F450858

General Info

Members Datasets Scaffolds Average Seq Length
472 321 472 141

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0214535|Ga0439465_0214535_38_550
Length 170
Sequence MCLRDVSWSCPSFIGGRCFFVAIHRLADLSSVMAAYAESFQVRTRGKGTFEITGEVAAIVRRSGIQAGIVTVFVRHTSASLVIMENADPSARRDLEAFFDHLVPEDTPYFVHTYEGPDDMPSHIRMALTRTSEVVPVVNGQMALGTWQGIFLFEHRRAPHQREIVVSVVG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
173 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
188 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
191 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
197 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
198 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
199 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
200 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
201 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
202 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
203 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
204 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
205 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
210 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
221 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
222 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
223 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
224 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
225 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
226 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
227 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
228 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
229 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
230 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
231 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
255 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
256 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
257 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
258 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
259 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
260 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
263 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
264 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
265 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
266 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
267 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
268 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
269 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
270 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
271 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
272 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
273 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
274 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
275 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
276 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
277 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
278 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
279 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
280 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
281 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
282 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
283 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
284 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
285 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
286 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
287 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
293 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
294 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
295 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
296 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
297 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
298 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
299 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
300 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
301 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
302 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
303 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
304 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
308 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
309 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 0
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002805 3300001977 Bacteria 2746
2 JGI24739J22299_10084802 3300001989 Bacteria 969
3 rootH2_10016736 3300003320 Bacteria 18315
4 JGI26129J50193_1001444 3300003349 Bacteria 1612
5 Ga0070658_10098411 3300005327 Bacteria 2416
6 Ga0070676_10005440 3300005328 Bacteria 6786
7 Ga0070676_10072158 3300005328 Bacteria 2075
8 Ga0070683_100121115 3300005329 Bacteria 2472
9 Ga0070690_100089256 3300005330 Bacteria 2027
10 Ga0070690_100423938 3300005330 Unclassified 981
11 Ga0070677_10008591 3300005333 Bacteria 3443
12 Ga0070666_10090799 3300005335 Bacteria 2098
13 Ga0070666_10374814 3300005335 Bacteria 1021
14 Ga0070680_100026972 3300005336 Bacteria 4598
15 Ga0070682_100037128 3300005337 Bacteria 2981
16 Ga0070660_100039287 3300005339 Bacteria 3596
17 Ga0070660_100748973 3300005339 Bacteria 820
18 Ga0070689_100033981 3300005340 Bacteria 3889
19 Ga0070691_10001282 3300005341 Bacteria 10632
20 Ga0070687_100017829 3300005343 Bacteria 3274
21 Ga0070687_100057281 3300005343 Bacteria 2043
22 Ga0070661_100002950 3300005344 Bacteria 11735
23 Ga0070661_100027708 3300005344 Bacteria 4082
24 Ga0070668_100021753 3300005347 Bacteria 4846
25 Ga0070668_100173682 3300005347 Bacteria 1756
26 Ga0070669_100004611 3300005353 Bacteria 9951
27 Ga0070675_100207918 3300005354 Bacteria 1700
28 Ga0070671_100243163 3300005355 Bacteria 1528
29 Ga0070674_100033686 3300005356 Bacteria 3412
30 Ga0070673_100003504 3300005364 Bacteria 9780
31 Ga0070673_100075488 3300005364 Bacteria 2719
32 Ga0070673_100328600 3300005364 Bacteria 1352
33 Ga0070688_100091699 3300005365 Bacteria 1986
34 Ga0070659_100011236 3300005366 Bacteria 6615
35 Ga0070667_101807059 3300005367 Bacteria 575
36 Ga0070711_100002612 3300005439 Bacteria 10315
37 Ga0070700_100012173 3300005441 Bacteria 4791
38 Ga0070700_101151856 3300005441 Unclassified 645
39 Ga0070694_100007190 3300005444 Bacteria 6778
40 Ga0070694_100012488 3300005444 Bacteria 5283
41 Ga0070694_100016436 3300005444 Bacteria 4657
42 Ga0070708_100135896 3300005445 Bacteria 2277
43 Ga0070663_100046777 3300005455 Bacteria 3063
44 Ga0070678_100073493 3300005456 Bacteria 2566
45 Ga0070662_100221613 3300005457 Bacteria 1509
46 Ga0070681_10047655 3300005458 Bacteria 4284
47 Ga0068867_100000121 3300005459 Bacteria 49744
48 Ga0070685_10252347 3300005466 Bacteria 1169
49 Ga0070706_100003758 3300005467 Bacteria 14825
50 Ga0070707_100000830 3300005468 Bacteria 30547
51 Ga0070698_100000901 3300005471 Bacteria 32627
52 Ga0070698_100231387 3300005471 Bacteria 1781
53 Ga0070699_100001545 3300005518 Bacteria 21044
54 Ga0070699_100112603 3300005518 Bacteria 2390
55 Ga0070679_100201903 3300005530 Bacteria 1954
56 Ga0070684_100450694 3300005535 Bacteria 1189
57 Ga0070697_100059029 3300005536 Bacteria 3122
58 Ga0070697_100095442 3300005536 Bacteria 2466
59 Ga0070697_100113855 3300005536 Bacteria 2257
60 Ga0068853_100340528 3300005539 Bacteria 1393
61 Ga0070686_100001095 3300005544 Bacteria 15614
62 Ga0070686_100010450 3300005544 Bacteria 5234
63 Ga0070686_100235167 3300005544 Bacteria 1331
64 Ga0070695_100004355 3300005545 Bacteria 8299
65 Ga0070696_100002650 3300005546 Bacteria 11864
66 Ga0070665_100258759 3300005548 Bacteria 1742
67 Ga0070704_100750009 3300005549 Bacteria 869
68 Ga0068855_101088327 3300005563 Bacteria 836
69 Ga0070664_100000711 3300005564 Bacteria 25471
70 Ga0070664_100010286 3300005564 Bacteria 7590
71 Ga0068857_100042510 3300005577 Bacteria 4033
72 Ga0068854_100025511 3300005578 Bacteria 4057
73 Ga0068854_102061091 3300005578 Bacteria 526
74 Ga0070702_100041102 3300005615 Bacteria 2591
75 Ga0068852_100102949 3300005616 Bacteria 2581
76 Ga0068861_100098281 3300005719 Bacteria 2323
77 Ga0068870_10533697 3300005840 Bacteria 787
78 Ga0068863_100334653 3300005841 Bacteria 1472
79 Ga0068860_100093310 3300005843 Bacteria 2869
80 Ga0068862_100038503 3300005844 Bacteria 4055
81 Ga0081455_10006888 3300005937 Bacteria 12097
82 Ga0081455_10516558 3300005937 Unclassified 798
83 Ga0081540_1067443 3300005983 Unclassified 1672
84 Ga0075432_10004286 3300006058 Bacteria 4855
85 Ga0075432_10088848 3300006058 Bacteria 1129
86 Ga0070716_100026203 3300006173 Unclassified 3120
87 Ga0070716_100194336 3300006173 Bacteria 1343
88 Ga0075367_11020827 3300006178 Bacteria 528
89 Ga0097621_100003300 3300006237 Bacteria 11105
90 Ga0097621_100035488 3300006237 Bacteria 3985
91 Ga0075370_10642850 3300006353 Bacteria 644
92 Ga0068871_100009624 3300006358 Bacteria 7017
93 Ga0068871_100216511 3300006358 Bacteria 1658
94 Ga0075430_100011257 3300006846 Bacteria 7588
95 Ga0075431_100119403 3300006847 Bacteria 2720
96 Ga0075433_10167333 3300006852 Bacteria 1956
97 Ga0075434_100208994 3300006871 Bacteria 1972
98 Ga0075434_100818288 3300006871 Bacteria 947
99 Ga0075434_101167095 3300006871 Bacteria 782
100 Ga0075429_101281626 3300006880 Bacteria 639
101 Ga0068865_100026050 3300006881 Bacteria 3852
102 Ga0068865_100661987 3300006881 Bacteria 888
103 Ga0075436_100220337 3300006914 Bacteria 1346
104 Ga0075435_100065163 3300007076 Bacteria 2961
105 Ga0075435_100086570 3300007076 Bacteria 2581
106 Ga0105245_10015504 3300009098 Bacteria 6645
107 Ga0105245_10162270 3300009098 Bacteria 2122
108 Ga0114129_10320723 3300009147 Bacteria 2060
109 Ga0114129_11161783 3300009147 Bacteria 963
110 Ga0105243_10000065 3300009148 Bacteria 124947
111 Ga0105243_10002767 3300009148 Bacteria 14580
112 Ga0105242_10000070 3300009176 Bacteria 71709
113 Ga0105237_10469216 3300009545 Bacteria 1265
114 Ga0105239_10040800 3300010375 Bacteria 5086
115 Ga0105239_11615567 3300010375 Bacteria 750
116 Ga0105246_10016860 3300011119 Bacteria 4634
117 Ga0157373_10000494 3300013100 Bacteria 31159
118 Ga0157371_10029105 3300013102 Bacteria 3998
119 Ga0157369_10076574 3300013105 Bacteria 3586
120 Ga0157374_10004213 3300013296 Bacteria 12087
121 Ga0157374_10024127 3300013296 Bacteria 5449
122 Ga0157374_10404666 3300013296 Bacteria 1362
123 Ga0157374_11992453 3300013296 Bacteria 607
124 Ga0157378_10007689 3300013297 Bacteria 9401
125 Ga0157378_10232746 3300013297 Bacteria 1756
126 Ga0163162_10439003 3300013306 Bacteria 1437
127 Ga0157372_10964343 3300013307 Bacteria 988
128 Ga0157375_10032744 3300013308 Bacteria 4932
129 Ga0157380_10453167 3300014326 Bacteria 1233
130 Ga0157377_10003551 3300014745 Bacteria 7061
131 Ga0157376_10005050 3300014969 Bacteria 9202
132 Ga0157376_10006856 3300014969 Bacteria 8065
133 Ga0157376_10008529 3300014969 Bacteria 7402
134 Ga0157376_10016319 3300014969 Bacteria 5635
135 Ga0207680_10304282 3300025903 Bacteria 1112
136 Ga0207645_10000271 3300025907 Bacteria 42808
137 Ga0207645_10126286 3300025907 Bacteria 1663
138 Ga0207705_10077254 3300025909 Bacteria 2422
139 Ga0207684_10001070 3300025910 Bacteria 30735
140 Ga0207684_10047878 3300025910 Bacteria 3625
141 Ga0207707_10303610 3300025912 Bacteria 1380
142 Ga0207663_10006748 3300025916 Bacteria 5903
143 Ga0207660_10049389 3300025917 Bacteria 2982
144 Ga0207662_10011546 3300025918 Bacteria 4904
145 Ga0207662_10495354 3300025918 Bacteria 841
146 Ga0207657_10001685 3300025919 Bacteria 23828
147 Ga0207649_10003846 3300025920 Bacteria 8186
148 Ga0207649_10012362 3300025920 Bacteria 4735
149 Ga0207649_10388405 3300025920 Unclassified 1042
150 Ga0207652_10124176 3300025921 Bacteria 2299
151 Ga0207646_10000617 3300025922 Bacteria 46226
152 Ga0207646_10173414 3300025922 Unclassified 1948
153 Ga0207681_10177009 3300025923 Bacteria 1621
154 Ga0207681_10938179 3300025923 Bacteria 725
155 Ga0207650_10026780 3300025925 Bacteria 4117
156 Ga0207650_11235577 3300025925 Unclassified 636
157 Ga0207687_10497245 3300025927 Bacteria 1017
158 Ga0207644_10346390 3300025931 Bacteria 1206
159 Ga0207706_10000107 3300025933 Bacteria 88259
160 Ga0207686_10002834 3300025934 Bacteria 9365
161 Ga0207709_10000866 3300025935 Bacteria 23102
162 Ga0207709_10004034 3300025935 Bacteria 8551
163 Ga0207709_10042410 3300025935 Bacteria 2737
164 Ga0207670_10024419 3300025936 Unclassified 3778
165 Ga0207670_10059705 3300025936 Bacteria 2595
166 Ga0207669_10151245 3300025937 Bacteria 1626
167 Ga0207669_10691429 3300025937 Bacteria 837
168 Ga0207704_10141737 3300025938 Bacteria 1682
169 Ga0207704_10914484 3300025938 Bacteria 738
170 Ga0207704_10967719 3300025938 Bacteria 718
171 Ga0207665_10016833 3300025939 Bacteria 4802
172 Ga0207665_10023782 3300025939 Bacteria 4035
173 Ga0207665_10045547 3300025939 Bacteria 2937
174 Ga0207691_10000472 3300025940 Bacteria 39858
175 Ga0207691_10121636 3300025940 Bacteria 2313
176 Ga0207691_10152515 3300025940 Bacteria 2031
177 Ga0207679_10004226 3300025945 Bacteria 8921
178 Ga0207679_10019984 3300025945 Bacteria 4512
179 Ga0207679_10022196 3300025945 Bacteria 4317
180 Ga0207651_10055516 3300025960 Bacteria 2721
181 Ga0207651_10130757 3300025960 Bacteria 1921
182 Ga0207651_10226575 3300025960 Bacteria 1514
183 Ga0207668_10377526 3300025972 Bacteria 1192
184 Ga0207658_11591682 3300025986 Bacteria 597
185 Ga0207677_10664361 3300026023 Bacteria 921
186 Ga0207678_10028464 3300026067 Bacteria 4879
187 Ga0207708_10006220 3300026075 Bacteria 8846
188 Ga0207641_10060311 3300026088 Bacteria 3234
189 Ga0207648_10000803 3300026089 Bacteria 35454
190 Ga0207648_10001393 3300026089 Bacteria 26615
191 Ga0207674_10055223 3300026116 Bacteria 4039
192 Ga0207675_100038086 3300026118 Bacteria 4487
193 Ga0207683_10000072 3300026121 Bacteria 78277
194 Ga0207698_10251676 3300026142 Bacteria 1617
195 Ga0209973_1005227 3300027252 Bacteria 1372
196 Ga0209969_1000029 3300027360 Bacteria 17473
197 Ga0209981_1001270 3300027378 Bacteria 3199
198 Ga0209996_1000002 3300027395 Bacteria 51944
199 Ga0209984_1000034 3300027424 Bacteria 13836
200 Ga0210000_1017928 3300027462 Bacteria 1074
201 Ga0209968_1000216 3300027526 Bacteria 10078
202 Ga0209999_1000112 3300027543 Bacteria 10076
203 Ga0209982_1000894 3300027552 Bacteria 3924
204 Ga0209970_1000257 3300027614 Bacteria 8708
205 Ga0210002_1000315 3300027617 Bacteria 6668
206 Ga0209983_1000366 3300027665 Bacteria 9568
207 Ga0209966_1000389 3300027695 Bacteria 13145
208 Ga0209966_1011966 3300027695 Bacteria 1588
209 Ga0209998_10000081 3300027717 Bacteria 37388
210 Ga0209974_10005167 3300027876 Bacteria 4608
211 Ga0209974_10180927 3300027876 Bacteria 772
212 Ga0207428_10071451 3300027907 Bacteria 2726
213 Ga0268265_10133408 3300028380 Bacteria 2068
214 Ga0268264_10139964 3300028381 Bacteria 2157
215 Ga0265340_10058388 3300031247 Bacteria 1853
216 Ga0265331_10021410 3300031250 Bacteria 3309
217 Ga0265327_10007650 3300031251 Bacteria 8279
218 Ga0307408_100000052 3300031548 Bacteria 149094
219 Ga0307408_100017910 3300031548 Bacteria 4749
220 Ga0307408_100069862 3300031548 Bacteria 2591
221 Ga0307408_100305382 3300031548 Bacteria 1334
222 Ga0265313_10093278 3300031595 Bacteria 1347
223 Ga0316575_10013757 3300031665 Bacteria 3028
224 Ga0316575_10116222 3300031665 Bacteria 1093
225 Ga0316579_10000607 3300031691 Bacteria 12080
226 Ga0316579_10012654 3300031691 Bacteria 3613
227 Ga0316579_10025046 3300031691 Bacteria 2691
228 Ga0316576_10032308 3300031727 Bacteria 3718
229 Ga0316576_10233265 3300031727 Bacteria 1383
230 Ga0316578_10001630 3300031728 Bacteria 9302
231 Ga0316578_10020902 3300031728 Bacteria 3625
232 Ga0316578_10177043 3300031728 Bacteria 1285
233 Ga0316578_10279281 3300031728 Bacteria 1000
234 Ga0316578_10533113 3300031728 Bacteria 690
235 Ga0307405_10001965 3300031731 Bacteria 8877
236 Ga0316577_10003201 3300031733 Bacteria 8235
237 Ga0316577_10007239 3300031733 Bacteria 5915
238 Ga0316577_10178194 3300031733 Bacteria 1200
239 Ga0316577_10471804 3300031733 Bacteria 713
240 Ga0307413_10225152 3300031824 Bacteria 1373
241 Ga0307413_11303225 3300031824 Unclassified 635
242 Ga0307410_10030150 3300031852 Bacteria 3463
243 Ga0307410_10182622 3300031852 Bacteria 1589
244 Ga0307410_10404233 3300031852 Bacteria 1104
245 Ga0307406_10000998 3300031901 Bacteria 15695
246 Ga0307406_10009125 3300031901 Bacteria 5552
247 Ga0307407_10000138 3300031903 Bacteria 22391
248 Ga0307407_10136463 3300031903 Bacteria 1577
249 Ga0307412_10000070 3300031911 Bacteria 107229
250 Ga0307412_10007776 3300031911 Bacteria 6098
251 Ga0307412_10800684 3300031911 Bacteria 818
252 Ga0307409_100546297 3300031995 Bacteria 1136
253 Ga0307409_100945538 3300031995 Bacteria 877
254 Ga0307416_100003448 3300032002 Bacteria 9286
255 Ga0307414_10000006 3300032004 Bacteria 451918
256 Ga0307414_10294232 3300032004 Bacteria 1370
257 Ga0307411_10089624 3300032005 Bacteria 2143
258 Ga0307411_10118727 3300032005 Bacteria 1908
259 Ga0307411_10969494 3300032005 Unclassified 759
260 Ga0307415_100029580 3300032126 Bacteria 3503
261 Ga0316583_10016759 3300032133 Bacteria 2635
262 Ga0316583_10017341 3300032133 Bacteria 2590
263 Ga0316585_10001825 3300032137 Bacteria 5689
264 Ga0316585_10091235 3300032137 Bacteria 996
265 Ga0316580_10004252 3300032139 Bacteria 4139
266 Ga0316580_10006293 3300032139 Bacteria 3504
267 Ga0316580_10010246 3300032139 Bacteria 2827
268 Ga0316580_10033977 3300032139 Bacteria 1578
269 Ga0373928_0074465 3300035084 Bacteria 846
270 Ga0373940_0103205 3300035088 Bacteria 868
271 Ga0373940_0129536 3300035088 Bacteria 789
272 Ga0373949_0161178 3300035090 Bacteria 654
273 Ga0373951_0193406 3300035091 Bacteria 590
274 Ga0373932_0095010 3300035112 Bacteria 962
275 Ga0373941_0007544 3300035115 Bacteria 2665
276 Ga0373960_0021091 3300035121 Bacteria 1729
277 Ga0373942_0273515 3300035207 Unclassified 580
278 Ga0373962_0023498 3300035242 Bacteria 1643
279 Ga0373962_0175516 3300035242 Bacteria 714
280 Ga0373962_0216711 3300035242 Unclassified 653
281 Ga0316574_0001379 3300035398 Bacteria 11462
282 Ga0316574_0013033 3300035398 Bacteria 4770
283 Ga0316574_0022006 3300035398 Bacteria 3792
284 Ga0316574_0268067 3300035398 Bacteria 1089
285 Ga0316574_1006386 3300035398 Bacteria 502
286 Ga0373931_0109333 3300035691 Bacteria 1566
287 Ga0373931_0120018 3300035691 Bacteria 1502
288 Ga0373931_0803364 3300035691 Bacteria 627
289 Ga0316582_0003471 3300036647 Bacteria 7740
290 Ga0316582_0008269 3300036647 Bacteria 5580
291 Ga0316582_0020030 3300036647 Bacteria 3927
292 Ga0316584_0013881 3300036712 Bacteria 5715
293 Ga0316584_0033065 3300036712 Bacteria 3828
294 Ga0316584_0605434 3300036712 Bacteria 759
295 Ga0316581_0000045 3300037588 Bacteria 13776
296 Ga0400484_07464 3300038725 Bacteria 3385
297 Ga0439438_018558 3300041405 Bacteria 1979
298 Ga0439447_021522 3300041407 Bacteria 1697
299 Ga0439453_0000612 3300041408 Bacteria 4028
300 Ga0439461_0007321 3300041410 Bacteria 1951
301 Ga0439466_0049164 3300041411 Unclassified 1385
302 Ga0439465_0214535 3300041413 Bacteria 704
303 Ga0439431_0076015 3300041997 Unclassified 901
304 Ga0439433_0005640 3300041999 Bacteria 2687
305 Ga0439442_037937 3300042002 Bacteria 1010
306 Ga0439432_025293 3300042006 Bacteria 1948
307 Ga0439462_0177030 3300042015 Unclassified 604
308 Ga0450912_007467 3300042116 Unclassified 888
309 Ga0450914_034123 3300042118 Bacteria 624
310 Ga0450890_000066 3300042127 Bacteria 19203
311 Ga0450891_007169 3300042129 Bacteria 1021
312 Ga0450892_000055 3300042130 Bacteria 12381
313 Ga0450892_016033 3300042130 Bacteria 703
314 Ga0450896_030629 3300042133 Unclassified 814
315 Ga0439446_0008550 3300042156 Bacteria 2723
316 Ga0439434_0013768 3300042435 Bacteria 2402
317 Ga0439464_0010548 3300042439 Bacteria 2439
318 Ga0450916_025640 3300042530 Unclassified 834
319 Ga0450893_0000433 3300042532 Bacteria 5915
320 Ga0450893_0001841 3300042532 Bacteria 3273
321 Ga0450893_0049512 3300042532 Bacteria 785
322 Ga0451577_0000084 3300042876 Bacteria 213553
323 Ga0451577_0002686 3300042876 Bacteria 20743
324 Ga0451577_0118724 3300042876 Bacteria 2369
325 Ga0451577_0138915 3300042876 Bacteria 2183
326 Ga0451577_0830348 3300042876 Bacteria 834
327 Ga0453683_0060643 3300044673 Bacteria 2365
328 Ga0453683_0903836 3300044673 Bacteria 584
329 Ga0453684_0003652 3300044712 Bacteria 34170
330 Ga0453684_0143703 3300044712 Bacteria 2845
331 Ga0453684_1195052 3300044712 Bacteria 799
332 Ga0466960_0485312 3300044901 Bacteria 722
333 Ga0451576_0002499 3300045051 Bacteria 27297
334 Ga0451576_0019023 3300045051 Bacteria 7506
335 Ga0451576_0375166 3300045051 Bacteria 1490
336 Ga0451576_0929090 3300045051 Bacteria 912
337 Ga0451576_1000848 3300045051 Bacteria 876
338 Ga0495598_0252915 3300046537 Unclassified 653
339 Ga0495669_0085061 3300046684 Unclassified 1455
340 Ga0495589_0396145 3300046794 Unclassified 634
341 Ga0496121_0029001 3300048924 Bacteria 5134
342 Ga0501290_000136 3300049513 Bacteria 11526
343 Ga0501291_002079 3300049514 Bacteria 2370
344 Ga0501292_000356 3300049515 Bacteria 6226
345 Ga0501293_000935 3300049516 Bacteria 2190
346 Ga0501294_000067 3300049517 Bacteria 11272
347 Ga0501295_000331 3300049518 Bacteria 4518
348 Ga0501296_000129 3300049519 Bacteria 8738
349 Ga0501297_001714 3300049520 Bacteria 2047
350 Ga0501298_000246 3300049521 Bacteria 7034
351 Ga0501299_000050 3300049522 Bacteria 12953
352 Ga0501299_005769 3300049522 Bacteria 1916
353 Ga0501299_009673 3300049522 Unclassified 1595
354 Ga0501300_000541 3300049523 Bacteria 5645
355 Ga0501303_001993 3300049526 Bacteria 1551
356 Ga0501031_0027261 3300049568 Bacteria 3725
357 Ga0501031_0844629 3300049568 Unclassified 587
358 Ga0501032_0000245 3300049569 Bacteria 45098
359 Ga0501032_0008380 3300049569 Bacteria 7539
360 Ga0501033_0000002 3300049570 Bacteria 668574
361 Ga0501036_0056473 3300049572 Bacteria 3327
362 Ga0501036_0118898 3300049572 Bacteria 2231
363 Ga0501036_0408057 3300049572 Bacteria 1133
364 Ga0501037_0187875 3300049573 Bacteria 1464
365 Ga0501038_0152092 3300049574 Bacteria 1886
366 Ga0501038_0615923 3300049574 Bacteria 820
367 Ga0501039_0043210 3300049575 Bacteria 3482
368 Ga0501039_0122701 3300049575 Bacteria 2037
369 Ga0501039_0138767 3300049575 Bacteria 1909
370 Ga0501039_0163877 3300049575 Bacteria 1748
371 Ga0501040_0061857 3300049576 Bacteria 2575
372 Ga0501040_0306389 3300049576 Bacteria 1135
373 Ga0501041_0039004 3300049577 Bacteria 2881
374 Ga0501041_0100827 3300049577 Bacteria 1787
375 Ga0501041_0104090 3300049577 Bacteria 1758
376 Ga0501042_0077484 3300049578 Bacteria 2380
377 Ga0501042_0145088 3300049578 Bacteria 1711
378 Ga0501042_0208149 3300049578 Bacteria 1410
379 Ga0501043_0104557 3300049579 Bacteria 2225
380 Ga0501046_0059853 3300049580 Bacteria 2982
381 Ga0501048_0040005 3300049582 Bacteria 3361
382 Ga0501048_0409975 3300049582 Bacteria 969
383 Ga0501048_0649822 3300049582 Bacteria 757
384 Ga0501068_0140246 3300049584 Bacteria 1515
385 Ga0501069_0069548 3300049585 Bacteria 1971
386 Ga0501069_0425205 3300049585 Bacteria 788
387 Ga0501069_0499194 3300049585 Unclassified 726
388 Ga0501070_0205384 3300049586 Bacteria 1618
389 Ga0501071_0033187 3300049587 Bacteria 3668
390 Ga0501071_0730353 3300049587 Bacteria 763
391 Ga0501072_0054918 3300049588 Bacteria 3140
392 Ga0501074_0315383 3300049590 Bacteria 1111
393 Ga0501075_0092330 3300049591 Bacteria 2297
394 Ga0501076_1133900 3300049592 Bacteria 644
395 Ga0501077_0018857 3300049593 Bacteria 4366
396 Ga0501077_0104718 3300049593 Bacteria 1793
397 Ga0501199_000230 3300049650 Bacteria 4849
398 Ga0501201_000230 3300049651 Bacteria 4983
399 Ga0501206_000661 3300049653 Bacteria 4170
400 Ga0501207_000164 3300049654 Bacteria 6237
401 Ga0501209_005202 3300049656 Bacteria 2328
402 Ga0501211_003233 3300049658 Bacteria 1687
403 Ga0501216_000050 3300049660 Bacteria 10167
404 Ga0501217_001564 3300049661 Bacteria 4324
405 Ga0501223_068949 3300049663 Unclassified 697
406 Ga0501224_055200 3300049664 Unclassified 613
407 Ga0501227_000800 3300049665 Bacteria 6869
408 Ga0501233_000967 3300049668 Bacteria 4872
409 Ga0501236_000352 3300049670 Bacteria 5050
410 Ga0501239_000236 3300049672 Bacteria 3952
411 Ga0501240_024239 3300049673 Unclassified 935
412 Ga0501243_005068 3300049675 Bacteria 1978
413 Ga0501246_000845 3300049676 Bacteria 2269
414 Ga0501247_001899 3300049677 Bacteria 2107
415 Ga0501248_000524 3300049678 Bacteria 2121
416 Ga0501249_003185 3300049679 Bacteria 3303
417 Ga0501250_013185 3300049680 Unclassified 988
418 Ga0501251_008619 3300049681 Unclassified 1159
419 Ga0501256_000342 3300049685 Bacteria 2874
420 Ga0501257_000518 3300049686 Bacteria 7651
421 Ga0501258_010304 3300049687 Bacteria 987
422 Ga0501259_004277 3300049688 Bacteria 2272
423 Ga0501260_000359 3300049689 Bacteria 3586
424 Ga0501261_012485 3300049690 Unclassified 1143
425 Ga0501219_000835 3300049703 Bacteria 3946
426 Ga0501221_000118 3300049704 Bacteria 9870
427 Ga0501225_0000338 3300049705 Bacteria 14722
428 Ga0501229_001720 3300049706 Unclassified 2564
429 Ga0501234_000238 3300049707 Bacteria 8000
430 Ga0501245_000100 3300049708 Bacteria 8720
431 Ga0501079_0229743 3300049741 Bacteria 1449
432 Ga0501080_0060384 3300049742 Bacteria 3529
433 Ga0501081_0071558 3300049743 Bacteria 2417
434 Ga0501083_0230129 3300049744 Bacteria 1207
435 Ga0501264_000777 3300049761 Bacteria 4180
436 Ga0501265_000018 3300049762 Bacteria 15780
437 Ga0501266_001451 3300049763 Bacteria 3024
438 Ga0501269_019576 3300049766 Unclassified 842
439 Ga0501271_000268 3300049768 Bacteria 4427
440 Ga0501272_000423 3300049769 Bacteria 3719
441 Ga0501273_003094 3300049770 Bacteria 1740
442 Ga0501274_000032 3300049771 Bacteria 8470
443 Ga0501275_000249 3300049772 Bacteria 6296
444 Ga0501278_000420 3300049774 Bacteria 3324
445 Ga0501279_000080 3300049775 Bacteria 16241
446 Ga0501281_00280 3300049777 Bacteria 5300
447 Ga0501283_000077 3300049779 Bacteria 12025
448 Ga0501035_0454505 3300049822 Bacteria 1059
449 Ga0501045_0113349 3300049824 Bacteria 2011
450 Ga0501045_0161389 3300049824 Bacteria 1668
451 Ga0501200_00361 3300049849 Bacteria 1442
452 Ga0501212_005430 3300049851 Bacteria 1682
453 Ga0501226_000423 3300049853 Bacteria 6008
454 nmdc:mga05p37_3359_c1 3300050507 Bacteria 18672
455 nmdc:mga05p37_46715_c1 3300050507 Bacteria 5323
456 nmdc:mga09592_95083_c1 3300050508 Bacteria 2549
457 nmdc:mga06r32_64695_c1 3300050510 Bacteria 3527
458 nmdc:mga08y16_47742_c1 3300050511 Bacteria 4482
459 nmdc:mga0n895_1682890_c1 3300050512 Unclassified 597
460 nmdc:mga0n895_1709643_c1 3300050512 Bacteria 592
461 nmdc:mga0n895_244904_c1 3300050512 Bacteria 1820
462 nmdc:mga0rr50_209333_c1 3300050513 Bacteria 1606
463 nmdc:mga0a205_1390490_c1 3300050515 Bacteria 550
464 nmdc:mga0a205_155460_c1 3300050515 Bacteria 2186
465 Ga0500559_0001204 3300053136 Bacteria 15389
466 Ga0501084_0146715 3300054114 Bacteria 1987
467 Ga0501084_0513544 3300054114 Bacteria 1013
468 Ga0590075_004839 3300059424 Bacteria 3183
469 Ga0501082_0177431 3300060353 Bacteria 1852
470 Ga0501082_0265458 3300060353 Bacteria 1494
471 Ga0501082_0581142 3300060353 Bacteria 980
472 Ga0530510_0154873 3300061734 Bacteria 1693

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035112 Ga0373932_0095010 Ga0373932_0095010_26_415 126
2 3300035691 Ga0373931_0803364 Ga0373931_0803364_221_610 126
3 3300041997 Ga0439431_0076015 Ga0439431_0076015_29_418 126
4 3300049585 Ga0501069_0069548 Ga0501069_0069548_14_403 126
5 3300049766 Ga0501269_019576 Ga0501269_019576_29_418 126
6 3300049762 Ga0501265_000018 Ga0501265_000018_13889_14284 128
7 3300042133 Ga0450896_030629 Ga0450896_030629_81_497 135
8 3300025939 Ga0207665_10023782 Ga0207665_100237822 136
9 3300025986 Ga0207658_11591682 Ga0207658_115916822 136
10 3300001989 JGI24739J22299_10084802 JGI24739J22299_100848022 137
11 3300003349 JGI26129J50193_1001444 JGI26129J50193_10014442 137
12 3300005328 Ga0070676_10005440 Ga0070676_100054402 137
13 3300005329 Ga0070683_100121115 Ga0070683_1001211152 137
14 3300005330 Ga0070690_100089256 Ga0070690_1000892562 137
15 3300005333 Ga0070677_10008591 Ga0070677_100085915 137
16 3300005335 Ga0070666_10090799 Ga0070666_100907992 137
17 3300005335 Ga0070666_10374814 Ga0070666_103748142 137
18 3300005336 Ga0070680_100026972 Ga0070680_1000269722 137
19 3300005337 Ga0070682_100037128 Ga0070682_1000371282 137
20 3300005339 Ga0070660_100039287 Ga0070660_1000392872 137
21 3300005339 Ga0070660_100748973 Ga0070660_1007489732 137
22 3300005340 Ga0070689_100033981 Ga0070689_1000339813 137
23 3300005341 Ga0070691_10001282 Ga0070691_100012827 137
24 3300005343 Ga0070687_100017829 Ga0070687_1000178293 137
25 3300005343 Ga0070687_100057281 Ga0070687_1000572812 137
26 3300005344 Ga0070661_100027708 Ga0070661_1000277083 137
27 3300005347 Ga0070668_100021753 Ga0070668_1000217534 137
28 3300005353 Ga0070669_100004611 Ga0070669_1000046114 137
29 3300005354 Ga0070675_100207918 Ga0070675_1002079182 137
30 3300005355 Ga0070671_100243163 Ga0070671_1002431632 137
31 3300005356 Ga0070674_100033686 Ga0070674_1000336862 137
32 3300005364 Ga0070673_100003504 Ga0070673_1000035048 137
33 3300005364 Ga0070673_100075488 Ga0070673_1000754882 137
34 3300005364 Ga0070673_100328600 Ga0070673_1003286002 137
35 3300005365 Ga0070688_100091699 Ga0070688_1000916991 137
36 3300005366 Ga0070659_100011236 Ga0070659_1000112366 137
37 3300005367 Ga0070667_101807059 Ga0070667_1018070591 137
38 3300005441 Ga0070700_100012173 Ga0070700_1000121733 137
39 3300005441 Ga0070700_101151856 Ga0070700_1011518561 137
40 3300005444 Ga0070694_100007190 Ga0070694_1000071906 137
41 3300005444 Ga0070694_100012488 Ga0070694_1000124882 137
42 3300005445 Ga0070708_100135896 Ga0070708_1001358962 137
43 3300005455 Ga0070663_100046777 Ga0070663_1000467774 137
44 3300005456 Ga0070678_100073493 Ga0070678_1000734934 137
45 3300005457 Ga0070662_100221613 Ga0070662_1002216132 137
46 3300005458 Ga0070681_10047655 Ga0070681_100476552 137
47 3300005466 Ga0070685_10252347 Ga0070685_102523472 137
48 3300005467 Ga0070706_100003758 Ga0070706_1000037587 137
49 3300005468 Ga0070707_100000830 Ga0070707_10000083012 137
50 3300005471 Ga0070698_100000901 Ga0070698_10000090113 137
51 3300005471 Ga0070698_100231387 Ga0070698_1002313872 137
52 3300005518 Ga0070699_100001545 Ga0070699_10000154513 137
53 3300005518 Ga0070699_100112603 Ga0070699_1001126032 137
54 3300005530 Ga0070679_100201903 Ga0070679_1002019032 137
55 3300005535 Ga0070684_100450694 Ga0070684_1004506941 137
56 3300005536 Ga0070697_100059029 Ga0070697_1000590294 137
57 3300005536 Ga0070697_100095442 Ga0070697_1000954422 137
58 3300005536 Ga0070697_100113855 Ga0070697_1001138552 137
59 3300005544 Ga0070686_100001095 Ga0070686_1000010954 137
60 3300005544 Ga0070686_100010450 Ga0070686_1000104502 137
61 3300005544 Ga0070686_100235167 Ga0070686_1002351672 137
62 3300005545 Ga0070695_100004355 Ga0070695_1000043557 137
63 3300005546 Ga0070696_100002650 Ga0070696_1000026503 137
64 3300005548 Ga0070665_100258759 Ga0070665_1002587592 137
65 3300005549 Ga0070704_100750009 Ga0070704_1007500091 137
66 3300005563 Ga0068855_101088327 Ga0068855_1010883272 137
67 3300005564 Ga0070664_100000711 Ga0070664_10000071118 137
68 3300005577 Ga0068857_100042510 Ga0068857_1000425105 137
69 3300005578 Ga0068854_100025511 Ga0068854_1000255113 137
70 3300005578 Ga0068854_102061091 Ga0068854_1020610911 137
71 3300005615 Ga0070702_100041102 Ga0070702_1000411022 137
72 3300005616 Ga0068852_100102949 Ga0068852_1001029493 137
73 3300005719 Ga0068861_100098281 Ga0068861_1000982813 137
74 3300005841 Ga0068863_100334653 Ga0068863_1003346532 137
75 3300005843 Ga0068860_100093310 Ga0068860_1000933103 137
76 3300005844 Ga0068862_100038503 Ga0068862_1000385033 137
77 3300005937 Ga0081455_10006888 Ga0081455_100068882 137
78 3300005937 Ga0081455_10516558 Ga0081455_105165582 137
79 3300006058 Ga0075432_10004286 Ga0075432_100042864 137
80 3300006058 Ga0075432_10088848 Ga0075432_100888482 137
81 3300006173 Ga0070716_100026203 Ga0070716_1000262035 137
82 3300006237 Ga0097621_100003300 Ga0097621_1000033004 137
83 3300006237 Ga0097621_100035488 Ga0097621_1000354883 137
84 3300006358 Ga0068871_100009624 Ga0068871_1000096247 137
85 3300006846 Ga0075430_100011257 Ga0075430_1000112576 137
86 3300006847 Ga0075431_100119403 Ga0075431_1001194032 137
87 3300006852 Ga0075433_10167333 Ga0075433_101673332 137
88 3300006871 Ga0075434_100208994 Ga0075434_1002089942 137
89 3300006871 Ga0075434_101167095 Ga0075434_1011670952 137
90 3300006880 Ga0075429_101281626 Ga0075429_1012816261 137
91 3300006881 Ga0068865_100026050 Ga0068865_1000260503 137
92 3300007076 Ga0075435_100065163 Ga0075435_1000651632 137
93 3300007076 Ga0075435_100086570 Ga0075435_1000865703 137
94 3300009098 Ga0105245_10015504 Ga0105245_100155046 137
95 3300009147 Ga0114129_10320723 Ga0114129_103207232 137
96 3300009147 Ga0114129_11161783 Ga0114129_111617832 137
97 3300009148 Ga0105243_10002767 Ga0105243_1000276717 137
98 3300009176 Ga0105242_10000070 Ga0105242_1000007073 137
99 3300010375 Ga0105239_10040800 Ga0105239_100408002 137
100 3300011119 Ga0105246_10016860 Ga0105246_100168602 137
101 3300013102 Ga0157371_10029105 Ga0157371_100291053 137
102 3300013105 Ga0157369_10076574 Ga0157369_100765744 137
103 3300013296 Ga0157374_10024127 Ga0157374_100241274 137
104 3300013296 Ga0157374_10404666 Ga0157374_104046662 137
105 3300013296 Ga0157374_11992453 Ga0157374_119924531 137
106 3300013297 Ga0157378_10007689 Ga0157378_100076898 137
107 3300013297 Ga0157378_10232746 Ga0157378_102327462 137
108 3300013307 Ga0157372_10964343 Ga0157372_109643432 137
109 3300013308 Ga0157375_10032744 Ga0157375_100327442 137
110 3300014326 Ga0157380_10453167 Ga0157380_104531672 137
111 3300014745 Ga0157377_10003551 Ga0157377_100035512 137
112 3300014969 Ga0157376_10006856 Ga0157376_100068563 137
113 3300014969 Ga0157376_10008529 Ga0157376_100085294 137
114 3300025903 Ga0207680_10304282 Ga0207680_103042822 137
115 3300025907 Ga0207645_10000271 Ga0207645_100002718 137
116 3300025910 Ga0207684_10001070 Ga0207684_1000107028 137
117 3300025910 Ga0207684_10047878 Ga0207684_100478784 137
118 3300025912 Ga0207707_10303610 Ga0207707_103036102 137
119 3300025917 Ga0207660_10049389 Ga0207660_100493893 137
120 3300025918 Ga0207662_10011546 Ga0207662_100115463 137
121 3300025918 Ga0207662_10495354 Ga0207662_104953542 137
122 3300025919 Ga0207657_10001685 Ga0207657_1000168511 137
123 3300025920 Ga0207649_10012362 Ga0207649_100123623 137
124 3300025921 Ga0207652_10124176 Ga0207652_101241762 137
125 3300025922 Ga0207646_10000617 Ga0207646_1000061721 137
126 3300025922 Ga0207646_10173414 Ga0207646_101734142 137
127 3300025923 Ga0207681_10177009 Ga0207681_101770092 137
128 3300025923 Ga0207681_10938179 Ga0207681_109381792 137
129 3300025925 Ga0207650_10026780 Ga0207650_100267801 137
130 3300025925 Ga0207650_11235577 Ga0207650_112355772 137
131 3300025931 Ga0207644_10346390 Ga0207644_103463902 137
132 3300025933 Ga0207706_10000107 Ga0207706_1000010772 137
133 3300025934 Ga0207686_10002834 Ga0207686_100028342 137
134 3300025935 Ga0207709_10042410 Ga0207709_100424103 137
135 3300025936 Ga0207670_10024419 Ga0207670_100244195 137
136 3300025936 Ga0207670_10059705 Ga0207670_100597052 137
137 3300025937 Ga0207669_10151245 Ga0207669_101512452 137
138 3300025937 Ga0207669_10691429 Ga0207669_106914292 137
139 3300025938 Ga0207704_10141737 Ga0207704_101417373 137
140 3300025938 Ga0207704_10967719 Ga0207704_109677192 137
141 3300025939 Ga0207665_10016833 Ga0207665_100168333 137
142 3300025940 Ga0207691_10000472 Ga0207691_100004722 137
143 3300025940 Ga0207691_10121636 Ga0207691_101216363 137
144 3300025940 Ga0207691_10152515 Ga0207691_101525152 137
145 3300025945 Ga0207679_10004226 Ga0207679_100042266 137
146 3300025945 Ga0207679_10019984 Ga0207679_100199843 137
147 3300025960 Ga0207651_10055516 Ga0207651_100555163 137
148 3300025960 Ga0207651_10130757 Ga0207651_101307572 137
149 3300025960 Ga0207651_10226575 Ga0207651_102265752 137
150 3300025972 Ga0207668_10377526 Ga0207668_103775262 137
151 3300026023 Ga0207677_10664361 Ga0207677_106643612 137
152 3300026067 Ga0207678_10028464 Ga0207678_100284641 137
153 3300026075 Ga0207708_10006220 Ga0207708_100062207 137
154 3300026088 Ga0207641_10060311 Ga0207641_100603114 137
155 3300026089 Ga0207648_10000803 Ga0207648_100008034 137
156 3300026116 Ga0207674_10055223 Ga0207674_100552232 137
157 3300026118 Ga0207675_100038086 Ga0207675_1000380866 137
158 3300026121 Ga0207683_10000072 Ga0207683_1000007256 137
159 3300026142 Ga0207698_10251676 Ga0207698_102516762 137
160 3300027252 Ga0209973_1005227 Ga0209973_10052272 137
161 3300027360 Ga0209969_1000029 Ga0209969_10000296 137
162 3300027378 Ga0209981_1001270 Ga0209981_10012703 137
163 3300027395 Ga0209996_1000002 Ga0209996_10000026 137
164 3300027424 Ga0209984_1000034 Ga0209984_10000346 137
165 3300027462 Ga0210000_1017928 Ga0210000_10179282 137
166 3300027526 Ga0209968_1000216 Ga0209968_10002167 137
167 3300027543 Ga0209999_1000112 Ga0209999_10001125 137
168 3300027552 Ga0209982_1000894 Ga0209982_10008943 137
169 3300027614 Ga0209970_1000257 Ga0209970_10002578 137
170 3300027617 Ga0210002_1000315 Ga0210002_10003156 137
171 3300027665 Ga0209983_1000366 Ga0209983_10003663 137
172 3300027695 Ga0209966_1000389 Ga0209966_10003892 137
173 3300027695 Ga0209966_1011966 Ga0209966_10119662 137
174 3300027717 Ga0209998_10000081 Ga0209998_1000008140 137
175 3300027876 Ga0209974_10005167 Ga0209974_100051672 137
176 3300027876 Ga0209974_10180927 Ga0209974_101809272 137
177 3300027907 Ga0207428_10071451 Ga0207428_100714513 137
178 3300028380 Ga0268265_10133408 Ga0268265_101334082 137
179 3300028381 Ga0268264_10139964 Ga0268264_101399642 137
180 3300031548 Ga0307408_100305382 Ga0307408_1003053822 137
181 3300031731 Ga0307405_10001965 Ga0307405_100019656 137
182 3300031824 Ga0307413_11303225 Ga0307413_113032251 137
183 3300031852 Ga0307410_10030150 Ga0307410_100301505 137
184 3300031901 Ga0307406_10009125 Ga0307406_100091254 137
185 3300031911 Ga0307412_10007776 Ga0307412_100077762 137
186 3300031995 Ga0307409_100546297 Ga0307409_1005462972 137
187 3300032005 Ga0307411_10118727 Ga0307411_101187273 137
188 3300032005 Ga0307411_10969494 Ga0307411_109694942 137
189 3300032126 Ga0307415_100029580 Ga0307415_1000295803 137
190 3300035084 Ga0373928_0074465 Ga0373928_0074465_297_725 137
191 3300035088 Ga0373940_0103205 Ga0373940_0103205_192_620 137
192 3300035088 Ga0373940_0129536 Ga0373940_0129536_82_510 137
193 3300035090 Ga0373949_0161178 Ga0373949_0161178_160_588 137
194 3300035091 Ga0373951_0193406 Ga0373951_0193406_20_448 137
195 3300035115 Ga0373941_0007544 Ga0373941_0007544_1234_1662 137
196 3300035121 Ga0373960_0021091 Ga0373960_0021091_325_753 137
197 3300035207 Ga0373942_0273515 Ga0373942_0273515_133_561 137
198 3300035242 Ga0373962_0023498 Ga0373962_0023498_342_770 137
199 3300035242 Ga0373962_0175516 Ga0373962_0175516_196_624 137
200 3300035242 Ga0373962_0216711 Ga0373962_0216711_82_510 137
201 3300035691 Ga0373931_0109333 Ga0373931_0109333_303_731 137
202 3300035691 Ga0373931_0120018 Ga0373931_0120018_825_1253 137
203 3300041405 Ga0439438_018558 Ga0439438_018558_25_447 137
204 3300041407 Ga0439447_021522 Ga0439447_021522_601_1023 137
205 3300041410 Ga0439461_0007321 Ga0439461_0007321_507_929 137
206 3300041411 Ga0439466_0049164 Ga0439466_0049164_457_879 137
207 3300041999 Ga0439433_0005640 Ga0439433_0005640_950_1372 137
208 3300042002 Ga0439442_037937 Ga0439442_037937_474_896 137
209 3300042006 Ga0439432_025293 Ga0439432_025293_1345_1767 137
210 3300042015 Ga0439462_0177030 Ga0439462_0177030_53_475 137
211 3300042116 Ga0450912_007467 Ga0450912_007467_413_835 137
212 3300042130 Ga0450892_016033 Ga0450892_016033_73_501 137
213 3300042156 Ga0439446_0008550 Ga0439446_0008550_134_556 137
214 3300042435 Ga0439434_0013768 Ga0439434_0013768_1474_1896 137
215 3300042439 Ga0439464_0010548 Ga0439464_0010548_54_476 137
216 3300042530 Ga0450916_025640 Ga0450916_025640_170_592 137
217 3300042876 Ga0451577_0118724 Ga0451577_0118724_192_614 137
218 3300042876 Ga0451577_0138915 Ga0451577_0138915_1702_2130 137
219 3300042876 Ga0451577_0830348 Ga0451577_0830348_161_583 137
220 3300044673 Ga0453683_0060643 Ga0453683_0060643_914_1345 137
221 3300044673 Ga0453683_0903836 Ga0453683_0903836_38_460 137
222 3300044712 Ga0453684_1195052 Ga0453684_1195052_288_710 137
223 3300044901 Ga0466960_0485312 Ga0466960_0485312_234_662 137
224 3300045051 Ga0451576_0002499 Ga0451576_0002499_10927_11355 137
225 3300045051 Ga0451576_0375166 Ga0451576_0375166_278_706 137
226 3300045051 Ga0451576_0929090 Ga0451576_0929090_174_602 137
227 3300046537 Ga0495598_0252915 Ga0495598_0252915_84_512 137
228 3300046684 Ga0495669_0085061 Ga0495669_0085061_839_1267 137
229 3300046794 Ga0495589_0396145 Ga0495589_0396145_68_496 137
230 3300049513 Ga0501290_000136 Ga0501290_000136_8016_8438 137
231 3300049514 Ga0501291_002079 Ga0501291_002079_466_888 137
232 3300049515 Ga0501292_000356 Ga0501292_000356_1390_1812 137
233 3300049516 Ga0501293_000935 Ga0501293_000935_1345_1767 137
234 3300049517 Ga0501294_000067 Ga0501294_000067_6959_7381 137
235 3300049518 Ga0501295_000331 Ga0501295_000331_344_766 137
236 3300049519 Ga0501296_000129 Ga0501296_000129_7844_8266 137
237 3300049520 Ga0501297_001714 Ga0501297_001714_1576_1998 137
238 3300049521 Ga0501298_000246 Ga0501298_000246_2832_3254 137
239 3300049522 Ga0501299_000050 Ga0501299_000050_3493_3915 137
240 3300049522 Ga0501299_005769 Ga0501299_005769_164_586 137
241 3300049522 Ga0501299_009673 Ga0501299_009673_190_612 137
242 3300049523 Ga0501300_000541 Ga0501300_000541_1445_1867 137
243 3300049526 Ga0501303_001993 Ga0501303_001993_118_540 137
244 3300049568 Ga0501031_0027261 Ga0501031_0027261_994_1422 137
245 3300049568 Ga0501031_0844629 Ga0501031_0844629_56_478 137
246 3300049572 Ga0501036_0056473 Ga0501036_0056473_1501_1929 137
247 3300049572 Ga0501036_0118898 Ga0501036_0118898_891_1313 137
248 3300049572 Ga0501036_0408057 Ga0501036_0408057_329_751 137
249 3300049573 Ga0501037_0187875 Ga0501037_0187875_698_1120 137
250 3300049574 Ga0501038_0152092 Ga0501038_0152092_49_471 137
251 3300049574 Ga0501038_0615923 Ga0501038_0615923_12_434 137
252 3300049575 Ga0501039_0043210 Ga0501039_0043210_2092_2520 137
253 3300049575 Ga0501039_0122701 Ga0501039_0122701_1171_1593 137
254 3300049575 Ga0501039_0138767 Ga0501039_0138767_102_524 137
255 3300049576 Ga0501040_0061857 Ga0501040_0061857_1370_1792 137
256 3300049576 Ga0501040_0306389 Ga0501040_0306389_131_553 137
257 3300049577 Ga0501041_0039004 Ga0501041_0039004_213_635 137
258 3300049577 Ga0501041_0100827 Ga0501041_0100827_1319_1747 137
259 3300049577 Ga0501041_0104090 Ga0501041_0104090_445_867 137
260 3300049578 Ga0501042_0077484 Ga0501042_0077484_736_1164 137
261 3300049578 Ga0501042_0145088 Ga0501042_0145088_133_555 137
262 3300049578 Ga0501042_0208149 Ga0501042_0208149_725_1147 137
263 3300049579 Ga0501043_0104557 Ga0501043_0104557_701_1123 137
264 3300049580 Ga0501046_0059853 Ga0501046_0059853_1641_2063 137
265 3300049582 Ga0501048_0040005 Ga0501048_0040005_990_1418 137
266 3300049582 Ga0501048_0409975 Ga0501048_0409975_260_682 137
267 3300049582 Ga0501048_0649822 Ga0501048_0649822_312_734 137
268 3300049584 Ga0501068_0140246 Ga0501068_0140246_218_676 137
269 3300049585 Ga0501069_0425205 Ga0501069_0425205_329_751 137
270 3300049585 Ga0501069_0499194 Ga0501069_0499194_86_508 137
271 3300049586 Ga0501070_0205384 Ga0501070_0205384_945_1367 137
272 3300049587 Ga0501071_0033187 Ga0501071_0033187_1687_2109 137
273 3300049587 Ga0501071_0730353 Ga0501071_0730353_307_735 137
274 3300049588 Ga0501072_0054918 Ga0501072_0054918_2048_2470 137
275 3300049590 Ga0501074_0315383 Ga0501074_0315383_641_1063 137
276 3300049591 Ga0501075_0092330 Ga0501075_0092330_1606_2028 137
277 3300049592 Ga0501076_1133900 Ga0501076_1133900_81_503 137
278 3300049593 Ga0501077_0018857 Ga0501077_0018857_175_597 137
279 3300049593 Ga0501077_0104718 Ga0501077_0104718_313_735 137
280 3300049650 Ga0501199_000230 Ga0501199_000230_937_1359 137
281 3300049651 Ga0501201_000230 Ga0501201_000230_1489_1911 137
282 3300049653 Ga0501206_000661 Ga0501206_000661_2783_3205 137
283 3300049654 Ga0501207_000164 Ga0501207_000164_2490_2912 137
284 3300049656 Ga0501209_005202 Ga0501209_005202_1572_1994 137
285 3300049658 Ga0501211_003233 Ga0501211_003233_941_1363 137
286 3300049660 Ga0501216_000050 Ga0501216_000050_6264_6686 137
287 3300049661 Ga0501217_001564 Ga0501217_001564_198_620 137
288 3300049663 Ga0501223_068949 Ga0501223_068949_213_635 137
289 3300049664 Ga0501224_055200 Ga0501224_055200_11_433 137
290 3300049668 Ga0501233_000967 Ga0501233_000967_204_626 137
291 3300049670 Ga0501236_000352 Ga0501236_000352_1788_2210 137
292 3300049672 Ga0501239_000236 Ga0501239_000236_327_749 137
293 3300049673 Ga0501240_024239 Ga0501240_024239_228_650 137
294 3300049675 Ga0501243_005068 Ga0501243_005068_1258_1680 137
295 3300049676 Ga0501246_000845 Ga0501246_000845_1390_1812 137
296 3300049677 Ga0501247_001899 Ga0501247_001899_654_1076 137
297 3300049678 Ga0501248_000524 Ga0501248_000524_668_1090 137
298 3300049679 Ga0501249_003185 Ga0501249_003185_2789_3211 137
299 3300049680 Ga0501250_013185 Ga0501250_013185_127_549 137
300 3300049681 Ga0501251_008619 Ga0501251_008619_516_938 137
301 3300049685 Ga0501256_000342 Ga0501256_000342_1482_1904 137
302 3300049686 Ga0501257_000518 Ga0501257_000518_7153_7575 137
303 3300049687 Ga0501258_010304 Ga0501258_010304_232_654 137
304 3300049688 Ga0501259_004277 Ga0501259_004277_1493_1915 137
305 3300049689 Ga0501260_000359 Ga0501260_000359_476_898 137
306 3300049690 Ga0501261_012485 Ga0501261_012485_181_603 137
307 3300049703 Ga0501219_000835 Ga0501219_000835_1427_1849 137
308 3300049704 Ga0501221_000118 Ga0501221_000118_8088_8510 137
309 3300049705 Ga0501225_0000338 Ga0501225_0000338_13285_13707 137
310 3300049706 Ga0501229_001720 Ga0501229_001720_584_1006 137
311 3300049707 Ga0501234_000238 Ga0501234_000238_7215_7637 137
312 3300049708 Ga0501245_000100 Ga0501245_000100_4516_4938 137
313 3300049741 Ga0501079_0229743 Ga0501079_0229743_274_696 137
314 3300049742 Ga0501080_0060384 Ga0501080_0060384_2477_2899 137
315 3300049743 Ga0501081_0071558 Ga0501081_0071558_1068_1490 137
316 3300049744 Ga0501083_0230129 Ga0501083_0230129_140_562 137
317 3300049761 Ga0501264_000777 Ga0501264_000777_1464_1886 137
318 3300049763 Ga0501266_001451 Ga0501266_001451_1591_2013 137
319 3300049768 Ga0501271_000268 Ga0501271_000268_34_456 137
320 3300049769 Ga0501272_000423 Ga0501272_000423_2832_3254 137
321 3300049770 Ga0501273_003094 Ga0501273_003094_330_752 137
322 3300049771 Ga0501274_000032 Ga0501274_000032_4092_4514 137
323 3300049772 Ga0501275_000249 Ga0501275_000249_787_1209 137
324 3300049774 Ga0501278_000420 Ga0501278_000420_1700_2122 137
325 3300049775 Ga0501279_000080 Ga0501279_000080_13276_13698 137
326 3300049777 Ga0501281_00280 Ga0501281_00280_1201_1623 137
327 3300049779 Ga0501283_000077 Ga0501283_000077_4007_4429 137
328 3300049822 Ga0501035_0454505 Ga0501035_0454505_431_853 137
329 3300049824 Ga0501045_0113349 Ga0501045_0113349_171_599 137
330 3300049824 Ga0501045_0161389 Ga0501045_0161389_264_686 137
331 3300049849 Ga0501200_00361 Ga0501200_00361_206_628 137
332 3300049851 Ga0501212_005430 Ga0501212_005430_181_603 137
333 3300049853 Ga0501226_000423 Ga0501226_000423_1326_1748 137
334 3300050507 nmdc:mga05p37_3359_c1 nmdc:mga05p37_3359_c1_1230_1652 137
335 3300050507 nmdc:mga05p37_46715_c1 nmdc:mga05p37_46715_c1_2034_2462 137
336 3300050508 nmdc:mga09592_95083_c1 nmdc:mga09592_95083_c1_1911_2339 137
337 3300050510 nmdc:mga06r32_64695_c1 nmdc:mga06r32_64695_c1_1077_1505 137
338 3300050511 nmdc:mga08y16_47742_c1 nmdc:mga08y16_47742_c1_2923_3351 137
339 3300050512 nmdc:mga0n895_1682890_c1 nmdc:mga0n895_1682890_c1_109_531 137
340 3300050512 nmdc:mga0n895_1709643_c1 nmdc:mga0n895_1709643_c1_15_443 137
341 3300050512 nmdc:mga0n895_244904_c1 nmdc:mga0n895_244904_c1_1344_1772 137
342 3300050513 nmdc:mga0rr50_209333_c1 nmdc:mga0rr50_209333_c1_969_1397 137
343 3300050515 nmdc:mga0a205_1390490_c1 nmdc:mga0a205_1390490_c1_52_480 137
344 3300050515 nmdc:mga0a205_155460_c1 nmdc:mga0a205_155460_c1_996_1424 137
345 3300054114 Ga0501084_0146715 Ga0501084_0146715_920_1342 137
346 3300054114 Ga0501084_0513544 Ga0501084_0513544_140_562 137
347 3300059424 Ga0590075_004839 Ga0590075_004839_1972_2394 137
348 3300060353 Ga0501082_0177431 Ga0501082_0177431_138_560 137
349 3300060353 Ga0501082_0265458 Ga0501082_0265458_561_983 137
350 3300060353 Ga0501082_0581142 Ga0501082_0581142_510_938 137
351 3300061734 Ga0530510_0154873 Ga0530510_0154873_488_910 137
352 3300005330 Ga0070690_100423938 Ga0070690_1004239382 138
353 3300005347 Ga0070668_100173682 Ga0070668_1001736823 138
354 3300005983 Ga0081540_1067443 Ga0081540_10674433 138
355 3300013306 Ga0163162_10439003 Ga0163162_104390033 138
356 3300031247 Ga0265340_10058388 Ga0265340_100583881 138
357 3300031548 Ga0307408_100017910 Ga0307408_1000179102 138
358 3300031595 Ga0265313_10093278 Ga0265313_100932782 138
359 3300032004 Ga0307414_10000006 Ga0307414_10000006272 138
360 3300041413 Ga0439465_0214535 Ga0439465_0214535_38_550 138
361 3300042876 Ga0451577_0000084 Ga0451577_0000084_17001_17420 138
362 3300044712 Ga0453684_0003652 Ga0453684_0003652_20323_20742 138
363 3300045051 Ga0451576_1000848 Ga0451576_1000848_190_609 138
364 3300001977 JGI24746J21847_1002805 JGI24746J21847_10028051 139
365 3300003320 rootH2_10016736 rootH2_1001673613 139
366 3300005327 Ga0070658_10098411 Ga0070658_100984112 139
367 3300005328 Ga0070676_10072158 Ga0070676_100721582 139
368 3300005344 Ga0070661_100002950 Ga0070661_1000029504 139
369 3300005439 Ga0070711_100002612 Ga0070711_1000026122 139
370 3300005444 Ga0070694_100016436 Ga0070694_1000164363 139
371 3300005459 Ga0068867_100000121 Ga0068867_10000012130 139
372 3300005539 Ga0068853_100340528 Ga0068853_1003405282 139
373 3300005564 Ga0070664_100010286 Ga0070664_1000102863 139
374 3300005840 Ga0068870_10533697 Ga0068870_105336971 139
375 3300006173 Ga0070716_100194336 Ga0070716_1001943362 139
376 3300006178 Ga0075367_11020827 Ga0075367_110208271 139
377 3300006353 Ga0075370_10642850 Ga0075370_106428502 139
378 3300006358 Ga0068871_100216511 Ga0068871_1002165112 139
379 3300006871 Ga0075434_100818288 Ga0075434_1008182881 139
380 3300006881 Ga0068865_100661987 Ga0068865_1006619872 139
381 3300006914 Ga0075436_100220337 Ga0075436_1002203372 139
382 3300009098 Ga0105245_10162270 Ga0105245_101622702 139
383 3300009148 Ga0105243_10000065 Ga0105243_10000065106 139
384 3300009545 Ga0105237_10469216 Ga0105237_104692161 139
385 3300010375 Ga0105239_11615567 Ga0105239_116155672 139
386 3300013100 Ga0157373_10000494 Ga0157373_1000049426 139
387 3300013296 Ga0157374_10004213 Ga0157374_1000421311 139
388 3300014969 Ga0157376_10005050 Ga0157376_1000505010 139
389 3300014969 Ga0157376_10016319 Ga0157376_100163193 139
390 3300025907 Ga0207645_10126286 Ga0207645_101262862 139
391 3300025909 Ga0207705_10077254 Ga0207705_100772543 139
392 3300025916 Ga0207663_10006748 Ga0207663_100067483 139
393 3300025920 Ga0207649_10003846 Ga0207649_100038467 139
394 3300025920 Ga0207649_10388405 Ga0207649_103884051 139
395 3300025927 Ga0207687_10497245 Ga0207687_104972452 139
396 3300025935 Ga0207709_10000866 Ga0207709_100008666 139
397 3300025935 Ga0207709_10004034 Ga0207709_100040348 139
398 3300025938 Ga0207704_10914484 Ga0207704_109144841 139
399 3300025939 Ga0207665_10045547 Ga0207665_100455472 139
400 3300025945 Ga0207679_10022196 Ga0207679_100221963 139
401 3300026089 Ga0207648_10001393 Ga0207648_1000139315 139
402 3300031250 Ga0265331_10021410 Ga0265331_100214103 139
403 3300031251 Ga0265327_10007650 Ga0265327_100076508 139
404 3300031548 Ga0307408_100000052 Ga0307408_10000005292 139
405 3300031548 Ga0307408_100069862 Ga0307408_1000698621 139
406 3300031665 Ga0316575_10013757 Ga0316575_100137574 139
407 3300031665 Ga0316575_10116222 Ga0316575_101162221 139
408 3300031691 Ga0316579_10000607 Ga0316579_100006075 139
409 3300031691 Ga0316579_10012654 Ga0316579_100126542 139
410 3300031691 Ga0316579_10025046 Ga0316579_100250462 139
411 3300031727 Ga0316576_10032308 Ga0316576_100323084 139
412 3300031727 Ga0316576_10233265 Ga0316576_102332652 139
413 3300031728 Ga0316578_10001630 Ga0316578_100016305 139
414 3300031728 Ga0316578_10020902 Ga0316578_100209022 139
415 3300031728 Ga0316578_10177043 Ga0316578_101770432 139
416 3300031728 Ga0316578_10279281 Ga0316578_102792812 139
417 3300031728 Ga0316578_10533113 Ga0316578_105331132 139
418 3300031733 Ga0316577_10003201 Ga0316577_100032015 139
419 3300031733 Ga0316577_10007239 Ga0316577_100072395 139
420 3300031733 Ga0316577_10178194 Ga0316577_101781942 139
421 3300031733 Ga0316577_10471804 Ga0316577_104718042 139
422 3300031824 Ga0307413_10225152 Ga0307413_102251521 139
423 3300031852 Ga0307410_10182622 Ga0307410_101826222 139
424 3300031852 Ga0307410_10404233 Ga0307410_104042332 139
425 3300031901 Ga0307406_10000998 Ga0307406_100009985 139
426 3300031903 Ga0307407_10000138 Ga0307407_1000013815 139
427 3300031903 Ga0307407_10136463 Ga0307407_101364632 139
428 3300031911 Ga0307412_10000070 Ga0307412_1000007087 139
429 3300031911 Ga0307412_10800684 Ga0307412_108006841 139
430 3300031995 Ga0307409_100945538 Ga0307409_1009455382 139
431 3300032002 Ga0307416_100003448 Ga0307416_1000034484 139
432 3300032004 Ga0307414_10294232 Ga0307414_102942322 139
433 3300032005 Ga0307411_10089624 Ga0307411_100896241 139
434 3300032133 Ga0316583_10016759 Ga0316583_100167592 139
435 3300032133 Ga0316583_10017341 Ga0316583_100173412 139
436 3300032137 Ga0316585_10001825 Ga0316585_100018254 139
437 3300032137 Ga0316585_10091235 Ga0316585_100912352 139
438 3300032139 Ga0316580_10004252 Ga0316580_100042522 139
439 3300032139 Ga0316580_10006293 Ga0316580_100062933 139
440 3300032139 Ga0316580_10010246 Ga0316580_100102463 139
441 3300032139 Ga0316580_10033977 Ga0316580_100339772 139
442 3300035398 Ga0316574_0001379 Ga0316574_0001379_1606_2031 139
443 3300035398 Ga0316574_0013033 Ga0316574_0013033_2481_2921 139
444 3300035398 Ga0316574_0022006 Ga0316574_0022006_1155_1637 139
445 3300035398 Ga0316574_0268067 Ga0316574_0268067_37_462 139
446 3300035398 Ga0316574_1006386 Ga0316574_1006386_31_465 139
447 3300036647 Ga0316582_0003471 Ga0316582_0003471_1873_2298 139
448 3300036647 Ga0316582_0008269 Ga0316582_0008269_2418_2843 139
449 3300036647 Ga0316582_0020030 Ga0316582_0020030_3262_3744 139
450 3300036712 Ga0316584_0013881 Ga0316584_0013881_1524_1949 139
451 3300036712 Ga0316584_0033065 Ga0316584_0033065_2367_2849 139
452 3300036712 Ga0316584_0605434 Ga0316584_0605434_90_515 139
453 3300037588 Ga0316581_0000045 Ga0316581_0000045_4799_5224 139
454 3300038725 Ga0400484_07464 Ga0400484_07464_2490_2921 139
455 3300041408 Ga0439453_0000612 Ga0439453_0000612_3371_3790 139
456 3300042118 Ga0450914_034123 Ga0450914_034123_117_536 139
457 3300042127 Ga0450890_000066 Ga0450890_000066_4250_4669 139
458 3300042129 Ga0450891_007169 Ga0450891_007169_11_430 139
459 3300042130 Ga0450892_000055 Ga0450892_000055_4586_5005 139
460 3300042532 Ga0450893_0000433 Ga0450893_0000433_4991_5410 139
461 3300042532 Ga0450893_0001841 Ga0450893_0001841_1338_1757 139
462 3300042532 Ga0450893_0049512 Ga0450893_0049512_28_447 139
463 3300042876 Ga0451577_0002686 Ga0451577_0002686_3801_4220 139
464 3300044712 Ga0453684_0143703 Ga0453684_0143703_2384_2806 139
465 3300045051 Ga0451576_0019023 Ga0451576_0019023_6438_6860 139
466 3300048924 Ga0496121_0029001 Ga0496121_0029001_2630_3049 139
467 3300049569 Ga0501032_0000245 Ga0501032_0000245_14415_14837 139
468 3300049569 Ga0501032_0008380 Ga0501032_0008380_5461_5880 139
469 3300049570 Ga0501033_0000002 Ga0501033_0000002_50967_51389 139
470 3300049575 Ga0501039_0163877 Ga0501039_0163877_640_1065 139
471 3300049665 Ga0501227_000800 Ga0501227_000800_4887_5306 139
472 3300053136 Ga0500559_0001204 Ga0500559_0001204_2186_2611 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

51

168

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9401 1 139
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.9378 4 139
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9335 1 139
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.9311 6 137
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.9244 4 139
ID Description Score Start End Superfamily
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9373 4 139 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9364 4 138 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9345 3 139 2.60.120.460
2cu5A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9339 5 137 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9241 4 139 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A2V5S9A0-F1-model_v4 YjbQ family protein 0.9847 1 139
AF-A0A2A2Q1B5-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9845 2 139
AF-A0A2E7SVX0-F1-model_v4 YjbQ family protein 0.9838 3 139
AF-A0A523PPF0-F1-model_v4 YjbQ family protein 0.9825 1 139
AF-A0A261SQ41-F1-model_v4 Secondary thiamine-phosphate synthase 0.9823 2 138

Feature Viewer

pLDDT pTM Quality
93.38 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map