3300026041 Bacteria 1520
292 Ga0207639_10296802 3300026041 Unclassified 1427
293 Ga0207639_10613998 3300026041 Unclassified 1004
294 Ga0207639_11166092 3300026041 Bacteria 723
295 Ga0207678_10008806 3300026067 Bacteria 8881
296 Ga0207702_10026746 3300026078 Bacteria 4790
297 Ga0207641_10018228 3300026088 Bacteria 5755
298 Ga0207641_10050858 3300026088 Bacteria 3508
299 Ga0207641_10079610 3300026088 Bacteria 2841
300 Ga0207641_10161796 3300026088 Bacteria 2036
301 Ga0207641_11120714 3300026088 Bacteria 786
302 Ga0207648_10003831 3300026089 Bacteria 15710
303 Ga0207648_10019106 3300026089 Bacteria 6183
304 Ga0207648_10099662 3300026089 Bacteria 2545
305 Ga0207648_11119477 3300026089 Bacteria 739
306 Ga0207676_10020328 3300026095 Bacteria 4857
307 Ga0207676_10037178 3300026095 Bacteria 3709
308 Ga0207676_10039474 3300026095 Bacteria 3611
309 Ga0207676_10225449 3300026095 Bacteria 1672
310 Ga0207674_10020654 3300026116 Bacteria 7110
311 Ga0207674_10167574 3300026116 Unclassified 2150
312 Ga0207674_10412084 3300026116 Bacteria 1306
313 Ga0207675_100181426 3300026118 Bacteria 2016
314 Ga0207675_100768515 3300026118 Bacteria 975
315 Ga0207683_10001161 3300026121 Bacteria 23877
316 Ga0207698_10014187 3300026142 Bacteria 5287
317 Ga0207698_10420578 3300026142 Bacteria 1282
318 Ga0209998_10007752 3300027717 Bacteria 2228
319 Ga0268266_10115569 3300028379 Unclassified 2382
320 Ga0268266_10233211 3300028379 Bacteria 1696
321 Ga0268266_10439923 3300028379 Bacteria 1238
322 Ga0268266_11042440 3300028379 Bacteria 791
323 Ga0268265_10084529 3300028380 Bacteria 2516
324 Ga0268264_10876210 3300028381 Bacteria 900
325 Ga0307515_10054365 3300028794 Bacteria 5879
326 Ga0265338_10037218 3300028800 Bacteria 4638
327 Ga0316179_1081349 3300030734 Unclassified 1231
328 Ga0265332_10001928 3300031238 Bacteria 10964
329 Ga0265327_10000906 3300031251 Bacteria 43527
330 Ga0265327_10050705 3300031251 Unclassified 2170
331 Ga0307513_10319611 3300031456 Bacteria 1311
332 Ga0307513_10691105 3300031456 Bacteria 726
333 Ga0307408_100028745 3300031548 Bacteria 3845
334 Ga0307508_10289567 3300031616 Bacteria 1231
335 Ga0307508_10371398 3300031616 Bacteria 1021
336 Ga0307516_10038029 3300031730 Bacteria 4806
337 Ga0307405_10448627 3300031731 Unclassified 1022
338 Ga0307410_10000383 3300031852 Bacteria 17335
339 Ga0307406_10000455 3300031901 Bacteria 23789
340 Ga0307406_10029863 3300031901 Bacteria 3304
341 Ga0307406_10189121 3300031901 Bacteria 1506
342 Ga0307407_10006908 3300031903 Bacteria 5097
343 Ga0307412_10183897 3300031911 Bacteria 1574
344 Ga0307414_10000008 3300032004 Bacteria 375832
345 Ga0307414_10012080 3300032004 Bacteria 5095
346 Ga0307414_10638469 3300032004 Bacteria 959
347 Ga0307411_10044526 3300032005 Bacteria 2848
348 Ga0307415_100548560 3300032126 Bacteria 1020
349 Ga0307507_10064853 3300033179 Bacteria 3366
350 Ga0373955_0109825 3300035172 Bacteria 1594
351 Ga0373955_0618452 3300035172 Bacteria 664
352 Ga0373961_0000011 3300035241 Bacteria 127972
353 Ga0316574_0090466 3300035398 Unclassified 1951
354 Ga0373935_0619011 3300035692 Bacteria 793
355 Ga0373933_0109976 3300035724 Bacteria 1718
356 Ga0373933_0292412 3300035724 Bacteria 1054
357 Ga0395899_0020258 3300037312 Bacteria 5047
358 Ga0395900_0004002 3300037418 Bacteria 15738
359 Ga0395898_0007899 3300037466 Bacteria 11290
360 Ga0395898_0170216 3300037466 Bacteria 2082
361 Ga0395905_0090913 3300037471 Bacteria 2862
362 Ga0395901_0311103 3300038443 Unclassified 1631
363 Ga0436365_1733403 3300039437 Bacteria 1038
364 Ga0439439_0047984 3300041406 Bacteria 1116
365 Ga0439439_0068394 3300041406 Bacteria 949
366 Ga0439466_0000213 3300041411 Bacteria 22681
367 Ga0439466_0117150 3300041411 Bacteria 824
368 Ga0451839_0534697 3300041496 Bacteria 678
369 Ga0451841_1293190 3300041498 Bacteria 687
370 Ga0451577_0000008 3300042876 Bacteria 692992
371 Ga0451577_0003746 3300042876 Bacteria 16574
372 Ga0451577_0028505 3300042876 Bacteria 5049
373 Ga0451577_0123012 3300042876 Bacteria 2324
374 Ga0451577_0889844 3300042876 Unclassified 802
375 Ga0453683_0042284 3300044673 Bacteria 2861
376 Ga0453684_0000032 3300044712 Bacteria 745626
377 Ga0453684_0001907 3300044712 Bacteria 54115
378 Ga0453684_0002385 3300044712 Bacteria 45843
379 Ga0453684_0011758 3300044712 Bacteria 14595
380 Ga0453684_0018648 3300044712 Bacteria 10635
381 Ga0453684_0093181 3300044712 Bacteria 3711
382 Ga0453684_0166161 3300044712 Bacteria 2605
383 Ga0453684_0179493 3300044712 Unclassified 2486
384 Ga0451576_0029734 3300045051 Bacteria 5845
385 Ga0451576_0060581 3300045051 Bacteria 3948
386 Ga0451576_0179505 3300045051 Bacteria 2210
387 Ga0495592_0198618 3300046454 Bacteria 1355
388 Ga0495651_0044057 3300046462 Bacteria 3459
389 Ga0495580_0081119 3300046472 Bacteria 2261
390 Ga0495582_0317916 3300046473 Bacteria 896
391 Ga0495618_0206101 3300046514 Bacteria 1244
392 Ga0495628_0017613 3300046516 Bacteria 5942
393 Ga0495652_0090643 3300046529 Unclassified 2501
394 Ga0495654_0083710 3300046530 Bacteria 1491
395 Ga0495665_0345229 3300046531 Bacteria 758
396 Ga0495586_0043647 3300046535 Bacteria 2415
397 Ga0495587_0025513 3300046536 Bacteria 3612
398 Ga0495634_0229759 3300046642 Bacteria 1142
399 Ga0495635_0149695 3300046663 Bacteria 1589
400 Ga0495635_0307193 3300046663 Bacteria 1063
401 Ga0495658_0084938 3300046683 Bacteria 1865
402 Ga0495649_0234717 3300046694 Bacteria 946
403 Ga0495600_0298018 3300046809 Bacteria 1018
404 Ga0495674_0587982 3300047319 Bacteria 883
405 Ga0495686_0002155 3300047472 Bacteria 19212
406 Ga0495686_0095390 3300047472 Bacteria 1801
407 Ga0495602_0071488 3300048088 Bacteria 2963
408 Ga0496113_0447427 3300048916 Bacteria 1038
409 Ga0496121_0029166 3300048924 Bacteria 5113
410 Ga0496125_0205891 3300048928 Bacteria 1283
411 Ga0501031_0027896 3300049568 Bacteria 3680
412 Ga0501033_0278715 3300049570 Bacteria 1180
413 Ga0501036_0000449 3300049572 Archaea 29391
414 Ga0501037_0034787 3300049573 Bacteria 3717
415 Ga0501038_0007998 3300049574 Bacteria 9746
416 Ga0501039_0007732 3300049575 Bacteria 8202
417 Ga0501040_0021198 3300049576 Bacteria 4336
418 Ga0501041_0000004 3300049577 Archaea 79389
419 Ga0501042_0009131 3300049578 Bacteria 6592
420 Ga0501046_0007219 3300049580 Bacteria 9766
421 Ga0501048_0014521 3300049582 Bacteria 5829
422 Ga0501069_0252447 3300049585 Bacteria 1029
423 Ga0501071_0001059 3300049587 Archaea 15240
424 Ga0501072_0000222 3300049588 Archaea 41727
425 Ga0501073_0135030 3300049589 Bacteria 1710
426 Ga0501074_0003785 3300049590 Bacteria 10748
427 Ga0501076_0000527 3300049592 Archaea 24320
428 Ga0501077_0004359 3300049593 Bacteria 8581
429 Ga0501238_000069 3300049671 Bacteria 16725
430 Ga0501249_000006 3300049679 Bacteria 224148
431 Ga0501249_001669 3300049679 Bacteria 4535
432 Ga0501079_0000588 3300049741 Archaea 24052
433 Ga0501080_0698909 3300049742 Bacteria 894
434 Ga0501081_0000709 3300049743 Archaea 19301
435 Ga0501083_0219934 3300049744 Bacteria 1237
436 Ga0501269_001022 3300049766 Bacteria 3980
437 Ga0501280_004250 3300049776 Bacteria 2117
438 Ga0501035_0007366 3300049822 Bacteria 10284
439 Ga0501044_0411342 3300049823 Bacteria 1264
440 nmdc:mga05p37_940944_c1 3300050507 Bacteria 926
441 nmdc:mga0n895_52765_c1 3300050512 Bacteria 3993
442 nmdc:mga0rr50_27676_c1 3300050513 Bacteria 3974
443 nmdc:mga0rr50_83057_c1 3300050513 Bacteria 2476
444 nmdc:mga08x19_18244_c1 3300050514 Bacteria 4300
445 nmdc:mga08x19_274761_c1 3300050514 Bacteria 1167
446 nmdc:mga0a205_167670_c1 3300050515 Bacteria 2092
447 Ga0495619_0014195 3300053085 Bacteria 5031
448 Ga0500578_0154370 3300053086 Bacteria 1428
449 Ga0500646_0002618 3300053090 Bacteria 4658
450 Ga0500583_0121064 3300053092 Bacteria 1295
451 Ga0500641_0000009 3300053096 Bacteria 173260
452 Ga0500641_0002806 3300053096 Bacteria 6173
453 Ga0500557_062764 3300053105 Bacteria 1209
454 Ga0500594_0001768 3300053118 Bacteria 4700
455 Ga0500597_055559 3300053120 Bacteria 1693
456 Ga0500658_0000035 3300053134 Bacteria 87202
457 Ga0501084_0020270 3300054114 Bacteria 5543
458 Ga0501082_0000473 3300060353 Archaea 35519
459 Ga0530510_0003731 3300061734 Bacteria 10483
460 Ga0530510_0530789 3300061734 Bacteria 893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10150326 Ga0105242_101503262 168
2 3300009174 Ga0105241_10115600 Ga0105241_101156002 172
3 3300013100 Ga0157373_10000001 Ga0157373_10000001564 175
4 3300015261 Ga0182006_1005750 Ga0182006_10057503 175
5 3300005334 Ga0068869_100219053 Ga0068869_1002190531 177
6 3300005347 Ga0070668_100110564 Ga0070668_1001105642 177
7 3300005353 Ga0070669_100827078 Ga0070669_1008270782 177
8 3300005617 Ga0068859_100638587 Ga0068859_1006385872 177
9 3300006931 Ga0097620_100638596 Ga0097620_1006385962 177
10 3300025942 Ga0207689_10034611 Ga0207689_100346111 177
11 3300026089 Ga0207648_10019106 Ga0207648_100191062 177
12 3300041411 Ga0439466_0000213 Ga0439466_0000213_9010_9579 181
13 3300048928 Ga0496125_0205891 Ga0496125_0205891_640_1266 181
14 3300035172 Ga0373955_0618452 Ga0373955_0618452_85_648 182
15 3300037466 Ga0395898_0170216 Ga0395898_0170216_33_581 182
16 3300038443 Ga0395901_0311103 Ga0395901_0311103_1060_1608 182
17 3300013104 Ga0157370_10000225 Ga0157370_100002255 183
18 3300005518 Ga0070699_100007975 Ga0070699_1000079756 185
19 3300006914 Ga0075436_100027917 Ga0075436_1000279174 185
20 3300006914 Ga0075436_100149028 Ga0075436_1001490281 185
21 3300025922 Ga0207646_10236107 Ga0207646_102361071 185
22 3300031901 Ga0307406_10189121 Ga0307406_101891212 185
23 3300032126 Ga0307415_100548560 Ga0307415_1005485601 185
24 3300045051 Ga0451576_0060581 Ga0451576_0060581_1512_2090 185
25 3300049679 Ga0501249_001669 Ga0501249_001669_3146_3742 185
26 3300050507 nmdc:mga05p37_940944_c1 nmdc:mga05p37_940944_c1_134_715 185
27 3300050512 nmdc:mga0n895_52765_c1 nmdc:mga0n895_52765_c1_2613_3191 185
28 3300050513 nmdc:mga0rr50_27676_c1 nmdc:mga0rr50_27676_c1_884_1462 185
29 3300050513 nmdc:mga0rr50_83057_c1 nmdc:mga0rr50_83057_c1_1817_2395 185
30 3300050514 nmdc:mga08x19_18244_c1 nmdc:mga08x19_18244_c1_2198_2776 185
31 3300050514 nmdc:mga08x19_274761_c1 nmdc:mga08x19_274761_c1_464_1042 185
32 3300050515 nmdc:mga0a205_167670_c1 nmdc:mga0a205_167670_c1_1334_1912 185
33 iso_pu_bacteria 2513020052 2513233126 185
34 iso_pu_bacteria 2643221725 2644683339 185
35 3300025912 Ga0207707_10402066 Ga0207707_104020662 186
36 3300026088 Ga0207641_11120714 Ga0207641_111207141 186
37 3300005334 Ga0068869_100046970 Ga0068869_1000469702 187
38 3300005334 Ga0068869_100099190 Ga0068869_1000991902 187
39 3300005535 Ga0070684_100875760 Ga0070684_1008757601 187
40 3300005549 Ga0070704_100024721 Ga0070704_1000247216 187
41 3300005719 Ga0068861_100061516 Ga0068861_1000615161 187
42 3300006028 Ga0070717_10050283 Ga0070717_100502835 187
43 3300006880 Ga0075429_100043023 Ga0075429_1000430231 187
44 3300013297 Ga0157378_10101745 Ga0157378_101017453 187
45 3300014745 Ga0157377_10646020 Ga0157377_106460202 187
46 3300025918 Ga0207662_10891106 Ga0207662_108911061 187
47 3300025927 Ga0207687_10044376 Ga0207687_100443761 187
48 3300025942 Ga0207689_10051857 Ga0207689_100518573 187
49 3300025942 Ga0207689_10243508 Ga0207689_102435082 187
50 3300026088 Ga0207641_10018228 Ga0207641_100182284 187
51 3300026118 Ga0207675_100768515 Ga0207675_1007685151 187
52 3300031238 Ga0265332_10001928 Ga0265332_100019288 187
53 3300031616 Ga0307508_10289567 Ga0307508_102895671 187
54 3300031616 Ga0307508_10371398 Ga0307508_103713982 187
55 3300031730 Ga0307516_10038029 Ga0307516_100380293 187
56 3300033179 Ga0307507_10064853 Ga0307507_100648534 187
57 3300035241 Ga0373961_0000011 Ga0373961_0000011_1392_1976 187
58 3300045051 Ga0451576_0179505 Ga0451576_0179505_671_1264 187
59 3300046694 Ga0495649_0234717 Ga0495649_0234717_83_667 187
60 3300053086 Ga0500578_0154370 Ga0500578_0154370_457_1041 187
61 3300053090 Ga0500646_0002618 Ga0500646_0002618_362_1177 187
62 3300053092 Ga0500583_0121064 Ga0500583_0121064_608_1195 187
63 3300053120 Ga0500597_055559 Ga0500597_055559_406_1155 187
64 3300061734 Ga0530510_0530789 Ga0530510_0530789_238_828 187
65 3300005466 Ga0070685_10691762 Ga0070685_106917621 188
66 3300025899 Ga0207642_10619221 Ga0207642_106192211 188
67 3300025918 Ga0207662_10302114 Ga0207662_103021141 188
68 3300025961 Ga0207712_10222654 Ga0207712_102226542 188
69 3300028794 Ga0307515_10054365 Ga0307515_100543655 188
70 3300031456 Ga0307513_10319611 Ga0307513_103196111 188
71 3300031901 Ga0307406_10029863 Ga0307406_100298632 188
72 3300042876 Ga0451577_0889844 Ga0451577_0889844_16_591 188
73 3300047472 Ga0495686_0095390 Ga0495686_0095390_774_1439 188
74 3300003316 rootH1_10006979 rootH1_100069796 189
75 3300003320 rootH2_10020236 rootH2_100202364 189
76 3300003322 rootL2_10000502 rootL2_100005027 189
77 3300003323 rootH1_10007354 rootH1_1000735411 189
78 3300005295 Ga0065707_10294338 Ga0065707_102943382 189
79 3300005328 Ga0070676_10043188 Ga0070676_100431883 189
80 3300005331 Ga0070670_100178906 Ga0070670_1001789063 189
81 3300005331 Ga0070670_100249667 Ga0070670_1002496672 189
82 3300005331 Ga0070670_100406950 Ga0070670_1004069502 189
83 3300005334 Ga0068869_100217032 Ga0068869_1002170321 189
84 3300005335 Ga0070666_10061662 Ga0070666_100616623 189
85 3300005338 Ga0068868_100031421 Ga0068868_1000314215 189
86 3300005343 Ga0070687_100094057 Ga0070687_1000940571 189
87 3300005353 Ga0070669_100145364 Ga0070669_1001453641 189
88 3300005354 Ga0070675_100025445 Ga0070675_1000254454 189
89 3300005354 Ga0070675_100406714 Ga0070675_1004067142 189
90 3300005364 Ga0070673_100681809 Ga0070673_1006818092 189
91 3300005367 Ga0070667_100099777 Ga0070667_1000997773 189
92 3300005367 Ga0070667_100267779 Ga0070667_1002677793 189
93 3300005456 Ga0070678_100398877 Ga0070678_1003988771 189
94 3300005457 Ga0070662_100287834 Ga0070662_1002878342 189
95 3300005459 Ga0068867_100158285 Ga0068867_1001582852 189
96 3300005459 Ga0068867_100794225 Ga0068867_1007942251 189
97 3300005539 Ga0068853_100481559 Ga0068853_1004815592 189
98 3300005543 Ga0070672_100240053 Ga0070672_1002400532 189
99 3300005548 Ga0070665_100007019 Ga0070665_1000070194 189
100 3300005548 Ga0070665_100087711 Ga0070665_1000877112 189
101 3300005617 Ga0068859_100008618 Ga0068859_10000861811 189
102 3300005617 Ga0068859_100175113 Ga0068859_1001751132 189
103 3300005843 Ga0068860_100183061 Ga0068860_1001830612 189
104 3300005843 Ga0068860_100305380 Ga0068860_1003053803 189
105 3300006237 Ga0097621_100202765 Ga0097621_1002027653 189
106 3300006358 Ga0068871_100052755 Ga0068871_1000527553 189
107 3300006881 Ga0068865_100033140 Ga0068865_1000331405 189
108 3300006881 Ga0068865_100141563 Ga0068865_1001415632 189
109 3300006931 Ga0097620_100008617 Ga0097620_10000861711 189
110 3300006931 Ga0097620_100175107 Ga0097620_1001751072 189
111 3300009093 Ga0105240_10002821 Ga0105240_1000282116 189
112 3300009098 Ga0105245_11250426 Ga0105245_112504261 189
113 3300010375 Ga0105239_10007190 Ga0105239_100071905 189
114 3300012485 Ga0157325_1000213 Ga0157325_10002134 189
115 3300014326 Ga0157380_10000004 Ga0157380_10000004177 189
116 3300014497 Ga0182008_10032885 Ga0182008_100328852 189
117 3300025900 Ga0207710_10001900 Ga0207710_1000190016 189
118 3300025907 Ga0207645_10125685 Ga0207645_101256853 189
119 3300025921 Ga0207652_10327598 Ga0207652_103275981 189
120 3300025923 Ga0207681_10067706 Ga0207681_100677063 189
121 3300025923 Ga0207681_10252370 Ga0207681_102523702 189
122 3300025926 Ga0207659_10274829 Ga0207659_102748291 189
123 3300025938 Ga0207704_10163187 Ga0207704_101631871 189
124 3300025938 Ga0207704_10555631 Ga0207704_105556311 189
125 3300025940 Ga0207691_10271899 Ga0207691_102718992 189
126 3300025942 Ga0207689_10027918 Ga0207689_100279182 189
127 3300025960 Ga0207651_10136894 Ga0207651_101368943 189
128 3300025986 Ga0207658_10182995 Ga0207658_101829951 189
129 3300026089 Ga0207648_10003831 Ga0207648_100038312 189
130 3300026089 Ga0207648_10099662 Ga0207648_100996623 189
131 3300026095 Ga0207676_10037178 Ga0207676_100371782 189
132 3300026116 Ga0207674_10412084 Ga0207674_104120842 189
133 3300026118 Ga0207675_100181426 Ga0207675_1001814261 189
134 3300026121 Ga0207683_10001161 Ga0207683_1000116112 189
135 3300028381 Ga0268264_10876210 Ga0268264_108762102 189
136 3300030734 Ga0316179_1081349 Ga0316179_10813491 189
137 3300031548 Ga0307408_100028745 Ga0307408_1000287454 189
138 3300031731 Ga0307405_10448627 Ga0307405_104486271 189
139 3300031852 Ga0307410_10000383 Ga0307410_1000038310 189
140 3300031901 Ga0307406_10000455 Ga0307406_100004555 189
141 3300031903 Ga0307407_10006908 Ga0307407_100069082 189
142 3300031911 Ga0307412_10183897 Ga0307412_101838972 189
143 3300032004 Ga0307414_10000008 Ga0307414_1000000891 189
144 3300032005 Ga0307411_10044526 Ga0307411_100445261 189
145 3300041496 Ga0451839_0534697 Ga0451839_0534697_14_598 189
146 3300041498 Ga0451841_1293190 Ga0451841_1293190_50_619 189
147 3300046514 Ga0495618_0206101 Ga0495618_0206101_629_1213 189
148 3300046530 Ga0495654_0083710 Ga0495654_0083710_373_942 189
149 3300046536 Ga0495587_0025513 Ga0495587_0025513_491_1075 189
150 3300048924 Ga0496121_0029166 Ga0496121_0029166_2817_3386 189
151 3300053096 Ga0500641_0000009 Ga0500641_0000009_100839_101408 189
152 3300005334 Ga0068869_100153019 Ga0068869_1001530192 191
153 3300006358 Ga0068871_100317132 Ga0068871_1003171322 191
154 3300013297 Ga0157378_10439851 Ga0157378_104398512 191
155 3300032004 Ga0307414_10638469 Ga0307414_106384692 191
156 3300035398 Ga0316574_0090466 Ga0316574_0090466_464_1048 191
157 3300003320 rootH2_10294655 rootH2_102946552 192
158 3300003323 rootH1_10132622 rootH1_101326221 192
159 3300005355 Ga0070671_100654186 Ga0070671_1006541861 192
160 3300005365 Ga0070688_100984292 Ga0070688_1009842921 192
161 3300005617 Ga0068859_100622158 Ga0068859_1006221582 192
162 3300006931 Ga0097620_100622106 Ga0097620_1006221061 192
163 3300025931 Ga0207644_10552467 Ga0207644_105524671 192
164 3300026041 Ga0207639_11166092 Ga0207639_111660921 192
165 3300026089 Ga0207648_11119477 Ga0207648_111194771 192
166 3300031456 Ga0307513_10691105 Ga0307513_106911051 192
167 iso_pu_bacteria 2588254257 2590614214 193
168 iso_pu_bacteria 2643221667 2644373596 193
169 iso_pu_bacteria 2739367857 2740002136 193
170 iso_pu_bacteria 2739367858 2740006952 193
171 iso_pu_bacteria 2857613821 2857616217 193
172 iso_pu_bacteria 2857618242 2857622612 193
173 iso_pu_bacteria 2904419702 2904423902 193
174 iso_pu_bacteria 2904555929 2904560364 193
175 iso_pu_bacteria 2919683626 2919688135 193
176 iso_pu_bacteria 2929150217 2929154305 193
177 iso_pu_bacteria 2977268062 2977271122 193
178 iso_pu_bacteria 8055592153 8055595530 193
179 3300005331 Ga0070670_100106716 Ga0070670_1001067163 195
180 3300005338 Ga0068868_100001285 Ga0068868_1000012857 195
181 3300005468 Ga0070707_100440696 Ga0070707_1004406962 195
182 3300005563 Ga0068855_100522724 Ga0068855_1005227242 195
183 3300005985 Ga0081539_10010847 Ga0081539_100108477 195
184 3300005985 Ga0081539_10217219 Ga0081539_102172192 195
185 3300013296 Ga0157374_10006784 Ga0157374_100067846 195
186 3300013307 Ga0157372_11388953 Ga0157372_113889531 195
187 3300025925 Ga0207650_10015135 Ga0207650_100151355 195
188 3300035724 Ga0373933_0109976 Ga0373933_0109976_1055_1645 195
189 3300039437 Ga0436365_1733403 Ga0436365_1733403_174_770 195
190 3300042876 Ga0451577_0028505 Ga0451577_0028505_867_1493 195
191 3300042876 Ga0451577_0123012 Ga0451577_0123012_475_1071 195
192 3300044673 Ga0453683_0042284 Ga0453683_0042284_349_942 195
193 3300044712 Ga0453684_0001907 Ga0453684_0001907_53228_53830 195
194 3300044712 Ga0453684_0011758 Ga0453684_0011758_10524_11150 195
195 3300044712 Ga0453684_0093181 Ga0453684_0093181_403_999 195
196 3300048088 Ga0495602_0071488 Ga0495602_0071488_1249_1845 195
197 3300005329 Ga0070683_100197985 Ga0070683_1001979853 196
198 3300005335 Ga0070666_10114338 Ga0070666_101143381 196
199 3300005355 Ga0070671_100046144 Ga0070671_1000461442 196
200 3300005367 Ga0070667_100843996 Ga0070667_1008439961 196
201 3300005539 Ga0068853_100341024 Ga0068853_1003410241 196
202 3300005548 Ga0070665_100466524 Ga0070665_1004665241 196
203 3300005614 Ga0068856_100029827 Ga0068856_1000298273 196
204 3300005616 Ga0068852_100077385 Ga0068852_1000773852 196
205 3300005618 Ga0068864_100642277 Ga0068864_1006422772 196
206 3300005834 Ga0068851_10012120 Ga0068851_100121202 196
207 3300005842 Ga0068858_100087206 Ga0068858_1000872062 196
208 3300006358 Ga0068871_100222067 Ga0068871_1002220672 196
209 3300006881 Ga0068865_100020273 Ga0068865_1000202734 196
210 3300009093 Ga0105240_10118102 Ga0105240_101181024 196
211 3300009147 Ga0114129_10296970 Ga0114129_102969702 196
212 3300009177 Ga0105248_10029771 Ga0105248_100297717 196
213 3300010375 Ga0105239_10066220 Ga0105239_100662206 196
214 3300011119 Ga0105246_11004144 Ga0105246_110041441 196
215 3300013296 Ga0157374_10082098 Ga0157374_100820981 196
216 3300014968 Ga0157379_10064366 Ga0157379_100643664 196
217 3300025321 Ga0207656_10014551 Ga0207656_100145514 196
218 3300025904 Ga0207647_10044422 Ga0207647_100444221 196
219 3300025913 Ga0207695_10133060 Ga0207695_101330604 196
220 3300025913 Ga0207695_10212954 Ga0207695_102129542 196
221 3300025938 Ga0207704_10050801 Ga0207704_100508013 196
222 3300025944 Ga0207661_10428693 Ga0207661_104286932 196
223 3300025949 Ga0207667_10206768 Ga0207667_102067682 196
224 3300025986 Ga0207658_10045909 Ga0207658_100459093 196
225 3300026035 Ga0207703_10036627 Ga0207703_100366272 196
226 3300026041 Ga0207639_10258999 Ga0207639_102589991 196
227 3300026078 Ga0207702_10026746 Ga0207702_100267463 196
228 3300026095 Ga0207676_10020328 Ga0207676_100203284 196
229 3300026116 Ga0207674_10020654 Ga0207674_100206543 196
230 3300028379 Ga0268266_11042440 Ga0268266_110424401 196
231 3300042876 Ga0451577_0000008 Ga0451577_0000008_570539_571135 196
232 3300044712 Ga0453684_0000032 Ga0453684_0000032_619693_620289 196
233 3300044712 Ga0453684_0018648 Ga0453684_0018648_5516_6112 196
234 3300045051 Ga0451576_0029734 Ga0451576_0029734_488_1081 196
235 3300053105 Ga0500557_062764 Ga0500557_062764_441_1046 196
236 3300000044 ARSoilOldRDRAFT_c000802 ARSoilOldRDRAFT_0008021 197
237 3300001904 JGI24736J21556_1002052 JGI24736J21556_10020522 197
238 3300003320 rootH2_10238081 rootH2_102380815 197
239 3300003322 rootL2_10362377 rootL2_103623772 197
240 3300003323 rootH1_10013909 rootH1_100139093 197
241 3300004803 Ga0058862_12229543 Ga0058862_122295431 197
242 3300005288 Ga0065714_10030687 Ga0065714_100306871 197
243 3300005288 Ga0065714_10075644 Ga0065714_100756442 197
244 3300005288 Ga0065714_10134041 Ga0065714_101340411 197
245 3300005293 Ga0065715_10198767 Ga0065715_101987672 197
246 3300005329 Ga0070683_100000340 Ga0070683_1000003404 197
247 3300005329 Ga0070683_100012066 Ga0070683_1000120668 197
248 3300005329 Ga0070683_100096310 Ga0070683_1000963103 197
249 3300005329 Ga0070683_100236006 Ga0070683_1002360062 197
250 3300005331 Ga0070670_100104026 Ga0070670_1001040263 197
251 3300005331 Ga0070670_100300978 Ga0070670_1003009782 197
252 3300005334 Ga0068869_100024298 Ga0068869_1000242984 197
253 3300005335 Ga0070666_10350044 Ga0070666_103500442 197
254 3300005338 Ga0068868_100064364 Ga0068868_1000643642 197
255 3300005340 Ga0070689_100030759 Ga0070689_1000307596 197
256 3300005340 Ga0070689_100052889 Ga0070689_1000528893 197
257 3300005347 Ga0070668_100496287 Ga0070668_1004962871 197
258 3300005354 Ga0070675_100166416 Ga0070675_1001664162 197
259 3300005355 Ga0070671_100221313 Ga0070671_1002213132 197
260 3300005355 Ga0070671_100448258 Ga0070671_1004482581 197
261 3300005364 Ga0070673_100117267 Ga0070673_1001172671 197
262 3300005364 Ga0070673_101074356 Ga0070673_1010743562 197
263 3300005365 Ga0070688_100171800 Ga0070688_1001718002 197
264 3300005366 Ga0070659_100479509 Ga0070659_1004795091 197
265 3300005367 Ga0070667_100039817 Ga0070667_1000398171 197
266 3300005367 Ga0070667_100403487 Ga0070667_1004034872 197
267 3300005440 Ga0070705_100106905 Ga0070705_1001069052 197
268 3300005457 Ga0070662_100137834 Ga0070662_1001378342 197
269 3300005458 Ga0070681_10877185 Ga0070681_108771851 197
270 3300005466 Ga0070685_10184970 Ga0070685_101849702 197
271 3300005518 Ga0070699_100711733 Ga0070699_1007117331 197
272 3300005535 Ga0070684_100005785 Ga0070684_1000057854 197
273 3300005535 Ga0070684_100506807 Ga0070684_1005068072 197
274 3300005539 Ga0068853_100079545 Ga0068853_1000795453 197
275 3300005539 Ga0068853_100159616 Ga0068853_1001596162 197
276 3300005539 Ga0068853_100324770 Ga0068853_1003247701 197
277 3300005543 Ga0070672_100039166 Ga0070672_1000391663 197
278 3300005547 Ga0070693_100356773 Ga0070693_1003567731 197
279 3300005548 Ga0070665_100257547 Ga0070665_1002575472 197
280 3300005548 Ga0070665_100334853 Ga0070665_1003348532 197
281 3300005563 Ga0068855_100000093 Ga0068855_10000009363 197
282 3300005564 Ga0070664_100058151 Ga0070664_1000581513 197
283 3300005564 Ga0070664_100341606 Ga0070664_1003416063 197
284 3300005564 Ga0070664_100805314 Ga0070664_1008053142 197
285 3300005577 Ga0068857_100212892 Ga0068857_1002128922 197
286 3300005577 Ga0068857_101068240 Ga0068857_1010682401 197
287 3300005577 Ga0068857_101575151 Ga0068857_1015751511 197
288 3300005578 Ga0068854_100026640 Ga0068854_1000266402 197
289 3300005578 Ga0068854_100255844 Ga0068854_1002558442 197
290 3300005616 Ga0068852_100099384 Ga0068852_1000993843 197
291 3300005617 Ga0068859_100073649 Ga0068859_1000736493 197
292 3300005617 Ga0068859_100717068 Ga0068859_1007170681 197
293 3300005618 Ga0068864_100013566 Ga0068864_1000135667 197
294 3300005618 Ga0068864_100496075 Ga0068864_1004960752 197
295 3300005618 Ga0068864_101356644 Ga0068864_1013566441 197
296 3300005841 Ga0068863_100150379 Ga0068863_1001503791 197
297 3300005842 Ga0068858_101139891 Ga0068858_1011398912 197
298 3300005843 Ga0068860_100180009 Ga0068860_1001800092 197
299 3300005844 Ga0068862_100484726 Ga0068862_1004847262 197
300 3300005937 Ga0081455_10096552 Ga0081455_100965522 197
301 3300006175 Ga0070712_100230837 Ga0070712_1002308371 197
302 3300006237 Ga0097621_100116174 Ga0097621_1001161742 197
303 3300006358 Ga0068871_100327647 Ga0068871_1003276472 197
304 3300006358 Ga0068871_100409419 Ga0068871_1004094192 197
305 3300006358 Ga0068871_100453614 Ga0068871_1004536141 197
306 3300006931 Ga0097620_100073651 Ga0097620_1000736514 197
307 3300006931 Ga0097620_100717070 Ga0097620_1007170701 197
308 3300009011 Ga0105251_10080724 Ga0105251_100807243 197
309 3300009093 Ga0105240_10070908 Ga0105240_100709084 197
310 3300009101 Ga0105247_10001974 Ga0105247_100019749 197
311 3300009174 Ga0105241_10130192 Ga0105241_101301924 197
312 3300009174 Ga0105241_10423015 Ga0105241_104230151 197
313 3300009176 Ga0105242_10200993 Ga0105242_102009932 197
314 3300009176 Ga0105242_10475687 Ga0105242_104756872 197
315 3300009545 Ga0105237_10025376 Ga0105237_100253763 197
316 3300009545 Ga0105237_10028347 Ga0105237_100283476 197
317 3300009553 Ga0105249_10001743 Ga0105249_100017433 197
318 3300009553 Ga0105249_10024457 Ga0105249_100244574 197
319 3300009553 Ga0105249_10642942 Ga0105249_106429422 197
320 3300010375 Ga0105239_10027092 Ga0105239_100270924 197
321 3300010375 Ga0105239_10679272 Ga0105239_106792722 197
322 3300010375 Ga0105239_10689244 Ga0105239_106892441 197
323 3300011119 Ga0105246_10193776 Ga0105246_101937763 197
324 3300013102 Ga0157371_10430152 Ga0157371_104301522 197
325 3300013296 Ga0157374_10098690 Ga0157374_100986903 197
326 3300013296 Ga0157374_10144241 Ga0157374_101442412 197
327 3300013296 Ga0157374_10228259 Ga0157374_102282592 197
328 3300013297 Ga0157378_10330928 Ga0157378_103309282 197
329 3300013297 Ga0157378_10351138 Ga0157378_103511382 197
330 3300013297 Ga0157378_10595080 Ga0157378_105950802 197
331 3300013306 Ga0163162_10022971 Ga0163162_100229715 197
332 3300013306 Ga0163162_10179505 Ga0163162_101795053 197
333 3300013306 Ga0163162_10451885 Ga0163162_104518851 197
334 3300013306 Ga0163162_10579925 Ga0163162_105799252 197
335 3300013308 Ga0157375_10009836 Ga0157375_100098363 197
336 3300013308 Ga0157375_10145361 Ga0157375_101453614 197
337 3300013308 Ga0157375_10776770 Ga0157375_107767701 197
338 3300014325 Ga0163163_10020021 Ga0163163_100200212 197
339 3300014325 Ga0163163_10054610 Ga0163163_100546103 197
340 3300014325 Ga0163163_10159453 Ga0163163_101594534 197
341 3300014325 Ga0163163_10420029 Ga0163163_104200293 197
342 3300014325 Ga0163163_10443685 Ga0163163_104436852 197
343 3300014325 Ga0163163_10569837 Ga0163163_105698371 197
344 3300014745 Ga0157377_10004811 Ga0157377_100048118 197
345 3300014745 Ga0157377_10411338 Ga0157377_104113381 197
346 3300014968 Ga0157379_10033211 Ga0157379_100332111 197
347 3300014968 Ga0157379_10075205 Ga0157379_100752051 197
348 3300014968 Ga0157379_10476623 Ga0157379_104766232 197
349 3300014969 Ga0157376_10254141 Ga0157376_102541412 197
350 3300014969 Ga0157376_10358137 Ga0157376_103581372 197
351 3300015265 Ga0182005_1050940 Ga0182005_10509401 197
352 3300017792 Ga0163161_10300625 Ga0163161_103006252 197
353 3300025272 Ga0209455_1007389 Ga0209455_10073892 197
354 3300025903 Ga0207680_10414255 Ga0207680_104142551 197
355 3300025904 Ga0207647_10046356 Ga0207647_100463563 197
356 3300025904 Ga0207647_10066109 Ga0207647_100661093 197
357 3300025909 Ga0207705_10403139 Ga0207705_104031392 197
358 3300025911 Ga0207654_10259118 Ga0207654_102591182 197
359 3300025913 Ga0207695_10036241 Ga0207695_100362414 197
360 3300025913 Ga0207695_10132875 Ga0207695_101328755 197
361 3300025913 Ga0207695_10443345 Ga0207695_104433452 197
362 3300025914 Ga0207671_10000318 Ga0207671_1000031833 197
363 3300025914 Ga0207671_10070197 Ga0207671_100701973 197
364 3300025920 Ga0207649_10030755 Ga0207649_100307555 197
365 3300025925 Ga0207650_10081620 Ga0207650_100816203 197
366 3300025925 Ga0207650_10813216 Ga0207650_108132161 197
367 3300025926 Ga0207659_10277287 Ga0207659_102772871 197
368 3300025933 Ga0207706_10010970 Ga0207706_100109702 197
369 3300025933 Ga0207706_10183880 Ga0207706_101838803 197
370 3300025933 Ga0207706_10270212 Ga0207706_102702123 197
371 3300025933 Ga0207706_10554728 Ga0207706_105547281 197
372 3300025936 Ga0207670_10020079 Ga0207670_100200792 197
373 3300025936 Ga0207670_10033056 Ga0207670_100330563 197
374 3300025940 Ga0207691_10071386 Ga0207691_100713864 197
375 3300025941 Ga0207711_10143756 Ga0207711_101437563 197
376 3300025942 Ga0207689_10015826 Ga0207689_100158265 197
377 3300025944 Ga0207661_10101784 Ga0207661_101017842 197
378 3300025944 Ga0207661_10193171 Ga0207661_101931713 197
379 3300025945 Ga0207679_10049718 Ga0207679_100497183 197
380 3300025945 Ga0207679_10199430 Ga0207679_101994301 197
381 3300025949 Ga0207667_10000939 Ga0207667_1000093921 197
382 3300025961 Ga0207712_10078029 Ga0207712_100780291 197
383 3300025972 Ga0207668_10470377 Ga0207668_104703772 197
384 3300025981 Ga0207640_10043730 Ga0207640_100437304 197
385 3300025986 Ga0207658_10028055 Ga0207658_100280552 197
386 3300025986 Ga0207658_10081393 Ga0207658_100813934 197
387 3300026023 Ga0207677_10121764 Ga0207677_101217642 197
388 3300026035 Ga0207703_11271264 Ga0207703_112712641 197
389 3300026041 Ga0207639_10296802 Ga0207639_102968021 197
390 3300026041 Ga0207639_10613998 Ga0207639_106139982 197
391 3300026067 Ga0207678_10008806 Ga0207678_1000880612 197
392 3300026088 Ga0207641_10050858 Ga0207641_100508582 197
393 3300026088 Ga0207641_10079610 Ga0207641_100796102 197
394 3300026088 Ga0207641_10161796 Ga0207641_101617963 197
395 3300026095 Ga0207676_10039474 Ga0207676_100394746 197
396 3300026095 Ga0207676_10225449 Ga0207676_102254492 197
397 3300026116 Ga0207674_10167574 Ga0207674_101675742 197
398 3300026142 Ga0207698_10014187 Ga0207698_100141873 197
399 3300026142 Ga0207698_10420578 Ga0207698_104205782 197
400 3300027717 Ga0209998_10007752 Ga0209998_100077522 197
401 3300028379 Ga0268266_10115569 Ga0268266_101155692 197
402 3300028379 Ga0268266_10233211 Ga0268266_102332112 197
403 3300028379 Ga0268266_10439923 Ga0268266_104399232 197
404 3300028380 Ga0268265_10084529 Ga0268265_100845292 197
405 3300028800 Ga0265338_10037218 Ga0265338_100372185 197
406 3300031251 Ga0265327_10000906 Ga0265327_1000090639 197
407 3300031251 Ga0265327_10050705 Ga0265327_100507052 197
408 3300032004 Ga0307414_10012080 Ga0307414_100120802 197
409 3300035172 Ga0373955_0109825 Ga0373955_0109825_841_1449 197
410 3300035692 Ga0373935_0619011 Ga0373935_0619011_58_666 197
411 3300035724 Ga0373933_0292412 Ga0373933_0292412_244_852 197
412 3300037312 Ga0395899_0020258 Ga0395899_0020258_448_1041 197
413 3300037418 Ga0395900_0004002 Ga0395900_0004002_7498_8091 197
414 3300037466 Ga0395898_0007899 Ga0395898_0007899_7020_7613 197
415 3300037471 Ga0395905_0090913 Ga0395905_0090913_626_1234 197
416 3300041406 Ga0439439_0047984 Ga0439439_0047984_95_688 197
417 3300041406 Ga0439439_0068394 Ga0439439_0068394_78_686 197
418 3300041411 Ga0439466_0117150 Ga0439466_0117150_213_806 197
419 3300042876 Ga0451577_0003746 Ga0451577_0003746_5309_5920 197
420 3300044712 Ga0453684_0002385 Ga0453684_0002385_38687_39298 197
421 3300044712 Ga0453684_0166161 Ga0453684_0166161_1212_1820 197
422 3300044712 Ga0453684_0179493 Ga0453684_0179493_58_660 197
423 3300046454 Ga0495592_0198618 Ga0495592_0198618_301_909 197
424 3300046462 Ga0495651_0044057 Ga0495651_0044057_549_1142 197
425 3300046472 Ga0495580_0081119 Ga0495580_0081119_839_1447 197
426 3300046473 Ga0495582_0317916 Ga0495582_0317916_41_649 197
427 3300046516 Ga0495628_0017613 Ga0495628_0017613_3275_3883 197
428 3300046529 Ga0495652_0090643 Ga0495652_0090643_793_1386 197
429 3300046531 Ga0495665_0345229 Ga0495665_0345229_35_643 197
430 3300046535 Ga0495586_0043647 Ga0495586_0043647_1479_2087 197
431 3300046642 Ga0495634_0229759 Ga0495634_0229759_234_842 197
432 3300046663 Ga0495635_0149695 Ga0495635_0149695_870_1478 197
433 3300046663 Ga0495635_0307193 Ga0495635_0307193_23_631 197
434 3300046683 Ga0495658_0084938 Ga0495658_0084938_619_1227 197
435 3300046809 Ga0495600_0298018 Ga0495600_0298018_119_727 197
436 3300047319 Ga0495674_0587982 Ga0495674_0587982_247_855 197
437 3300047472 Ga0495686_0002155 Ga0495686_0002155_7187_7795 197
438 3300048916 Ga0496113_0447427 Ga0496113_0447427_99_707 197
439 3300049568 Ga0501031_0027896 Ga0501031_0027896_42_638 197
440 3300049570 Ga0501033_0278715 Ga0501033_0278715_559_1155 197
441 3300049572 Ga0501036_0000449 Ga0501036_0000449_2812_3408 197
442 3300049573 Ga0501037_0034787 Ga0501037_0034787_2683_3279 197
443 3300049574 Ga0501038_0007998 Ga0501038_0007998_2216_2812 197
444 3300049575 Ga0501039_0007732 Ga0501039_0007732_1241_1837 197
445 3300049576 Ga0501040_0021198 Ga0501040_0021198_248_844 197
446 3300049577 Ga0501041_0000004 Ga0501041_0000004_46142_46738 197
447 3300049578 Ga0501042_0009131 Ga0501042_0009131_4409_5005 197
448 3300049580 Ga0501046_0007219 Ga0501046_0007219_8810_9406 197
449 3300049582 Ga0501048_0014521 Ga0501048_0014521_3872_4468 197
450 3300049585 Ga0501069_0252447 Ga0501069_0252447_79_675 197
451 3300049587 Ga0501071_0001059 Ga0501071_0001059_6019_6615 197
452 3300049588 Ga0501072_0000222 Ga0501072_0000222_24653_25249 197
453 3300049589 Ga0501073_0135030 Ga0501073_0135030_775_1371 197
454 3300049590 Ga0501074_0003785 Ga0501074_0003785_8991_9587 197
455 3300049592 Ga0501076_0000527 Ga0501076_0000527_19715_20311 197
456 3300049593 Ga0501077_0004359 Ga0501077_0004359_5721_6317 197
457 3300049671 Ga0501238_000069 Ga0501238_000069_4675_5268 197
458 3300049679 Ga0501249_000006 Ga0501249_000006_217240_217899 197
459 3300049741 Ga0501079_0000588 Ga0501079_0000588_15845_16441 197
460 3300049742 Ga0501080_0698909 Ga0501080_0698909_262_858 197
461 3300049743 Ga0501081_0000709 Ga0501081_0000709_2677_3273 197
462 3300049744 Ga0501083_0219934 Ga0501083_0219934_410_1006 197
463 3300049766 Ga0501269_001022 Ga0501269_001022_3376_3969 197
464 3300049776 Ga0501280_004250 Ga0501280_004250_153_746 197
465 3300049822 Ga0501035_0007366 Ga0501035_0007366_8223_8819 197
466 3300049823 Ga0501044_0411342 Ga0501044_0411342_474_1070 197
467 3300053085 Ga0495619_0014195 Ga0495619_0014195_3504_4112 197
468 3300053096 Ga0500641_0002806 Ga0500641_0002806_962_1555 197
469 3300053118 Ga0500594_0001768 Ga0500594_0001768_3303_3896 197
470 3300053134 Ga0500658_0000035 Ga0500658_0000035_75153_75746 197
471 3300054114 Ga0501084_0020270 Ga0501084_0020270_4861_5457 197
472 3300060353 Ga0501082_0000473 Ga0501082_0000473_9831_10427 197
473 3300061734 Ga0530510_0003731 Ga0530510_0003731_2069_2665 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

26

210

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7myl-assembly2.cif.gz_C crystal structure of dfra1 dihydrofolate reductase in complex with trimethoprim 0.8064 3 182
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8013 3 183
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7926 3 183
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7848 3 183
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7804 3 183
ID Description Score Start End Superfamily
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8053 2 187 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8028 4 182 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8011 2 187 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7954 4 182 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7848 3 183 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A5B8WA10-F1-model_v4 Dihydrofolate reductase 0.9771 1 193 GO:0008703
GO:0009231
AF-A0A1H0RL86-F1-model_v4 Dihydrofolate reductase 0.9764 1 193 GO:0008703
GO:0009231
AF-A0A3D9RZI7-F1-model_v4 deleted 0.9757 1 193
AF-A0A364Y113-F1-model_v4 Dihydrofolate reductase 0.9747 1 193 GO:0008703
GO:0009231
AF-A0A3C0B7S5-F1-model_v4 Dihydrofolate reductase 0.9745 1 157 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
92.96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map