F450858
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 472 | 321 | 472 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300041413|Ga0439465_0214535|Ga0439465_0214535_38_550 |
| Length | 170 |
| Sequence | MCLRDVSWSCPSFIGGRCFFVAIHRLADLSSVMAAYAESFQVRTRGKGTFEITGEVAAIVRRSGIQAGIVTVFVRHTSASLVIMENADPSARRDLEAFFDHLVPEDTPYFVHTYEGPDDMPSHIRMALTRTSEVVPVVNGQMALGTWQGIFLFEHRRAPHQREIVVSVVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 156 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 172 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 173 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 174 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 186 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 187 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 188 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 189 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 190 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 191 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 192 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 193 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 196 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 197 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 198 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 199 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 200 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 201 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 202 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 203 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 204 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 205 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 210 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 221 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 224 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 225 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 226 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 227 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 228 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 229 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 230 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 231 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 255 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 257 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 258 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 259 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 260 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 261 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 262 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 270 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 271 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 272 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 274 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 277 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 278 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 279 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 280 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 281 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 283 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 284 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 286 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 293 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 294 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 295 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 296 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 298 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 299 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 300 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 301 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 302 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 303 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 304 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049849 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought | Metagenome | Rhizosphere |
| 308 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 309 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.64 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002805 | 3300001977 | Bacteria | 2746 |
| 2 | JGI24739J22299_10084802 | 3300001989 | Bacteria | 969 |
| 3 | rootH2_10016736 | 3300003320 | Bacteria | 18315 |
| 4 | JGI26129J50193_1001444 | 3300003349 | Bacteria | 1612 |
| 5 | Ga0070658_10098411 | 3300005327 | Bacteria | 2416 |
| 6 | Ga0070676_10005440 | 3300005328 | Bacteria | 6786 |
| 7 | Ga0070676_10072158 | 3300005328 | Bacteria | 2075 |
| 8 | Ga0070683_100121115 | 3300005329 | Bacteria | 2472 |
| 9 | Ga0070690_100089256 | 3300005330 | Bacteria | 2027 |
| 10 | Ga0070690_100423938 | 3300005330 | Unclassified | 981 |
| 11 | Ga0070677_10008591 | 3300005333 | Bacteria | 3443 |
| 12 | Ga0070666_10090799 | 3300005335 | Bacteria | 2098 |
| 13 | Ga0070666_10374814 | 3300005335 | Bacteria | 1021 |
| 14 | Ga0070680_100026972 | 3300005336 | Bacteria | 4598 |
| 15 | Ga0070682_100037128 | 3300005337 | Bacteria | 2981 |
| 16 | Ga0070660_100039287 | 3300005339 | Bacteria | 3596 |
| 17 | Ga0070660_100748973 | 3300005339 | Bacteria | 820 |
| 18 | Ga0070689_100033981 | 3300005340 | Bacteria | 3889 |
| 19 | Ga0070691_10001282 | 3300005341 | Bacteria | 10632 |
| 20 | Ga0070687_100017829 | 3300005343 | Bacteria | 3274 |
| 21 | Ga0070687_100057281 | 3300005343 | Bacteria | 2043 |
| 22 | Ga0070661_100002950 | 3300005344 | Bacteria | 11735 |
| 23 | Ga0070661_100027708 | 3300005344 | Bacteria | 4082 |
| 24 | Ga0070668_100021753 | 3300005347 | Bacteria | 4846 |
| 25 | Ga0070668_100173682 | 3300005347 | Bacteria | 1756 |
| 26 | Ga0070669_100004611 | 3300005353 | Bacteria | 9951 |
| 27 | Ga0070675_100207918 | 3300005354 | Bacteria | 1700 |
| 28 | Ga0070671_100243163 | 3300005355 | Bacteria | 1528 |
| 29 | Ga0070674_100033686 | 3300005356 | Bacteria | 3412 |
| 30 | Ga0070673_100003504 | 3300005364 | Bacteria | 9780 |
| 31 | Ga0070673_100075488 | 3300005364 | Bacteria | 2719 |
| 32 | Ga0070673_100328600 | 3300005364 | Bacteria | 1352 |
| 33 | Ga0070688_100091699 | 3300005365 | Bacteria | 1986 |
| 34 | Ga0070659_100011236 | 3300005366 | Bacteria | 6615 |
| 35 | Ga0070667_101807059 | 3300005367 | Bacteria | 575 |
| 36 | Ga0070711_100002612 | 3300005439 | Bacteria | 10315 |
| 37 | Ga0070700_100012173 | 3300005441 | Bacteria | 4791 |
| 38 | Ga0070700_101151856 | 3300005441 | Unclassified | 645 |
| 39 | Ga0070694_100007190 | 3300005444 | Bacteria | 6778 |
| 40 | Ga0070694_100012488 | 3300005444 | Bacteria | 5283 |
| 41 | Ga0070694_100016436 | 3300005444 | Bacteria | 4657 |
| 42 | Ga0070708_100135896 | 3300005445 | Bacteria | 2277 |
| 43 | Ga0070663_100046777 | 3300005455 | Bacteria | 3063 |
| 44 | Ga0070678_100073493 | 3300005456 | Bacteria | 2566 |
| 45 | Ga0070662_100221613 | 3300005457 | Bacteria | 1509 |
| 46 | Ga0070681_10047655 | 3300005458 | Bacteria | 4284 |
| 47 | Ga0068867_100000121 | 3300005459 | Bacteria | 49744 |
| 48 | Ga0070685_10252347 | 3300005466 | Bacteria | 1169 |
| 49 | Ga0070706_100003758 | 3300005467 | Bacteria | 14825 |
| 50 | Ga0070707_100000830 | 3300005468 | Bacteria | 30547 |
| 51 | Ga0070698_100000901 | 3300005471 | Bacteria | 32627 |
| 52 | Ga0070698_100231387 | 3300005471 | Bacteria | 1781 |
| 53 | Ga0070699_100001545 | 3300005518 | Bacteria | 21044 |
| 54 | Ga0070699_100112603 | 3300005518 | Bacteria | 2390 |
| 55 | Ga0070679_100201903 | 3300005530 | Bacteria | 1954 |
| 56 | Ga0070684_100450694 | 3300005535 | Bacteria | 1189 |
| 57 | Ga0070697_100059029 | 3300005536 | Bacteria | 3122 |
| 58 | Ga0070697_100095442 | 3300005536 | Bacteria | 2466 |
| 59 | Ga0070697_100113855 | 3300005536 | Bacteria | 2257 |
| 60 | Ga0068853_100340528 | 3300005539 | Bacteria | 1393 |
| 61 | Ga0070686_100001095 | 3300005544 | Bacteria | 15614 |
| 62 | Ga0070686_100010450 | 3300005544 | Bacteria | 5234 |
| 63 | Ga0070686_100235167 | 3300005544 | Bacteria | 1331 |
| 64 | Ga0070695_100004355 | 3300005545 | Bacteria | 8299 |
| 65 | Ga0070696_100002650 | 3300005546 | Bacteria | 11864 |
| 66 | Ga0070665_100258759 | 3300005548 | Bacteria | 1742 |
| 67 | Ga0070704_100750009 | 3300005549 | Bacteria | 869 |
| 68 | Ga0068855_101088327 | 3300005563 | Bacteria | 836 |
| 69 | Ga0070664_100000711 | 3300005564 | Bacteria | 25471 |
| 70 | Ga0070664_100010286 | 3300005564 | Bacteria | 7590 |
| 71 | Ga0068857_100042510 | 3300005577 | Bacteria | 4033 |
| 72 | Ga0068854_100025511 | 3300005578 | Bacteria | 4057 |
| 73 | Ga0068854_102061091 | 3300005578 | Bacteria | 526 |
| 74 | Ga0070702_100041102 | 3300005615 | Bacteria | 2591 |
| 75 | Ga0068852_100102949 | 3300005616 | Bacteria | 2581 |
| 76 | Ga0068861_100098281 | 3300005719 | Bacteria | 2323 |
| 77 | Ga0068870_10533697 | 3300005840 | Bacteria | 787 |
| 78 | Ga0068863_100334653 | 3300005841 | Bacteria | 1472 |
| 79 | Ga0068860_100093310 | 3300005843 | Bacteria | 2869 |
| 80 | Ga0068862_100038503 | 3300005844 | Bacteria | 4055 |
| 81 | Ga0081455_10006888 | 3300005937 | Bacteria | 12097 |
| 82 | Ga0081455_10516558 | 3300005937 | Unclassified | 798 |
| 83 | Ga0081540_1067443 | 3300005983 | Unclassified | 1672 |
| 84 | Ga0075432_10004286 | 3300006058 | Bacteria | 4855 |
| 85 | Ga0075432_10088848 | 3300006058 | Bacteria | 1129 |
| 86 | Ga0070716_100026203 | 3300006173 | Unclassified | 3120 |
| 87 | Ga0070716_100194336 | 3300006173 | Bacteria | 1343 |
| 88 | Ga0075367_11020827 | 3300006178 | Bacteria | 528 |
| 89 | Ga0097621_100003300 | 3300006237 | Bacteria | 11105 |
| 90 | Ga0097621_100035488 | 3300006237 | Bacteria | 3985 |
| 91 | Ga0075370_10642850 | 3300006353 | Bacteria | 644 |
| 92 | Ga0068871_100009624 | 3300006358 | Bacteria | 7017 |
| 93 | Ga0068871_100216511 | 3300006358 | Bacteria | 1658 |
| 94 | Ga0075430_100011257 | 3300006846 | Bacteria | 7588 |
| 95 | Ga0075431_100119403 | 3300006847 | Bacteria | 2720 |
| 96 | Ga0075433_10167333 | 3300006852 | Bacteria | 1956 |
| 97 | Ga0075434_100208994 | 3300006871 | Bacteria | 1972 |
| 98 | Ga0075434_100818288 | 3300006871 | Bacteria | 947 |
| 99 | Ga0075434_101167095 | 3300006871 | Bacteria | 782 |
| 100 | Ga0075429_101281626 | 3300006880 | Bacteria | 639 |
| 101 | Ga0068865_100026050 | 3300006881 | Bacteria | 3852 |
| 102 | Ga0068865_100661987 | 3300006881 | Bacteria | 888 |
| 103 | Ga0075436_100220337 | 3300006914 | Bacteria | 1346 |
| 104 | Ga0075435_100065163 | 3300007076 | Bacteria | 2961 |
| 105 | Ga0075435_100086570 | 3300007076 | Bacteria | 2581 |
| 106 | Ga0105245_10015504 | 3300009098 | Bacteria | 6645 |
| 107 | Ga0105245_10162270 | 3300009098 | Bacteria | 2122 |
| 108 | Ga0114129_10320723 | 3300009147 | Bacteria | 2060 |
| 109 | Ga0114129_11161783 | 3300009147 | Bacteria | 963 |
| 110 | Ga0105243_10000065 | 3300009148 | Bacteria | 124947 |
| 111 | Ga0105243_10002767 | 3300009148 | Bacteria | 14580 |
| 112 | Ga0105242_10000070 | 3300009176 | Bacteria | 71709 |
| 113 | Ga0105237_10469216 | 3300009545 | Bacteria | 1265 |
| 114 | Ga0105239_10040800 | 3300010375 | Bacteria | 5086 |
| 115 | Ga0105239_11615567 | 3300010375 | Bacteria | 750 |
| 116 | Ga0105246_10016860 | 3300011119 | Bacteria | 4634 |
| 117 | Ga0157373_10000494 | 3300013100 | Bacteria | 31159 |
| 118 | Ga0157371_10029105 | 3300013102 | Bacteria | 3998 |
| 119 | Ga0157369_10076574 | 3300013105 | Bacteria | 3586 |
| 120 | Ga0157374_10004213 | 3300013296 | Bacteria | 12087 |
| 121 | Ga0157374_10024127 | 3300013296 | Bacteria | 5449 |
| 122 | Ga0157374_10404666 | 3300013296 | Bacteria | 1362 |
| 123 | Ga0157374_11992453 | 3300013296 | Bacteria | 607 |
| 124 | Ga0157378_10007689 | 3300013297 | Bacteria | 9401 |
| 125 | Ga0157378_10232746 | 3300013297 | Bacteria | 1756 |
| 126 | Ga0163162_10439003 | 3300013306 | Bacteria | 1437 |
| 127 | Ga0157372_10964343 | 3300013307 | Bacteria | 988 |
| 128 | Ga0157375_10032744 | 3300013308 | Bacteria | 4932 |
| 129 | Ga0157380_10453167 | 3300014326 | Bacteria | 1233 |
| 130 | Ga0157377_10003551 | 3300014745 | Bacteria | 7061 |
| 131 | Ga0157376_10005050 | 3300014969 | Bacteria | 9202 |
| 132 | Ga0157376_10006856 | 3300014969 | Bacteria | 8065 |
| 133 | Ga0157376_10008529 | 3300014969 | Bacteria | 7402 |
| 134 | Ga0157376_10016319 | 3300014969 | Bacteria | 5635 |
| 135 | Ga0207680_10304282 | 3300025903 | Bacteria | 1112 |
| 136 | Ga0207645_10000271 | 3300025907 | Bacteria | 42808 |
| 137 | Ga0207645_10126286 | 3300025907 | Bacteria | 1663 |
| 138 | Ga0207705_10077254 | 3300025909 | Bacteria | 2422 |
| 139 | Ga0207684_10001070 | 3300025910 | Bacteria | 30735 |
| 140 | Ga0207684_10047878 | 3300025910 | Bacteria | 3625 |
| 141 | Ga0207707_10303610 | 3300025912 | Bacteria | 1380 |
| 142 | Ga0207663_10006748 | 3300025916 | Bacteria | 5903 |
| 143 | Ga0207660_10049389 | 3300025917 | Bacteria | 2982 |
| 144 | Ga0207662_10011546 | 3300025918 | Bacteria | 4904 |
| 145 | Ga0207662_10495354 | 3300025918 | Bacteria | 841 |
| 146 | Ga0207657_10001685 | 3300025919 | Bacteria | 23828 |
| 147 | Ga0207649_10003846 | 3300025920 | Bacteria | 8186 |
| 148 | Ga0207649_10012362 | 3300025920 | Bacteria | 4735 |
| 149 | Ga0207649_10388405 | 3300025920 | Unclassified | 1042 |
| 150 | Ga0207652_10124176 | 3300025921 | Bacteria | 2299 |
| 151 | Ga0207646_10000617 | 3300025922 | Bacteria | 46226 |
| 152 | Ga0207646_10173414 | 3300025922 | Unclassified | 1948 |
| 153 | Ga0207681_10177009 | 3300025923 | Bacteria | 1621 |
| 154 | Ga0207681_10938179 | 3300025923 | Bacteria | 725 |
| 155 | Ga0207650_10026780 | 3300025925 | Bacteria | 4117 |
| 156 | Ga0207650_11235577 | 3300025925 | Unclassified | 636 |
| 157 | Ga0207687_10497245 | 3300025927 | Bacteria | 1017 |
| 158 | Ga0207644_10346390 | 3300025931 | Bacteria | 1206 |
| 159 | Ga0207706_10000107 | 3300025933 | Bacteria | 88259 |
| 160 | Ga0207686_10002834 | 3300025934 | Bacteria | 9365 |
| 161 | Ga0207709_10000866 | 3300025935 | Bacteria | 23102 |
| 162 | Ga0207709_10004034 | 3300025935 | Bacteria | 8551 |
| 163 | Ga0207709_10042410 | 3300025935 | Bacteria | 2737 |
| 164 | Ga0207670_10024419 | 3300025936 | Unclassified | 3778 |
| 165 | Ga0207670_10059705 | 3300025936 | Bacteria | 2595 |
| 166 | Ga0207669_10151245 | 3300025937 | Bacteria | 1626 |
| 167 | Ga0207669_10691429 | 3300025937 | Bacteria | 837 |
| 168 | Ga0207704_10141737 | 3300025938 | Bacteria | 1682 |
| 169 | Ga0207704_10914484 | 3300025938 | Bacteria | 738 |
| 170 | Ga0207704_10967719 | 3300025938 | Bacteria | 718 |
| 171 | Ga0207665_10016833 | 3300025939 | Bacteria | 4802 |
| 172 | Ga0207665_10023782 | 3300025939 | Bacteria | 4035 |
| 173 | Ga0207665_10045547 | 3300025939 | Bacteria | 2937 |
| 174 | Ga0207691_10000472 | 3300025940 | Bacteria | 39858 |
| 175 | Ga0207691_10121636 | 3300025940 | Bacteria | 2313 |
| 176 | Ga0207691_10152515 | 3300025940 | Bacteria | 2031 |
| 177 | Ga0207679_10004226 | 3300025945 | Bacteria | 8921 |
| 178 | Ga0207679_10019984 | 3300025945 | Bacteria | 4512 |
| 179 | Ga0207679_10022196 | 3300025945 | Bacteria | 4317 |
| 180 | Ga0207651_10055516 | 3300025960 | Bacteria | 2721 |
| 181 | Ga0207651_10130757 | 3300025960 | Bacteria | 1921 |
| 182 | Ga0207651_10226575 | 3300025960 | Bacteria | 1514 |
| 183 | Ga0207668_10377526 | 3300025972 | Bacteria | 1192 |
| 184 | Ga0207658_11591682 | 3300025986 | Bacteria | 597 |
| 185 | Ga0207677_10664361 | 3300026023 | Bacteria | 921 |
| 186 | Ga0207678_10028464 | 3300026067 | Bacteria | 4879 |
| 187 | Ga0207708_10006220 | 3300026075 | Bacteria | 8846 |
| 188 | Ga0207641_10060311 | 3300026088 | Bacteria | 3234 |
| 189 | Ga0207648_10000803 | 3300026089 | Bacteria | 35454 |
| 190 | Ga0207648_10001393 | 3300026089 | Bacteria | 26615 |
| 191 | Ga0207674_10055223 | 3300026116 | Bacteria | 4039 |
| 192 | Ga0207675_100038086 | 3300026118 | Bacteria | 4487 |
| 193 | Ga0207683_10000072 | 3300026121 | Bacteria | 78277 |
| 194 | Ga0207698_10251676 | 3300026142 | Bacteria | 1617 |
| 195 | Ga0209973_1005227 | 3300027252 | Bacteria | 1372 |
| 196 | Ga0209969_1000029 | 3300027360 | Bacteria | 17473 |
| 197 | Ga0209981_1001270 | 3300027378 | Bacteria | 3199 |
| 198 | Ga0209996_1000002 | 3300027395 | Bacteria | 51944 |
| 199 | Ga0209984_1000034 | 3300027424 | Bacteria | 13836 |
| 200 | Ga0210000_1017928 | 3300027462 | Bacteria | 1074 |
| 201 | Ga0209968_1000216 | 3300027526 | Bacteria | 10078 |
| 202 | Ga0209999_1000112 | 3300027543 | Bacteria | 10076 |
| 203 | Ga0209982_1000894 | 3300027552 | Bacteria | 3924 |
| 204 | Ga0209970_1000257 | 3300027614 | Bacteria | 8708 |
| 205 | Ga0210002_1000315 | 3300027617 | Bacteria | 6668 |
| 206 | Ga0209983_1000366 | 3300027665 | Bacteria | 9568 |
| 207 | Ga0209966_1000389 | 3300027695 | Bacteria | 13145 |
| 208 | Ga0209966_1011966 | 3300027695 | Bacteria | 1588 |
| 209 | Ga0209998_10000081 | 3300027717 | Bacteria | 37388 |
| 210 | Ga0209974_10005167 | 3300027876 | Bacteria | 4608 |
| 211 | Ga0209974_10180927 | 3300027876 | Bacteria | 772 |
| 212 | Ga0207428_10071451 | 3300027907 | Bacteria | 2726 |
| 213 | Ga0268265_10133408 | 3300028380 | Bacteria | 2068 |
| 214 | Ga0268264_10139964 | 3300028381 | Bacteria | 2157 |
| 215 | Ga0265340_10058388 | 3300031247 | Bacteria | 1853 |
| 216 | Ga0265331_10021410 | 3300031250 | Bacteria | 3309 |
| 217 | Ga0265327_10007650 | 3300031251 | Bacteria | 8279 |
| 218 | Ga0307408_100000052 | 3300031548 | Bacteria | 149094 |
| 219 | Ga0307408_100017910 | 3300031548 | Bacteria | 4749 |
| 220 | Ga0307408_100069862 | 3300031548 | Bacteria | 2591 |
| 221 | Ga0307408_100305382 | 3300031548 | Bacteria | 1334 |
| 222 | Ga0265313_10093278 | 3300031595 | Bacteria | 1347 |
| 223 | Ga0316575_10013757 | 3300031665 | Bacteria | 3028 |
| 224 | Ga0316575_10116222 | 3300031665 | Bacteria | 1093 |
| 225 | Ga0316579_10000607 | 3300031691 | Bacteria | 12080 |
| 226 | Ga0316579_10012654 | 3300031691 | Bacteria | 3613 |
| 227 | Ga0316579_10025046 | 3300031691 | Bacteria | 2691 |
| 228 | Ga0316576_10032308 | 3300031727 | Bacteria | 3718 |
| 229 | Ga0316576_10233265 | 3300031727 | Bacteria | 1383 |
| 230 | Ga0316578_10001630 | 3300031728 | Bacteria | 9302 |
| 231 | Ga0316578_10020902 | 3300031728 | Bacteria | 3625 |
| 232 | Ga0316578_10177043 | 3300031728 | Bacteria | 1285 |
| 233 | Ga0316578_10279281 | 3300031728 | Bacteria | 1000 |
| 234 | Ga0316578_10533113 | 3300031728 | Bacteria | 690 |
| 235 | Ga0307405_10001965 | 3300031731 | Bacteria | 8877 |
| 236 | Ga0316577_10003201 | 3300031733 | Bacteria | 8235 |
| 237 | Ga0316577_10007239 | 3300031733 | Bacteria | 5915 |
| 238 | Ga0316577_10178194 | 3300031733 | Bacteria | 1200 |
| 239 | Ga0316577_10471804 | 3300031733 | Bacteria | 713 |
| 240 | Ga0307413_10225152 | 3300031824 | Bacteria | 1373 |
| 241 | Ga0307413_11303225 | 3300031824 | Unclassified | 635 |
| 242 | Ga0307410_10030150 | 3300031852 | Bacteria | 3463 |
| 243 | Ga0307410_10182622 | 3300031852 | Bacteria | 1589 |
| 244 | Ga0307410_10404233 | 3300031852 | Bacteria | 1104 |
| 245 | Ga0307406_10000998 | 3300031901 | Bacteria | 15695 |
| 246 | Ga0307406_10009125 | 3300031901 | Bacteria | 5552 |
| 247 | Ga0307407_10000138 | 3300031903 | Bacteria | 22391 |
| 248 | Ga0307407_10136463 | 3300031903 | Bacteria | 1577 |
| 249 | Ga0307412_10000070 | 3300031911 | Bacteria | 107229 |
| 250 | Ga0307412_10007776 | 3300031911 | Bacteria | 6098 |
| 251 | Ga0307412_10800684 | 3300031911 | Bacteria | 818 |
| 252 | Ga0307409_100546297 | 3300031995 | Bacteria | 1136 |
| 253 | Ga0307409_100945538 | 3300031995 | Bacteria | 877 |
| 254 | Ga0307416_100003448 | 3300032002 | Bacteria | 9286 |
| 255 | Ga0307414_10000006 | 3300032004 | Bacteria | 451918 |
| 256 | Ga0307414_10294232 | 3300032004 | Bacteria | 1370 |
| 257 | Ga0307411_10089624 | 3300032005 | Bacteria | 2143 |
| 258 | Ga0307411_10118727 | 3300032005 | Bacteria | 1908 |
| 259 | Ga0307411_10969494 | 3300032005 | Unclassified | 759 |
| 260 | Ga0307415_100029580 | 3300032126 | Bacteria | 3503 |
| 261 | Ga0316583_10016759 | 3300032133 | Bacteria | 2635 |
| 262 | Ga0316583_10017341 | 3300032133 | Bacteria | 2590 |
| 263 | Ga0316585_10001825 | 3300032137 | Bacteria | 5689 |
| 264 | Ga0316585_10091235 | 3300032137 | Bacteria | 996 |
| 265 | Ga0316580_10004252 | 3300032139 | Bacteria | 4139 |
| 266 | Ga0316580_10006293 | 3300032139 | Bacteria | 3504 |
| 267 | Ga0316580_10010246 | 3300032139 | Bacteria | 2827 |
| 268 | Ga0316580_10033977 | 3300032139 | Bacteria | 1578 |
| 269 | Ga0373928_0074465 | 3300035084 | Bacteria | 846 |
| 270 | Ga0373940_0103205 | 3300035088 | Bacteria | 868 |
| 271 | Ga0373940_0129536 | 3300035088 | Bacteria | 789 |
| 272 | Ga0373949_0161178 | 3300035090 | Bacteria | 654 |
| 273 | Ga0373951_0193406 | 3300035091 | Bacteria | 590 |
| 274 | Ga0373932_0095010 | 3300035112 | Bacteria | 962 |
| 275 | Ga0373941_0007544 | 3300035115 | Bacteria | 2665 |
| 276 | Ga0373960_0021091 | 3300035121 | Bacteria | 1729 |
| 277 | Ga0373942_0273515 | 3300035207 | Unclassified | 580 |
| 278 | Ga0373962_0023498 | 3300035242 | Bacteria | 1643 |
| 279 | Ga0373962_0175516 | 3300035242 | Bacteria | 714 |
| 280 | Ga0373962_0216711 | 3300035242 | Unclassified | 653 |
| 281 | Ga0316574_0001379 | 3300035398 | Bacteria | 11462 |
| 282 | Ga0316574_0013033 | 3300035398 | Bacteria | 4770 |
| 283 | Ga0316574_0022006 | 3300035398 | Bacteria | 3792 |
| 284 | Ga0316574_0268067 | 3300035398 | Bacteria | 1089 |
| 285 | Ga0316574_1006386 | 3300035398 | Bacteria | 502 |
| 286 | Ga0373931_0109333 | 3300035691 | Bacteria | 1566 |
| 287 | Ga0373931_0120018 | 3300035691 | Bacteria | 1502 |
| 288 | Ga0373931_0803364 | 3300035691 | Bacteria | 627 |
| 289 | Ga0316582_0003471 | 3300036647 | Bacteria | 7740 |
| 290 | Ga0316582_0008269 | 3300036647 | Bacteria | 5580 |
| 291 | Ga0316582_0020030 | 3300036647 | Bacteria | 3927 |
| 292 | Ga0316584_0013881 | 3300036712 | Bacteria | 5715 |
| 293 | Ga0316584_0033065 | 3300036712 | Bacteria | 3828 |
| 294 | Ga0316584_0605434 | 3300036712 | Bacteria | 759 |
| 295 | Ga0316581_0000045 | 3300037588 | Bacteria | 13776 |
| 296 | Ga0400484_07464 | 3300038725 | Bacteria | 3385 |
| 297 | Ga0439438_018558 | 3300041405 | Bacteria | 1979 |
| 298 | Ga0439447_021522 | 3300041407 | Bacteria | 1697 |
| 299 | Ga0439453_0000612 | 3300041408 | Bacteria | 4028 |
| 300 | Ga0439461_0007321 | 3300041410 | Bacteria | 1951 |
| 301 | Ga0439466_0049164 | 3300041411 | Unclassified | 1385 |
| 302 | Ga0439465_0214535 | 3300041413 | Bacteria | 704 |
| 303 | Ga0439431_0076015 | 3300041997 | Unclassified | 901 |
| 304 | Ga0439433_0005640 | 3300041999 | Bacteria | 2687 |
| 305 | Ga0439442_037937 | 3300042002 | Bacteria | 1010 |
| 306 | Ga0439432_025293 | 3300042006 | Bacteria | 1948 |
| 307 | Ga0439462_0177030 | 3300042015 | Unclassified | 604 |
| 308 | Ga0450912_007467 | 3300042116 | Unclassified | 888 |
| 309 | Ga0450914_034123 | 3300042118 | Bacteria | 624 |
| 310 | Ga0450890_000066 | 3300042127 | Bacteria | 19203 |
| 311 | Ga0450891_007169 | 3300042129 | Bacteria | 1021 |
| 312 | Ga0450892_000055 | 3300042130 | Bacteria | 12381 |
| 313 | Ga0450892_016033 | 3300042130 | Bacteria | 703 |
| 314 | Ga0450896_030629 | 3300042133 | Unclassified | 814 |
| 315 | Ga0439446_0008550 | 3300042156 | Bacteria | 2723 |
| 316 | Ga0439434_0013768 | 3300042435 | Bacteria | 2402 |
| 317 | Ga0439464_0010548 | 3300042439 | Bacteria | 2439 |
| 318 | Ga0450916_025640 | 3300042530 | Unclassified | 834 |
| 319 | Ga0450893_0000433 | 3300042532 | Bacteria | 5915 |
| 320 | Ga0450893_0001841 | 3300042532 | Bacteria | 3273 |
| 321 | Ga0450893_0049512 | 3300042532 | Bacteria | 785 |
| 322 | Ga0451577_0000084 | 3300042876 | Bacteria | 213553 |
| 323 | Ga0451577_0002686 | 3300042876 | Bacteria | 20743 |
| 324 | Ga0451577_0118724 | 3300042876 | Bacteria | 2369 |
| 325 | Ga0451577_0138915 | 3300042876 | Bacteria | 2183 |
| 326 | Ga0451577_0830348 | 3300042876 | Bacteria | 834 |
| 327 | Ga0453683_0060643 | 3300044673 | Bacteria | 2365 |
| 328 | Ga0453683_0903836 | 3300044673 | Bacteria | 584 |
| 329 | Ga0453684_0003652 | 3300044712 | Bacteria | 34170 |
| 330 | Ga0453684_0143703 | 3300044712 | Bacteria | 2845 |
| 331 | Ga0453684_1195052 | 3300044712 | Bacteria | 799 |
| 332 | Ga0466960_0485312 | 3300044901 | Bacteria | 722 |
| 333 | Ga0451576_0002499 | 3300045051 | Bacteria | 27297 |
| 334 | Ga0451576_0019023 | 3300045051 | Bacteria | 7506 |
| 335 | Ga0451576_0375166 | 3300045051 | Bacteria | 1490 |
| 336 | Ga0451576_0929090 | 3300045051 | Bacteria | 912 |
| 337 | Ga0451576_1000848 | 3300045051 | Bacteria | 876 |
| 338 | Ga0495598_0252915 | 3300046537 | Unclassified | 653 |
| 339 | Ga0495669_0085061 | 3300046684 | Unclassified | 1455 |
| 340 | Ga0495589_0396145 | 3300046794 | Unclassified | 634 |
| 341 | Ga0496121_0029001 | 3300048924 | Bacteria | 5134 |
| 342 | Ga0501290_000136 | 3300049513 | Bacteria | 11526 |
| 343 | Ga0501291_002079 | 3300049514 | Bacteria | 2370 |
| 344 | Ga0501292_000356 | 3300049515 | Bacteria | 6226 |
| 345 | Ga0501293_000935 | 3300049516 | Bacteria | 2190 |
| 346 | Ga0501294_000067 | 3300049517 | Bacteria | 11272 |
| 347 | Ga0501295_000331 | 3300049518 | Bacteria | 4518 |
| 348 | Ga0501296_000129 | 3300049519 | Bacteria | 8738 |
| 349 | Ga0501297_001714 | 3300049520 | Bacteria | 2047 |
| 350 | Ga0501298_000246 | 3300049521 | Bacteria | 7034 |
| 351 | Ga0501299_000050 | 3300049522 | Bacteria | 12953 |
| 352 | Ga0501299_005769 | 3300049522 | Bacteria | 1916 |
| 353 | Ga0501299_009673 | 3300049522 | Unclassified | 1595 |
| 354 | Ga0501300_000541 | 3300049523 | Bacteria | 5645 |
| 355 | Ga0501303_001993 | 3300049526 | Bacteria | 1551 |
| 356 | Ga0501031_0027261 | 3300049568 | Bacteria | 3725 |
| 357 | Ga0501031_0844629 | 3300049568 | Unclassified | 587 |
| 358 | Ga0501032_0000245 | 3300049569 | Bacteria | 45098 |
| 359 | Ga0501032_0008380 | 3300049569 | Bacteria | 7539 |
| 360 | Ga0501033_0000002 | 3300049570 | Bacteria | 668574 |
| 361 | Ga0501036_0056473 | 3300049572 | Bacteria | 3327 |
| 362 | Ga0501036_0118898 | 3300049572 | Bacteria | 2231 |
| 363 | Ga0501036_0408057 | 3300049572 | Bacteria | 1133 |
| 364 | Ga0501037_0187875 | 3300049573 | Bacteria | 1464 |
| 365 | Ga0501038_0152092 | 3300049574 | Bacteria | 1886 |
| 366 | Ga0501038_0615923 | 3300049574 | Bacteria | 820 |
| 367 | Ga0501039_0043210 | 3300049575 | Bacteria | 3482 |
| 368 | Ga0501039_0122701 | 3300049575 | Bacteria | 2037 |
| 369 | Ga0501039_0138767 | 3300049575 | Bacteria | 1909 |
| 370 | Ga0501039_0163877 | 3300049575 | Bacteria | 1748 |
| 371 | Ga0501040_0061857 | 3300049576 | Bacteria | 2575 |
| 372 | Ga0501040_0306389 | 3300049576 | Bacteria | 1135 |
| 373 | Ga0501041_0039004 | 3300049577 | Bacteria | 2881 |
| 374 | Ga0501041_0100827 | 3300049577 | Bacteria | 1787 |
| 375 | Ga0501041_0104090 | 3300049577 | Bacteria | 1758 |
| 376 | Ga0501042_0077484 | 3300049578 | Bacteria | 2380 |
| 377 | Ga0501042_0145088 | 3300049578 | Bacteria | 1711 |
| 378 | Ga0501042_0208149 | 3300049578 | Bacteria | 1410 |
| 379 | Ga0501043_0104557 | 3300049579 | Bacteria | 2225 |
| 380 | Ga0501046_0059853 | 3300049580 | Bacteria | 2982 |
| 381 | Ga0501048_0040005 | 3300049582 | Bacteria | 3361 |
| 382 | Ga0501048_0409975 | 3300049582 | Bacteria | 969 |
| 383 | Ga0501048_0649822 | 3300049582 | Bacteria | 757 |
| 384 | Ga0501068_0140246 | 3300049584 | Bacteria | 1515 |
| 385 | Ga0501069_0069548 | 3300049585 | Bacteria | 1971 |
| 386 | Ga0501069_0425205 | 3300049585 | Bacteria | 788 |
| 387 | Ga0501069_0499194 | 3300049585 | Unclassified | 726 |
| 388 | Ga0501070_0205384 | 3300049586 | Bacteria | 1618 |
| 389 | Ga0501071_0033187 | 3300049587 | Bacteria | 3668 |
| 390 | Ga0501071_0730353 | 3300049587 | Bacteria | 763 |
| 391 | Ga0501072_0054918 | 3300049588 | Bacteria | 3140 |
| 392 | Ga0501074_0315383 | 3300049590 | Bacteria | 1111 |
| 393 | Ga0501075_0092330 | 3300049591 | Bacteria | 2297 |
| 394 | Ga0501076_1133900 | 3300049592 | Bacteria | 644 |
| 395 | Ga0501077_0018857 | 3300049593 | Bacteria | 4366 |
| 396 | Ga0501077_0104718 | 3300049593 | Bacteria | 1793 |
| 397 | Ga0501199_000230 | 3300049650 | Bacteria | 4849 |
| 398 | Ga0501201_000230 | 3300049651 | Bacteria | 4983 |
| 399 | Ga0501206_000661 | 3300049653 | Bacteria | 4170 |
| 400 | Ga0501207_000164 | 3300049654 | Bacteria | 6237 |
| 401 | Ga0501209_005202 | 3300049656 | Bacteria | 2328 |
| 402 | Ga0501211_003233 | 3300049658 | Bacteria | 1687 |
| 403 | Ga0501216_000050 | 3300049660 | Bacteria | 10167 |
| 404 | Ga0501217_001564 | 3300049661 | Bacteria | 4324 |
| 405 | Ga0501223_068949 | 3300049663 | Unclassified | 697 |
| 406 | Ga0501224_055200 | 3300049664 | Unclassified | 613 |
| 407 | Ga0501227_000800 | 3300049665 | Bacteria | 6869 |
| 408 | Ga0501233_000967 | 3300049668 | Bacteria | 4872 |
| 409 | Ga0501236_000352 | 3300049670 | Bacteria | 5050 |
| 410 | Ga0501239_000236 | 3300049672 | Bacteria | 3952 |
| 411 | Ga0501240_024239 | 3300049673 | Unclassified | 935 |
| 412 | Ga0501243_005068 | 3300049675 | Bacteria | 1978 |
| 413 | Ga0501246_000845 | 3300049676 | Bacteria | 2269 |
| 414 | Ga0501247_001899 | 3300049677 | Bacteria | 2107 |
| 415 | Ga0501248_000524 | 3300049678 | Bacteria | 2121 |
| 416 | Ga0501249_003185 | 3300049679 | Bacteria | 3303 |
| 417 | Ga0501250_013185 | 3300049680 | Unclassified | 988 |
| 418 | Ga0501251_008619 | 3300049681 | Unclassified | 1159 |
| 419 | Ga0501256_000342 | 3300049685 | Bacteria | 2874 |
| 420 | Ga0501257_000518 | 3300049686 | Bacteria | 7651 |
| 421 | Ga0501258_010304 | 3300049687 | Bacteria | 987 |
| 422 | Ga0501259_004277 | 3300049688 | Bacteria | 2272 |
| 423 | Ga0501260_000359 | 3300049689 | Bacteria | 3586 |
| 424 | Ga0501261_012485 | 3300049690 | Unclassified | 1143 |
| 425 | Ga0501219_000835 | 3300049703 | Bacteria | 3946 |
| 426 | Ga0501221_000118 | 3300049704 | Bacteria | 9870 |
| 427 | Ga0501225_0000338 | 3300049705 | Bacteria | 14722 |
| 428 | Ga0501229_001720 | 3300049706 | Unclassified | 2564 |
| 429 | Ga0501234_000238 | 3300049707 | Bacteria | 8000 |
| 430 | Ga0501245_000100 | 3300049708 | Bacteria | 8720 |
| 431 | Ga0501079_0229743 | 3300049741 | Bacteria | 1449 |
| 432 | Ga0501080_0060384 | 3300049742 | Bacteria | 3529 |
| 433 | Ga0501081_0071558 | 3300049743 | Bacteria | 2417 |
| 434 | Ga0501083_0230129 | 3300049744 | Bacteria | 1207 |
| 435 | Ga0501264_000777 | 3300049761 | Bacteria | 4180 |
| 436 | Ga0501265_000018 | 3300049762 | Bacteria | 15780 |
| 437 | Ga0501266_001451 | 3300049763 | Bacteria | 3024 |
| 438 | Ga0501269_019576 | 3300049766 | Unclassified | 842 |
| 439 | Ga0501271_000268 | 3300049768 | Bacteria | 4427 |
| 440 | Ga0501272_000423 | 3300049769 | Bacteria | 3719 |
| 441 | Ga0501273_003094 | 3300049770 | Bacteria | 1740 |
| 442 | Ga0501274_000032 | 3300049771 | Bacteria | 8470 |
| 443 | Ga0501275_000249 | 3300049772 | Bacteria | 6296 |
| 444 | Ga0501278_000420 | 3300049774 | Bacteria | 3324 |
| 445 | Ga0501279_000080 | 3300049775 | Bacteria | 16241 |
| 446 | Ga0501281_00280 | 3300049777 | Bacteria | 5300 |
| 447 | Ga0501283_000077 | 3300049779 | Bacteria | 12025 |
| 448 | Ga0501035_0454505 | 3300049822 | Bacteria | 1059 |
| 449 | Ga0501045_0113349 | 3300049824 | Bacteria | 2011 |
| 450 | Ga0501045_0161389 | 3300049824 | Bacteria | 1668 |
| 451 | Ga0501200_00361 | 3300049849 | Bacteria | 1442 |
| 452 | Ga0501212_005430 | 3300049851 | Bacteria | 1682 |
| 453 | Ga0501226_000423 | 3300049853 | Bacteria | 6008 |
| 454 | nmdc:mga05p37_3359_c1 | 3300050507 | Bacteria | 18672 |
| 455 | nmdc:mga05p37_46715_c1 | 3300050507 | Bacteria | 5323 |
| 456 | nmdc:mga09592_95083_c1 | 3300050508 | Bacteria | 2549 |
| 457 | nmdc:mga06r32_64695_c1 | 3300050510 | Bacteria | 3527 |
| 458 | nmdc:mga08y16_47742_c1 | 3300050511 | Bacteria | 4482 |
| 459 | nmdc:mga0n895_1682890_c1 | 3300050512 | Unclassified | 597 |
| 460 | nmdc:mga0n895_1709643_c1 | 3300050512 | Bacteria | 592 |
| 461 | nmdc:mga0n895_244904_c1 | 3300050512 | Bacteria | 1820 |
| 462 | nmdc:mga0rr50_209333_c1 | 3300050513 | Bacteria | 1606 |
| 463 | nmdc:mga0a205_1390490_c1 | 3300050515 | Bacteria | 550 |
| 464 | nmdc:mga0a205_155460_c1 | 3300050515 | Bacteria | 2186 |
| 465 | Ga0500559_0001204 | 3300053136 | Bacteria | 15389 |
| 466 | Ga0501084_0146715 | 3300054114 | Bacteria | 1987 |
| 467 | Ga0501084_0513544 | 3300054114 | Bacteria | 1013 |
| 468 | Ga0590075_004839 | 3300059424 | Bacteria | 3183 |
| 469 | Ga0501082_0177431 | 3300060353 | Bacteria | 1852 |
| 470 | Ga0501082_0265458 | 3300060353 | Bacteria | 1494 |
| 471 | Ga0501082_0581142 | 3300060353 | Bacteria | 980 |
| 472 | Ga0530510_0154873 | 3300061734 | Bacteria | 1693 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035112 | Ga0373932_0095010 | Ga0373932_0095010_26_415 | 126 |
| 2 | 3300035691 | Ga0373931_0803364 | Ga0373931_0803364_221_610 | 126 |
| 3 | 3300041997 | Ga0439431_0076015 | Ga0439431_0076015_29_418 | 126 |
| 4 | 3300049585 | Ga0501069_0069548 | Ga0501069_0069548_14_403 | 126 |
| 5 | 3300049766 | Ga0501269_019576 | Ga0501269_019576_29_418 | 126 |
| 6 | 3300049762 | Ga0501265_000018 | Ga0501265_000018_13889_14284 | 128 |
| 7 | 3300042133 | Ga0450896_030629 | Ga0450896_030629_81_497 | 135 |
| 8 | 3300025939 | Ga0207665_10023782 | Ga0207665_100237822 | 136 |
| 9 | 3300025986 | Ga0207658_11591682 | Ga0207658_115916822 | 136 |
| 10 | 3300001989 | JGI24739J22299_10084802 | JGI24739J22299_100848022 | 137 |
| 11 | 3300003349 | JGI26129J50193_1001444 | JGI26129J50193_10014442 | 137 |
| 12 | 3300005328 | Ga0070676_10005440 | Ga0070676_100054402 | 137 |
| 13 | 3300005329 | Ga0070683_100121115 | Ga0070683_1001211152 | 137 |
| 14 | 3300005330 | Ga0070690_100089256 | Ga0070690_1000892562 | 137 |
| 15 | 3300005333 | Ga0070677_10008591 | Ga0070677_100085915 | 137 |
| 16 | 3300005335 | Ga0070666_10090799 | Ga0070666_100907992 | 137 |
| 17 | 3300005335 | Ga0070666_10374814 | Ga0070666_103748142 | 137 |
| 18 | 3300005336 | Ga0070680_100026972 | Ga0070680_1000269722 | 137 |
| 19 | 3300005337 | Ga0070682_100037128 | Ga0070682_1000371282 | 137 |
| 20 | 3300005339 | Ga0070660_100039287 | Ga0070660_1000392872 | 137 |
| 21 | 3300005339 | Ga0070660_100748973 | Ga0070660_1007489732 | 137 |
| 22 | 3300005340 | Ga0070689_100033981 | Ga0070689_1000339813 | 137 |
| 23 | 3300005341 | Ga0070691_10001282 | Ga0070691_100012827 | 137 |
| 24 | 3300005343 | Ga0070687_100017829 | Ga0070687_1000178293 | 137 |
| 25 | 3300005343 | Ga0070687_100057281 | Ga0070687_1000572812 | 137 |
| 26 | 3300005344 | Ga0070661_100027708 | Ga0070661_1000277083 | 137 |
| 27 | 3300005347 | Ga0070668_100021753 | Ga0070668_1000217534 | 137 |
| 28 | 3300005353 | Ga0070669_100004611 | Ga0070669_1000046114 | 137 |
| 29 | 3300005354 | Ga0070675_100207918 | Ga0070675_1002079182 | 137 |
| 30 | 3300005355 | Ga0070671_100243163 | Ga0070671_1002431632 | 137 |
| 31 | 3300005356 | Ga0070674_100033686 | Ga0070674_1000336862 | 137 |
| 32 | 3300005364 | Ga0070673_100003504 | Ga0070673_1000035048 | 137 |
| 33 | 3300005364 | Ga0070673_100075488 | Ga0070673_1000754882 | 137 |
| 34 | 3300005364 | Ga0070673_100328600 | Ga0070673_1003286002 | 137 |
| 35 | 3300005365 | Ga0070688_100091699 | Ga0070688_1000916991 | 137 |
| 36 | 3300005366 | Ga0070659_100011236 | Ga0070659_1000112366 | 137 |
| 37 | 3300005367 | Ga0070667_101807059 | Ga0070667_1018070591 | 137 |
| 38 | 3300005441 | Ga0070700_100012173 | Ga0070700_1000121733 | 137 |
| 39 | 3300005441 | Ga0070700_101151856 | Ga0070700_1011518561 | 137 |
| 40 | 3300005444 | Ga0070694_100007190 | Ga0070694_1000071906 | 137 |
| 41 | 3300005444 | Ga0070694_100012488 | Ga0070694_1000124882 | 137 |
| 42 | 3300005445 | Ga0070708_100135896 | Ga0070708_1001358962 | 137 |
| 43 | 3300005455 | Ga0070663_100046777 | Ga0070663_1000467774 | 137 |
| 44 | 3300005456 | Ga0070678_100073493 | Ga0070678_1000734934 | 137 |
| 45 | 3300005457 | Ga0070662_100221613 | Ga0070662_1002216132 | 137 |
| 46 | 3300005458 | Ga0070681_10047655 | Ga0070681_100476552 | 137 |
| 47 | 3300005466 | Ga0070685_10252347 | Ga0070685_102523472 | 137 |
| 48 | 3300005467 | Ga0070706_100003758 | Ga0070706_1000037587 | 137 |
| 49 | 3300005468 | Ga0070707_100000830 | Ga0070707_10000083012 | 137 |
| 50 | 3300005471 | Ga0070698_100000901 | Ga0070698_10000090113 | 137 |
| 51 | 3300005471 | Ga0070698_100231387 | Ga0070698_1002313872 | 137 |
| 52 | 3300005518 | Ga0070699_100001545 | Ga0070699_10000154513 | 137 |
| 53 | 3300005518 | Ga0070699_100112603 | Ga0070699_1001126032 | 137 |
| 54 | 3300005530 | Ga0070679_100201903 | Ga0070679_1002019032 | 137 |
| 55 | 3300005535 | Ga0070684_100450694 | Ga0070684_1004506941 | 137 |
| 56 | 3300005536 | Ga0070697_100059029 | Ga0070697_1000590294 | 137 |
| 57 | 3300005536 | Ga0070697_100095442 | Ga0070697_1000954422 | 137 |
| 58 | 3300005536 | Ga0070697_100113855 | Ga0070697_1001138552 | 137 |
| 59 | 3300005544 | Ga0070686_100001095 | Ga0070686_1000010954 | 137 |
| 60 | 3300005544 | Ga0070686_100010450 | Ga0070686_1000104502 | 137 |
| 61 | 3300005544 | Ga0070686_100235167 | Ga0070686_1002351672 | 137 |
| 62 | 3300005545 | Ga0070695_100004355 | Ga0070695_1000043557 | 137 |
| 63 | 3300005546 | Ga0070696_100002650 | Ga0070696_1000026503 | 137 |
| 64 | 3300005548 | Ga0070665_100258759 | Ga0070665_1002587592 | 137 |
| 65 | 3300005549 | Ga0070704_100750009 | Ga0070704_1007500091 | 137 |
| 66 | 3300005563 | Ga0068855_101088327 | Ga0068855_1010883272 | 137 |
| 67 | 3300005564 | Ga0070664_100000711 | Ga0070664_10000071118 | 137 |
| 68 | 3300005577 | Ga0068857_100042510 | Ga0068857_1000425105 | 137 |
| 69 | 3300005578 | Ga0068854_100025511 | Ga0068854_1000255113 | 137 |
| 70 | 3300005578 | Ga0068854_102061091 | Ga0068854_1020610911 | 137 |
| 71 | 3300005615 | Ga0070702_100041102 | Ga0070702_1000411022 | 137 |
| 72 | 3300005616 | Ga0068852_100102949 | Ga0068852_1001029493 | 137 |
| 73 | 3300005719 | Ga0068861_100098281 | Ga0068861_1000982813 | 137 |
| 74 | 3300005841 | Ga0068863_100334653 | Ga0068863_1003346532 | 137 |
| 75 | 3300005843 | Ga0068860_100093310 | Ga0068860_1000933103 | 137 |
| 76 | 3300005844 | Ga0068862_100038503 | Ga0068862_1000385033 | 137 |
| 77 | 3300005937 | Ga0081455_10006888 | Ga0081455_100068882 | 137 |
| 78 | 3300005937 | Ga0081455_10516558 | Ga0081455_105165582 | 137 |
| 79 | 3300006058 | Ga0075432_10004286 | Ga0075432_100042864 | 137 |
| 80 | 3300006058 | Ga0075432_10088848 | Ga0075432_100888482 | 137 |
| 81 | 3300006173 | Ga0070716_100026203 | Ga0070716_1000262035 | 137 |
| 82 | 3300006237 | Ga0097621_100003300 | Ga0097621_1000033004 | 137 |
| 83 | 3300006237 | Ga0097621_100035488 | Ga0097621_1000354883 | 137 |
| 84 | 3300006358 | Ga0068871_100009624 | Ga0068871_1000096247 | 137 |
| 85 | 3300006846 | Ga0075430_100011257 | Ga0075430_1000112576 | 137 |
| 86 | 3300006847 | Ga0075431_100119403 | Ga0075431_1001194032 | 137 |
| 87 | 3300006852 | Ga0075433_10167333 | Ga0075433_101673332 | 137 |
| 88 | 3300006871 | Ga0075434_100208994 | Ga0075434_1002089942 | 137 |
| 89 | 3300006871 | Ga0075434_101167095 | Ga0075434_1011670952 | 137 |
| 90 | 3300006880 | Ga0075429_101281626 | Ga0075429_1012816261 | 137 |
| 91 | 3300006881 | Ga0068865_100026050 | Ga0068865_1000260503 | 137 |
| 92 | 3300007076 | Ga0075435_100065163 | Ga0075435_1000651632 | 137 |
| 93 | 3300007076 | Ga0075435_100086570 | Ga0075435_1000865703 | 137 |
| 94 | 3300009098 | Ga0105245_10015504 | Ga0105245_100155046 | 137 |
| 95 | 3300009147 | Ga0114129_10320723 | Ga0114129_103207232 | 137 |
| 96 | 3300009147 | Ga0114129_11161783 | Ga0114129_111617832 | 137 |
| 97 | 3300009148 | Ga0105243_10002767 | Ga0105243_1000276717 | 137 |
| 98 | 3300009176 | Ga0105242_10000070 | Ga0105242_1000007073 | 137 |
| 99 | 3300010375 | Ga0105239_10040800 | Ga0105239_100408002 | 137 |
| 100 | 3300011119 | Ga0105246_10016860 | Ga0105246_100168602 | 137 |
| 101 | 3300013102 | Ga0157371_10029105 | Ga0157371_100291053 | 137 |
| 102 | 3300013105 | Ga0157369_10076574 | Ga0157369_100765744 | 137 |
| 103 | 3300013296 | Ga0157374_10024127 | Ga0157374_100241274 | 137 |
| 104 | 3300013296 | Ga0157374_10404666 | Ga0157374_104046662 | 137 |
| 105 | 3300013296 | Ga0157374_11992453 | Ga0157374_119924531 | 137 |
| 106 | 3300013297 | Ga0157378_10007689 | Ga0157378_100076898 | 137 |
| 107 | 3300013297 | Ga0157378_10232746 | Ga0157378_102327462 | 137 |
| 108 | 3300013307 | Ga0157372_10964343 | Ga0157372_109643432 | 137 |
| 109 | 3300013308 | Ga0157375_10032744 | Ga0157375_100327442 | 137 |
| 110 | 3300014326 | Ga0157380_10453167 | Ga0157380_104531672 | 137 |
| 111 | 3300014745 | Ga0157377_10003551 | Ga0157377_100035512 | 137 |
| 112 | 3300014969 | Ga0157376_10006856 | Ga0157376_100068563 | 137 |
| 113 | 3300014969 | Ga0157376_10008529 | Ga0157376_100085294 | 137 |
| 114 | 3300025903 | Ga0207680_10304282 | Ga0207680_103042822 | 137 |
| 115 | 3300025907 | Ga0207645_10000271 | Ga0207645_100002718 | 137 |
| 116 | 3300025910 | Ga0207684_10001070 | Ga0207684_1000107028 | 137 |
| 117 | 3300025910 | Ga0207684_10047878 | Ga0207684_100478784 | 137 |
| 118 | 3300025912 | Ga0207707_10303610 | Ga0207707_103036102 | 137 |
| 119 | 3300025917 | Ga0207660_10049389 | Ga0207660_100493893 | 137 |
| 120 | 3300025918 | Ga0207662_10011546 | Ga0207662_100115463 | 137 |
| 121 | 3300025918 | Ga0207662_10495354 | Ga0207662_104953542 | 137 |
| 122 | 3300025919 | Ga0207657_10001685 | Ga0207657_1000168511 | 137 |
| 123 | 3300025920 | Ga0207649_10012362 | Ga0207649_100123623 | 137 |
| 124 | 3300025921 | Ga0207652_10124176 | Ga0207652_101241762 | 137 |
| 125 | 3300025922 | Ga0207646_10000617 | Ga0207646_1000061721 | 137 |
| 126 | 3300025922 | Ga0207646_10173414 | Ga0207646_101734142 | 137 |
| 127 | 3300025923 | Ga0207681_10177009 | Ga0207681_101770092 | 137 |
| 128 | 3300025923 | Ga0207681_10938179 | Ga0207681_109381792 | 137 |
| 129 | 3300025925 | Ga0207650_10026780 | Ga0207650_100267801 | 137 |
| 130 | 3300025925 | Ga0207650_11235577 | Ga0207650_112355772 | 137 |
| 131 | 3300025931 | Ga0207644_10346390 | Ga0207644_103463902 | 137 |
| 132 | 3300025933 | Ga0207706_10000107 | Ga0207706_1000010772 | 137 |
| 133 | 3300025934 | Ga0207686_10002834 | Ga0207686_100028342 | 137 |
| 134 | 3300025935 | Ga0207709_10042410 | Ga0207709_100424103 | 137 |
| 135 | 3300025936 | Ga0207670_10024419 | Ga0207670_100244195 | 137 |
| 136 | 3300025936 | Ga0207670_10059705 | Ga0207670_100597052 | 137 |
| 137 | 3300025937 | Ga0207669_10151245 | Ga0207669_101512452 | 137 |
| 138 | 3300025937 | Ga0207669_10691429 | Ga0207669_106914292 | 137 |
| 139 | 3300025938 | Ga0207704_10141737 | Ga0207704_101417373 | 137 |
| 140 | 3300025938 | Ga0207704_10967719 | Ga0207704_109677192 | 137 |
| 141 | 3300025939 | Ga0207665_10016833 | Ga0207665_100168333 | 137 |
| 142 | 3300025940 | Ga0207691_10000472 | Ga0207691_100004722 | 137 |
| 143 | 3300025940 | Ga0207691_10121636 | Ga0207691_101216363 | 137 |
| 144 | 3300025940 | Ga0207691_10152515 | Ga0207691_101525152 | 137 |
| 145 | 3300025945 | Ga0207679_10004226 | Ga0207679_100042266 | 137 |
| 146 | 3300025945 | Ga0207679_10019984 | Ga0207679_100199843 | 137 |
| 147 | 3300025960 | Ga0207651_10055516 | Ga0207651_100555163 | 137 |
| 148 | 3300025960 | Ga0207651_10130757 | Ga0207651_101307572 | 137 |
| 149 | 3300025960 | Ga0207651_10226575 | Ga0207651_102265752 | 137 |
| 150 | 3300025972 | Ga0207668_10377526 | Ga0207668_103775262 | 137 |
| 151 | 3300026023 | Ga0207677_10664361 | Ga0207677_106643612 | 137 |
| 152 | 3300026067 | Ga0207678_10028464 | Ga0207678_100284641 | 137 |
| 153 | 3300026075 | Ga0207708_10006220 | Ga0207708_100062207 | 137 |
| 154 | 3300026088 | Ga0207641_10060311 | Ga0207641_100603114 | 137 |
| 155 | 3300026089 | Ga0207648_10000803 | Ga0207648_100008034 | 137 |
| 156 | 3300026116 | Ga0207674_10055223 | Ga0207674_100552232 | 137 |
| 157 | 3300026118 | Ga0207675_100038086 | Ga0207675_1000380866 | 137 |
| 158 | 3300026121 | Ga0207683_10000072 | Ga0207683_1000007256 | 137 |
| 159 | 3300026142 | Ga0207698_10251676 | Ga0207698_102516762 | 137 |
| 160 | 3300027252 | Ga0209973_1005227 | Ga0209973_10052272 | 137 |
| 161 | 3300027360 | Ga0209969_1000029 | Ga0209969_10000296 | 137 |
| 162 | 3300027378 | Ga0209981_1001270 | Ga0209981_10012703 | 137 |
| 163 | 3300027395 | Ga0209996_1000002 | Ga0209996_10000026 | 137 |
| 164 | 3300027424 | Ga0209984_1000034 | Ga0209984_10000346 | 137 |
| 165 | 3300027462 | Ga0210000_1017928 | Ga0210000_10179282 | 137 |
| 166 | 3300027526 | Ga0209968_1000216 | Ga0209968_10002167 | 137 |
| 167 | 3300027543 | Ga0209999_1000112 | Ga0209999_10001125 | 137 |
| 168 | 3300027552 | Ga0209982_1000894 | Ga0209982_10008943 | 137 |
| 169 | 3300027614 | Ga0209970_1000257 | Ga0209970_10002578 | 137 |
| 170 | 3300027617 | Ga0210002_1000315 | Ga0210002_10003156 | 137 |
| 171 | 3300027665 | Ga0209983_1000366 | Ga0209983_10003663 | 137 |
| 172 | 3300027695 | Ga0209966_1000389 | Ga0209966_10003892 | 137 |
| 173 | 3300027695 | Ga0209966_1011966 | Ga0209966_10119662 | 137 |
| 174 | 3300027717 | Ga0209998_10000081 | Ga0209998_1000008140 | 137 |
| 175 | 3300027876 | Ga0209974_10005167 | Ga0209974_100051672 | 137 |
| 176 | 3300027876 | Ga0209974_10180927 | Ga0209974_101809272 | 137 |
| 177 | 3300027907 | Ga0207428_10071451 | Ga0207428_100714513 | 137 |
| 178 | 3300028380 | Ga0268265_10133408 | Ga0268265_101334082 | 137 |
| 179 | 3300028381 | Ga0268264_10139964 | Ga0268264_101399642 | 137 |
| 180 | 3300031548 | Ga0307408_100305382 | Ga0307408_1003053822 | 137 |
| 181 | 3300031731 | Ga0307405_10001965 | Ga0307405_100019656 | 137 |
| 182 | 3300031824 | Ga0307413_11303225 | Ga0307413_113032251 | 137 |
| 183 | 3300031852 | Ga0307410_10030150 | Ga0307410_100301505 | 137 |
| 184 | 3300031901 | Ga0307406_10009125 | Ga0307406_100091254 | 137 |
| 185 | 3300031911 | Ga0307412_10007776 | Ga0307412_100077762 | 137 |
| 186 | 3300031995 | Ga0307409_100546297 | Ga0307409_1005462972 | 137 |
| 187 | 3300032005 | Ga0307411_10118727 | Ga0307411_101187273 | 137 |
| 188 | 3300032005 | Ga0307411_10969494 | Ga0307411_109694942 | 137 |
| 189 | 3300032126 | Ga0307415_100029580 | Ga0307415_1000295803 | 137 |
| 190 | 3300035084 | Ga0373928_0074465 | Ga0373928_0074465_297_725 | 137 |
| 191 | 3300035088 | Ga0373940_0103205 | Ga0373940_0103205_192_620 | 137 |
| 192 | 3300035088 | Ga0373940_0129536 | Ga0373940_0129536_82_510 | 137 |
| 193 | 3300035090 | Ga0373949_0161178 | Ga0373949_0161178_160_588 | 137 |
| 194 | 3300035091 | Ga0373951_0193406 | Ga0373951_0193406_20_448 | 137 |
| 195 | 3300035115 | Ga0373941_0007544 | Ga0373941_0007544_1234_1662 | 137 |
| 196 | 3300035121 | Ga0373960_0021091 | Ga0373960_0021091_325_753 | 137 |
| 197 | 3300035207 | Ga0373942_0273515 | Ga0373942_0273515_133_561 | 137 |
| 198 | 3300035242 | Ga0373962_0023498 | Ga0373962_0023498_342_770 | 137 |
| 199 | 3300035242 | Ga0373962_0175516 | Ga0373962_0175516_196_624 | 137 |
| 200 | 3300035242 | Ga0373962_0216711 | Ga0373962_0216711_82_510 | 137 |
| 201 | 3300035691 | Ga0373931_0109333 | Ga0373931_0109333_303_731 | 137 |
| 202 | 3300035691 | Ga0373931_0120018 | Ga0373931_0120018_825_1253 | 137 |
| 203 | 3300041405 | Ga0439438_018558 | Ga0439438_018558_25_447 | 137 |
| 204 | 3300041407 | Ga0439447_021522 | Ga0439447_021522_601_1023 | 137 |
| 205 | 3300041410 | Ga0439461_0007321 | Ga0439461_0007321_507_929 | 137 |
| 206 | 3300041411 | Ga0439466_0049164 | Ga0439466_0049164_457_879 | 137 |
| 207 | 3300041999 | Ga0439433_0005640 | Ga0439433_0005640_950_1372 | 137 |
| 208 | 3300042002 | Ga0439442_037937 | Ga0439442_037937_474_896 | 137 |
| 209 | 3300042006 | Ga0439432_025293 | Ga0439432_025293_1345_1767 | 137 |
| 210 | 3300042015 | Ga0439462_0177030 | Ga0439462_0177030_53_475 | 137 |
| 211 | 3300042116 | Ga0450912_007467 | Ga0450912_007467_413_835 | 137 |
| 212 | 3300042130 | Ga0450892_016033 | Ga0450892_016033_73_501 | 137 |
| 213 | 3300042156 | Ga0439446_0008550 | Ga0439446_0008550_134_556 | 137 |
| 214 | 3300042435 | Ga0439434_0013768 | Ga0439434_0013768_1474_1896 | 137 |
| 215 | 3300042439 | Ga0439464_0010548 | Ga0439464_0010548_54_476 | 137 |
| 216 | 3300042530 | Ga0450916_025640 | Ga0450916_025640_170_592 | 137 |
| 217 | 3300042876 | Ga0451577_0118724 | Ga0451577_0118724_192_614 | 137 |
| 218 | 3300042876 | Ga0451577_0138915 | Ga0451577_0138915_1702_2130 | 137 |
| 219 | 3300042876 | Ga0451577_0830348 | Ga0451577_0830348_161_583 | 137 |
| 220 | 3300044673 | Ga0453683_0060643 | Ga0453683_0060643_914_1345 | 137 |
| 221 | 3300044673 | Ga0453683_0903836 | Ga0453683_0903836_38_460 | 137 |
| 222 | 3300044712 | Ga0453684_1195052 | Ga0453684_1195052_288_710 | 137 |
| 223 | 3300044901 | Ga0466960_0485312 | Ga0466960_0485312_234_662 | 137 |
| 224 | 3300045051 | Ga0451576_0002499 | Ga0451576_0002499_10927_11355 | 137 |
| 225 | 3300045051 | Ga0451576_0375166 | Ga0451576_0375166_278_706 | 137 |
| 226 | 3300045051 | Ga0451576_0929090 | Ga0451576_0929090_174_602 | 137 |
| 227 | 3300046537 | Ga0495598_0252915 | Ga0495598_0252915_84_512 | 137 |
| 228 | 3300046684 | Ga0495669_0085061 | Ga0495669_0085061_839_1267 | 137 |
| 229 | 3300046794 | Ga0495589_0396145 | Ga0495589_0396145_68_496 | 137 |
| 230 | 3300049513 | Ga0501290_000136 | Ga0501290_000136_8016_8438 | 137 |
| 231 | 3300049514 | Ga0501291_002079 | Ga0501291_002079_466_888 | 137 |
| 232 | 3300049515 | Ga0501292_000356 | Ga0501292_000356_1390_1812 | 137 |
| 233 | 3300049516 | Ga0501293_000935 | Ga0501293_000935_1345_1767 | 137 |
| 234 | 3300049517 | Ga0501294_000067 | Ga0501294_000067_6959_7381 | 137 |
| 235 | 3300049518 | Ga0501295_000331 | Ga0501295_000331_344_766 | 137 |
| 236 | 3300049519 | Ga0501296_000129 | Ga0501296_000129_7844_8266 | 137 |
| 237 | 3300049520 | Ga0501297_001714 | Ga0501297_001714_1576_1998 | 137 |
| 238 | 3300049521 | Ga0501298_000246 | Ga0501298_000246_2832_3254 | 137 |
| 239 | 3300049522 | Ga0501299_000050 | Ga0501299_000050_3493_3915 | 137 |
| 240 | 3300049522 | Ga0501299_005769 | Ga0501299_005769_164_586 | 137 |
| 241 | 3300049522 | Ga0501299_009673 | Ga0501299_009673_190_612 | 137 |
| 242 | 3300049523 | Ga0501300_000541 | Ga0501300_000541_1445_1867 | 137 |
| 243 | 3300049526 | Ga0501303_001993 | Ga0501303_001993_118_540 | 137 |
| 244 | 3300049568 | Ga0501031_0027261 | Ga0501031_0027261_994_1422 | 137 |
| 245 | 3300049568 | Ga0501031_0844629 | Ga0501031_0844629_56_478 | 137 |
| 246 | 3300049572 | Ga0501036_0056473 | Ga0501036_0056473_1501_1929 | 137 |
| 247 | 3300049572 | Ga0501036_0118898 | Ga0501036_0118898_891_1313 | 137 |
| 248 | 3300049572 | Ga0501036_0408057 | Ga0501036_0408057_329_751 | 137 |
| 249 | 3300049573 | Ga0501037_0187875 | Ga0501037_0187875_698_1120 | 137 |
| 250 | 3300049574 | Ga0501038_0152092 | Ga0501038_0152092_49_471 | 137 |
| 251 | 3300049574 | Ga0501038_0615923 | Ga0501038_0615923_12_434 | 137 |
| 252 | 3300049575 | Ga0501039_0043210 | Ga0501039_0043210_2092_2520 | 137 |
| 253 | 3300049575 | Ga0501039_0122701 | Ga0501039_0122701_1171_1593 | 137 |
| 254 | 3300049575 | Ga0501039_0138767 | Ga0501039_0138767_102_524 | 137 |
| 255 | 3300049576 | Ga0501040_0061857 | Ga0501040_0061857_1370_1792 | 137 |
| 256 | 3300049576 | Ga0501040_0306389 | Ga0501040_0306389_131_553 | 137 |
| 257 | 3300049577 | Ga0501041_0039004 | Ga0501041_0039004_213_635 | 137 |
| 258 | 3300049577 | Ga0501041_0100827 | Ga0501041_0100827_1319_1747 | 137 |
| 259 | 3300049577 | Ga0501041_0104090 | Ga0501041_0104090_445_867 | 137 |
| 260 | 3300049578 | Ga0501042_0077484 | Ga0501042_0077484_736_1164 | 137 |
| 261 | 3300049578 | Ga0501042_0145088 | Ga0501042_0145088_133_555 | 137 |
| 262 | 3300049578 | Ga0501042_0208149 | Ga0501042_0208149_725_1147 | 137 |
| 263 | 3300049579 | Ga0501043_0104557 | Ga0501043_0104557_701_1123 | 137 |
| 264 | 3300049580 | Ga0501046_0059853 | Ga0501046_0059853_1641_2063 | 137 |
| 265 | 3300049582 | Ga0501048_0040005 | Ga0501048_0040005_990_1418 | 137 |
| 266 | 3300049582 | Ga0501048_0409975 | Ga0501048_0409975_260_682 | 137 |
| 267 | 3300049582 | Ga0501048_0649822 | Ga0501048_0649822_312_734 | 137 |
| 268 | 3300049584 | Ga0501068_0140246 | Ga0501068_0140246_218_676 | 137 |
| 269 | 3300049585 | Ga0501069_0425205 | Ga0501069_0425205_329_751 | 137 |
| 270 | 3300049585 | Ga0501069_0499194 | Ga0501069_0499194_86_508 | 137 |
| 271 | 3300049586 | Ga0501070_0205384 | Ga0501070_0205384_945_1367 | 137 |
| 272 | 3300049587 | Ga0501071_0033187 | Ga0501071_0033187_1687_2109 | 137 |
| 273 | 3300049587 | Ga0501071_0730353 | Ga0501071_0730353_307_735 | 137 |
| 274 | 3300049588 | Ga0501072_0054918 | Ga0501072_0054918_2048_2470 | 137 |
| 275 | 3300049590 | Ga0501074_0315383 | Ga0501074_0315383_641_1063 | 137 |
| 276 | 3300049591 | Ga0501075_0092330 | Ga0501075_0092330_1606_2028 | 137 |
| 277 | 3300049592 | Ga0501076_1133900 | Ga0501076_1133900_81_503 | 137 |
| 278 | 3300049593 | Ga0501077_0018857 | Ga0501077_0018857_175_597 | 137 |
| 279 | 3300049593 | Ga0501077_0104718 | Ga0501077_0104718_313_735 | 137 |
| 280 | 3300049650 | Ga0501199_000230 | Ga0501199_000230_937_1359 | 137 |
| 281 | 3300049651 | Ga0501201_000230 | Ga0501201_000230_1489_1911 | 137 |
| 282 | 3300049653 | Ga0501206_000661 | Ga0501206_000661_2783_3205 | 137 |
| 283 | 3300049654 | Ga0501207_000164 | Ga0501207_000164_2490_2912 | 137 |
| 284 | 3300049656 | Ga0501209_005202 | Ga0501209_005202_1572_1994 | 137 |
| 285 | 3300049658 | Ga0501211_003233 | Ga0501211_003233_941_1363 | 137 |
| 286 | 3300049660 | Ga0501216_000050 | Ga0501216_000050_6264_6686 | 137 |
| 287 | 3300049661 | Ga0501217_001564 | Ga0501217_001564_198_620 | 137 |
| 288 | 3300049663 | Ga0501223_068949 | Ga0501223_068949_213_635 | 137 |
| 289 | 3300049664 | Ga0501224_055200 | Ga0501224_055200_11_433 | 137 |
| 290 | 3300049668 | Ga0501233_000967 | Ga0501233_000967_204_626 | 137 |
| 291 | 3300049670 | Ga0501236_000352 | Ga0501236_000352_1788_2210 | 137 |
| 292 | 3300049672 | Ga0501239_000236 | Ga0501239_000236_327_749 | 137 |
| 293 | 3300049673 | Ga0501240_024239 | Ga0501240_024239_228_650 | 137 |
| 294 | 3300049675 | Ga0501243_005068 | Ga0501243_005068_1258_1680 | 137 |
| 295 | 3300049676 | Ga0501246_000845 | Ga0501246_000845_1390_1812 | 137 |
| 296 | 3300049677 | Ga0501247_001899 | Ga0501247_001899_654_1076 | 137 |
| 297 | 3300049678 | Ga0501248_000524 | Ga0501248_000524_668_1090 | 137 |
| 298 | 3300049679 | Ga0501249_003185 | Ga0501249_003185_2789_3211 | 137 |
| 299 | 3300049680 | Ga0501250_013185 | Ga0501250_013185_127_549 | 137 |
| 300 | 3300049681 | Ga0501251_008619 | Ga0501251_008619_516_938 | 137 |
| 301 | 3300049685 | Ga0501256_000342 | Ga0501256_000342_1482_1904 | 137 |
| 302 | 3300049686 | Ga0501257_000518 | Ga0501257_000518_7153_7575 | 137 |
| 303 | 3300049687 | Ga0501258_010304 | Ga0501258_010304_232_654 | 137 |
| 304 | 3300049688 | Ga0501259_004277 | Ga0501259_004277_1493_1915 | 137 |
| 305 | 3300049689 | Ga0501260_000359 | Ga0501260_000359_476_898 | 137 |
| 306 | 3300049690 | Ga0501261_012485 | Ga0501261_012485_181_603 | 137 |
| 307 | 3300049703 | Ga0501219_000835 | Ga0501219_000835_1427_1849 | 137 |
| 308 | 3300049704 | Ga0501221_000118 | Ga0501221_000118_8088_8510 | 137 |
| 309 | 3300049705 | Ga0501225_0000338 | Ga0501225_0000338_13285_13707 | 137 |
| 310 | 3300049706 | Ga0501229_001720 | Ga0501229_001720_584_1006 | 137 |
| 311 | 3300049707 | Ga0501234_000238 | Ga0501234_000238_7215_7637 | 137 |
| 312 | 3300049708 | Ga0501245_000100 | Ga0501245_000100_4516_4938 | 137 |
| 313 | 3300049741 | Ga0501079_0229743 | Ga0501079_0229743_274_696 | 137 |
| 314 | 3300049742 | Ga0501080_0060384 | Ga0501080_0060384_2477_2899 | 137 |
| 315 | 3300049743 | Ga0501081_0071558 | Ga0501081_0071558_1068_1490 | 137 |
| 316 | 3300049744 | Ga0501083_0230129 | Ga0501083_0230129_140_562 | 137 |
| 317 | 3300049761 | Ga0501264_000777 | Ga0501264_000777_1464_1886 | 137 |
| 318 | 3300049763 | Ga0501266_001451 | Ga0501266_001451_1591_2013 | 137 |
| 319 | 3300049768 | Ga0501271_000268 | Ga0501271_000268_34_456 | 137 |
| 320 | 3300049769 | Ga0501272_000423 | Ga0501272_000423_2832_3254 | 137 |
| 321 | 3300049770 | Ga0501273_003094 | Ga0501273_003094_330_752 | 137 |
| 322 | 3300049771 | Ga0501274_000032 | Ga0501274_000032_4092_4514 | 137 |
| 323 | 3300049772 | Ga0501275_000249 | Ga0501275_000249_787_1209 | 137 |
| 324 | 3300049774 | Ga0501278_000420 | Ga0501278_000420_1700_2122 | 137 |
| 325 | 3300049775 | Ga0501279_000080 | Ga0501279_000080_13276_13698 | 137 |
| 326 | 3300049777 | Ga0501281_00280 | Ga0501281_00280_1201_1623 | 137 |
| 327 | 3300049779 | Ga0501283_000077 | Ga0501283_000077_4007_4429 | 137 |
| 328 | 3300049822 | Ga0501035_0454505 | Ga0501035_0454505_431_853 | 137 |
| 329 | 3300049824 | Ga0501045_0113349 | Ga0501045_0113349_171_599 | 137 |
| 330 | 3300049824 | Ga0501045_0161389 | Ga0501045_0161389_264_686 | 137 |
| 331 | 3300049849 | Ga0501200_00361 | Ga0501200_00361_206_628 | 137 |
| 332 | 3300049851 | Ga0501212_005430 | Ga0501212_005430_181_603 | 137 |
| 333 | 3300049853 | Ga0501226_000423 | Ga0501226_000423_1326_1748 | 137 |
| 334 | 3300050507 | nmdc:mga05p37_3359_c1 | nmdc:mga05p37_3359_c1_1230_1652 | 137 |
| 335 | 3300050507 | nmdc:mga05p37_46715_c1 | nmdc:mga05p37_46715_c1_2034_2462 | 137 |
| 336 | 3300050508 | nmdc:mga09592_95083_c1 | nmdc:mga09592_95083_c1_1911_2339 | 137 |
| 337 | 3300050510 | nmdc:mga06r32_64695_c1 | nmdc:mga06r32_64695_c1_1077_1505 | 137 |
| 338 | 3300050511 | nmdc:mga08y16_47742_c1 | nmdc:mga08y16_47742_c1_2923_3351 | 137 |
| 339 | 3300050512 | nmdc:mga0n895_1682890_c1 | nmdc:mga0n895_1682890_c1_109_531 | 137 |
| 340 | 3300050512 | nmdc:mga0n895_1709643_c1 | nmdc:mga0n895_1709643_c1_15_443 | 137 |
| 341 | 3300050512 | nmdc:mga0n895_244904_c1 | nmdc:mga0n895_244904_c1_1344_1772 | 137 |
| 342 | 3300050513 | nmdc:mga0rr50_209333_c1 | nmdc:mga0rr50_209333_c1_969_1397 | 137 |
| 343 | 3300050515 | nmdc:mga0a205_1390490_c1 | nmdc:mga0a205_1390490_c1_52_480 | 137 |
| 344 | 3300050515 | nmdc:mga0a205_155460_c1 | nmdc:mga0a205_155460_c1_996_1424 | 137 |
| 345 | 3300054114 | Ga0501084_0146715 | Ga0501084_0146715_920_1342 | 137 |
| 346 | 3300054114 | Ga0501084_0513544 | Ga0501084_0513544_140_562 | 137 |
| 347 | 3300059424 | Ga0590075_004839 | Ga0590075_004839_1972_2394 | 137 |
| 348 | 3300060353 | Ga0501082_0177431 | Ga0501082_0177431_138_560 | 137 |
| 349 | 3300060353 | Ga0501082_0265458 | Ga0501082_0265458_561_983 | 137 |
| 350 | 3300060353 | Ga0501082_0581142 | Ga0501082_0581142_510_938 | 137 |
| 351 | 3300061734 | Ga0530510_0154873 | Ga0530510_0154873_488_910 | 137 |
| 352 | 3300005330 | Ga0070690_100423938 | Ga0070690_1004239382 | 138 |
| 353 | 3300005347 | Ga0070668_100173682 | Ga0070668_1001736823 | 138 |
| 354 | 3300005983 | Ga0081540_1067443 | Ga0081540_10674433 | 138 |
| 355 | 3300013306 | Ga0163162_10439003 | Ga0163162_104390033 | 138 |
| 356 | 3300031247 | Ga0265340_10058388 | Ga0265340_100583881 | 138 |
| 357 | 3300031548 | Ga0307408_100017910 | Ga0307408_1000179102 | 138 |
| 358 | 3300031595 | Ga0265313_10093278 | Ga0265313_100932782 | 138 |
| 359 | 3300032004 | Ga0307414_10000006 | Ga0307414_10000006272 | 138 |
| 360 | 3300041413 | Ga0439465_0214535 | Ga0439465_0214535_38_550 | 138 |
| 361 | 3300042876 | Ga0451577_0000084 | Ga0451577_0000084_17001_17420 | 138 |
| 362 | 3300044712 | Ga0453684_0003652 | Ga0453684_0003652_20323_20742 | 138 |
| 363 | 3300045051 | Ga0451576_1000848 | Ga0451576_1000848_190_609 | 138 |
| 364 | 3300001977 | JGI24746J21847_1002805 | JGI24746J21847_10028051 | 139 |
| 365 | 3300003320 | rootH2_10016736 | rootH2_1001673613 | 139 |
| 366 | 3300005327 | Ga0070658_10098411 | Ga0070658_100984112 | 139 |
| 367 | 3300005328 | Ga0070676_10072158 | Ga0070676_100721582 | 139 |
| 368 | 3300005344 | Ga0070661_100002950 | Ga0070661_1000029504 | 139 |
| 369 | 3300005439 | Ga0070711_100002612 | Ga0070711_1000026122 | 139 |
| 370 | 3300005444 | Ga0070694_100016436 | Ga0070694_1000164363 | 139 |
| 371 | 3300005459 | Ga0068867_100000121 | Ga0068867_10000012130 | 139 |
| 372 | 3300005539 | Ga0068853_100340528 | Ga0068853_1003405282 | 139 |
| 373 | 3300005564 | Ga0070664_100010286 | Ga0070664_1000102863 | 139 |
| 374 | 3300005840 | Ga0068870_10533697 | Ga0068870_105336971 | 139 |
| 375 | 3300006173 | Ga0070716_100194336 | Ga0070716_1001943362 | 139 |
| 376 | 3300006178 | Ga0075367_11020827 | Ga0075367_110208271 | 139 |
| 377 | 3300006353 | Ga0075370_10642850 | Ga0075370_106428502 | 139 |
| 378 | 3300006358 | Ga0068871_100216511 | Ga0068871_1002165112 | 139 |
| 379 | 3300006871 | Ga0075434_100818288 | Ga0075434_1008182881 | 139 |
| 380 | 3300006881 | Ga0068865_100661987 | Ga0068865_1006619872 | 139 |
| 381 | 3300006914 | Ga0075436_100220337 | Ga0075436_1002203372 | 139 |
| 382 | 3300009098 | Ga0105245_10162270 | Ga0105245_101622702 | 139 |
| 383 | 3300009148 | Ga0105243_10000065 | Ga0105243_10000065106 | 139 |
| 384 | 3300009545 | Ga0105237_10469216 | Ga0105237_104692161 | 139 |
| 385 | 3300010375 | Ga0105239_11615567 | Ga0105239_116155672 | 139 |
| 386 | 3300013100 | Ga0157373_10000494 | Ga0157373_1000049426 | 139 |
| 387 | 3300013296 | Ga0157374_10004213 | Ga0157374_1000421311 | 139 |
| 388 | 3300014969 | Ga0157376_10005050 | Ga0157376_1000505010 | 139 |
| 389 | 3300014969 | Ga0157376_10016319 | Ga0157376_100163193 | 139 |
| 390 | 3300025907 | Ga0207645_10126286 | Ga0207645_101262862 | 139 |
| 391 | 3300025909 | Ga0207705_10077254 | Ga0207705_100772543 | 139 |
| 392 | 3300025916 | Ga0207663_10006748 | Ga0207663_100067483 | 139 |
| 393 | 3300025920 | Ga0207649_10003846 | Ga0207649_100038467 | 139 |
| 394 | 3300025920 | Ga0207649_10388405 | Ga0207649_103884051 | 139 |
| 395 | 3300025927 | Ga0207687_10497245 | Ga0207687_104972452 | 139 |
| 396 | 3300025935 | Ga0207709_10000866 | Ga0207709_100008666 | 139 |
| 397 | 3300025935 | Ga0207709_10004034 | Ga0207709_100040348 | 139 |
| 398 | 3300025938 | Ga0207704_10914484 | Ga0207704_109144841 | 139 |
| 399 | 3300025939 | Ga0207665_10045547 | Ga0207665_100455472 | 139 |
| 400 | 3300025945 | Ga0207679_10022196 | Ga0207679_100221963 | 139 |
| 401 | 3300026089 | Ga0207648_10001393 | Ga0207648_1000139315 | 139 |
| 402 | 3300031250 | Ga0265331_10021410 | Ga0265331_100214103 | 139 |
| 403 | 3300031251 | Ga0265327_10007650 | Ga0265327_100076508 | 139 |
| 404 | 3300031548 | Ga0307408_100000052 | Ga0307408_10000005292 | 139 |
| 405 | 3300031548 | Ga0307408_100069862 | Ga0307408_1000698621 | 139 |
| 406 | 3300031665 | Ga0316575_10013757 | Ga0316575_100137574 | 139 |
| 407 | 3300031665 | Ga0316575_10116222 | Ga0316575_101162221 | 139 |
| 408 | 3300031691 | Ga0316579_10000607 | Ga0316579_100006075 | 139 |
| 409 | 3300031691 | Ga0316579_10012654 | Ga0316579_100126542 | 139 |
| 410 | 3300031691 | Ga0316579_10025046 | Ga0316579_100250462 | 139 |
| 411 | 3300031727 | Ga0316576_10032308 | Ga0316576_100323084 | 139 |
| 412 | 3300031727 | Ga0316576_10233265 | Ga0316576_102332652 | 139 |
| 413 | 3300031728 | Ga0316578_10001630 | Ga0316578_100016305 | 139 |
| 414 | 3300031728 | Ga0316578_10020902 | Ga0316578_100209022 | 139 |
| 415 | 3300031728 | Ga0316578_10177043 | Ga0316578_101770432 | 139 |
| 416 | 3300031728 | Ga0316578_10279281 | Ga0316578_102792812 | 139 |
| 417 | 3300031728 | Ga0316578_10533113 | Ga0316578_105331132 | 139 |
| 418 | 3300031733 | Ga0316577_10003201 | Ga0316577_100032015 | 139 |
| 419 | 3300031733 | Ga0316577_10007239 | Ga0316577_100072395 | 139 |
| 420 | 3300031733 | Ga0316577_10178194 | Ga0316577_101781942 | 139 |
| 421 | 3300031733 | Ga0316577_10471804 | Ga0316577_104718042 | 139 |
| 422 | 3300031824 | Ga0307413_10225152 | Ga0307413_102251521 | 139 |
| 423 | 3300031852 | Ga0307410_10182622 | Ga0307410_101826222 | 139 |
| 424 | 3300031852 | Ga0307410_10404233 | Ga0307410_104042332 | 139 |
| 425 | 3300031901 | Ga0307406_10000998 | Ga0307406_100009985 | 139 |
| 426 | 3300031903 | Ga0307407_10000138 | Ga0307407_1000013815 | 139 |
| 427 | 3300031903 | Ga0307407_10136463 | Ga0307407_101364632 | 139 |
| 428 | 3300031911 | Ga0307412_10000070 | Ga0307412_1000007087 | 139 |
| 429 | 3300031911 | Ga0307412_10800684 | Ga0307412_108006841 | 139 |
| 430 | 3300031995 | Ga0307409_100945538 | Ga0307409_1009455382 | 139 |
| 431 | 3300032002 | Ga0307416_100003448 | Ga0307416_1000034484 | 139 |
| 432 | 3300032004 | Ga0307414_10294232 | Ga0307414_102942322 | 139 |
| 433 | 3300032005 | Ga0307411_10089624 | Ga0307411_100896241 | 139 |
| 434 | 3300032133 | Ga0316583_10016759 | Ga0316583_100167592 | 139 |
| 435 | 3300032133 | Ga0316583_10017341 | Ga0316583_100173412 | 139 |
| 436 | 3300032137 | Ga0316585_10001825 | Ga0316585_100018254 | 139 |
| 437 | 3300032137 | Ga0316585_10091235 | Ga0316585_100912352 | 139 |
| 438 | 3300032139 | Ga0316580_10004252 | Ga0316580_100042522 | 139 |
| 439 | 3300032139 | Ga0316580_10006293 | Ga0316580_100062933 | 139 |
| 440 | 3300032139 | Ga0316580_10010246 | Ga0316580_100102463 | 139 |
| 441 | 3300032139 | Ga0316580_10033977 | Ga0316580_100339772 | 139 |
| 442 | 3300035398 | Ga0316574_0001379 | Ga0316574_0001379_1606_2031 | 139 |
| 443 | 3300035398 | Ga0316574_0013033 | Ga0316574_0013033_2481_2921 | 139 |
| 444 | 3300035398 | Ga0316574_0022006 | Ga0316574_0022006_1155_1637 | 139 |
| 445 | 3300035398 | Ga0316574_0268067 | Ga0316574_0268067_37_462 | 139 |
| 446 | 3300035398 | Ga0316574_1006386 | Ga0316574_1006386_31_465 | 139 |
| 447 | 3300036647 | Ga0316582_0003471 | Ga0316582_0003471_1873_2298 | 139 |
| 448 | 3300036647 | Ga0316582_0008269 | Ga0316582_0008269_2418_2843 | 139 |
| 449 | 3300036647 | Ga0316582_0020030 | Ga0316582_0020030_3262_3744 | 139 |
| 450 | 3300036712 | Ga0316584_0013881 | Ga0316584_0013881_1524_1949 | 139 |
| 451 | 3300036712 | Ga0316584_0033065 | Ga0316584_0033065_2367_2849 | 139 |
| 452 | 3300036712 | Ga0316584_0605434 | Ga0316584_0605434_90_515 | 139 |
| 453 | 3300037588 | Ga0316581_0000045 | Ga0316581_0000045_4799_5224 | 139 |
| 454 | 3300038725 | Ga0400484_07464 | Ga0400484_07464_2490_2921 | 139 |
| 455 | 3300041408 | Ga0439453_0000612 | Ga0439453_0000612_3371_3790 | 139 |
| 456 | 3300042118 | Ga0450914_034123 | Ga0450914_034123_117_536 | 139 |
| 457 | 3300042127 | Ga0450890_000066 | Ga0450890_000066_4250_4669 | 139 |
| 458 | 3300042129 | Ga0450891_007169 | Ga0450891_007169_11_430 | 139 |
| 459 | 3300042130 | Ga0450892_000055 | Ga0450892_000055_4586_5005 | 139 |
| 460 | 3300042532 | Ga0450893_0000433 | Ga0450893_0000433_4991_5410 | 139 |
| 461 | 3300042532 | Ga0450893_0001841 | Ga0450893_0001841_1338_1757 | 139 |
| 462 | 3300042532 | Ga0450893_0049512 | Ga0450893_0049512_28_447 | 139 |
| 463 | 3300042876 | Ga0451577_0002686 | Ga0451577_0002686_3801_4220 | 139 |
| 464 | 3300044712 | Ga0453684_0143703 | Ga0453684_0143703_2384_2806 | 139 |
| 465 | 3300045051 | Ga0451576_0019023 | Ga0451576_0019023_6438_6860 | 139 |
| 466 | 3300048924 | Ga0496121_0029001 | Ga0496121_0029001_2630_3049 | 139 |
| 467 | 3300049569 | Ga0501032_0000245 | Ga0501032_0000245_14415_14837 | 139 |
| 468 | 3300049569 | Ga0501032_0008380 | Ga0501032_0008380_5461_5880 | 139 |
| 469 | 3300049570 | Ga0501033_0000002 | Ga0501033_0000002_50967_51389 | 139 |
| 470 | 3300049575 | Ga0501039_0163877 | Ga0501039_0163877_640_1065 | 139 |
| 471 | 3300049665 | Ga0501227_000800 | Ga0501227_000800_4887_5306 | 139 |
| 472 | 3300053136 | Ga0500559_0001204 | Ga0500559_0001204_2186_2611 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ve0-assembly1.cif.gz_A | crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii | 0.9401 | 1 | 139 |
| 2p6h-assembly1.cif.gz_A | crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 | 0.9378 | 4 | 139 |
| 1ve0-assembly1.cif.gz_A | crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii | 0.9335 | 1 | 139 |
| 2cu5-assembly1.cif.gz_C | crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 | 0.9311 | 6 | 137 |
| 2p6h-assembly1.cif.gz_A | crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 | 0.9244 | 4 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p6hB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9373 | 4 | 139 | 2.60.120.460 |
| af_P9WFP9_1_132_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9364 | 4 | 138 | 2.60.120.460 |
| 1ve0A00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9345 | 3 | 139 | 2.60.120.460 |
| 2cu5A00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9339 | 5 | 137 | 2.60.120.460 |
| 2p6hB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9241 | 4 | 139 | 2.60.120.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5S9A0-F1-model_v4 | YjbQ family protein | 0.9847 | 1 | 139 |
|
| AF-A0A2A2Q1B5-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9845 | 2 | 139 |
|
| AF-A0A2E7SVX0-F1-model_v4 | YjbQ family protein | 0.9838 | 3 | 139 |
|
| AF-A0A523PPF0-F1-model_v4 | YjbQ family protein | 0.9825 | 1 | 139 |
|
| AF-A0A261SQ41-F1-model_v4 | Secondary thiamine-phosphate synthase | 0.9823 | 2 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar