F450850

General Info

Members Datasets Scaffolds Average Seq Length
472 295 944 159

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0303346|Ga0436364_0303346_1051_1641
Length 196
Sequence VTPSRRRHGNEPEPLVETAGRRRYLFGAAAEGRMSERHEGGGIDWKTHGIKVIPGSQLDPNTAQTPGMDRAAAINFARAGAKKLWAGTVKIHANAKTGAHHHGELESVIYVVKGRARMRWGDRLEFVAEAGPGDFIFVPPYVPHQEINASTSETLECVLVRSDNEAVVVNLDIEPVEKPEKVLWVDPIHKAPPGGG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
116 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
117 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
277 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
280 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
287 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
288 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
289 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
290 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
291 2643221672 Variovorax sp. Root434 Isolate Unclassified
292 2738541293 Rhizobium sp. GV031 Isolate Unclassified
293 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
294 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
295 8005258706 Rhizobium sp. R693 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.4
Metatranscriptomes 1.27
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.58
Nodule 0.85
Rhizoplane 3.81
Rhizosphere 69.92
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0303346 3300037853 Bacteria 1653
2 JGI24743J22301_10031262 3300001991 Bacteria 1048
3 JGI24744J21845_10000106 3300002077 Bacteria 11254
4 JGI24742J22300_10001800 3300002244 Bacteria 3415
5 JGI25152J39213_1002889 3300002773 Bacteria 6135
6 JGI25152J39213_1003142 3300002773 Bacteria 5767
7 JGI25152J39213_1005233 3300002773 Bacteria 3856
8 JGI25159J45721_1002828 3300002987 Bacteria 6384
9 JGI25151J46595_10006059 3300003187 Bacteria 6153
10 JGI25151J46595_10008801 3300003187 Bacteria 4824
11 JGI25151J46595_10020606 3300003187 Bacteria 2777
12 JGI25151J46595_10032391 3300003187 Bacteria 2026
13 JGI25151J46595_10051180 3300003187 Bacteria 1400
14 JGI25406J46586_10022065 3300003203 Bacteria 2546
15 JGI25153J46596_10001179 3300003215 Bacteria 15805
16 JGI25153J46596_10005841 3300003215 Bacteria 6384
17 JGI25153J46596_10006733 3300003215 Bacteria 5767
18 JGI25160J50197_1001479 3300003354 Bacteria 11690
19 Ga0055535_1000221 3300003761 Bacteria 60185
20 Ga0055542_1000129 3300003762 Bacteria 99542
21 Ga0055526_1012634 3300003771 Bacteria 3661
22 Ga0055526_1016577 3300003771 Bacteria 2871
23 Ga0055524_1019687 3300003775 Bacteria 2298
24 Ga0055524_1033825 3300003775 Bacteria 1424
25 Ga0055536_1009252 3300003781 Bacteria 4102
26 Ga0055534_1002468 3300003784 Bacteria 6384
27 Ga0055528_1000525 3300003790 Bacteria 29704
28 Ga0055528_1035134 3300003790 Bacteria 1222
29 Ga0055530_10010358 3300003791 Bacteria 3455
30 Ga0055540_1003024 3300003792 Bacteria 8408
31 Ga0055540_1032178 3300003792 Bacteria 1199
32 Ga0055531_10002327 3300003794 Bacteria 12826
33 Ga0055543_1000419 3300004625 Bacteria 26802
34 Ga0055543_1002078 3300004625 Bacteria 6980
35 Ga0065165_1005994 3300005262 Bacteria 6557
36 Ga0065165_1037555 3300005262 Bacteria 1467
37 Ga0070676_10016236 3300005328 Bacteria 4115
38 Ga0070676_10852173 3300005328 Bacteria 676
39 Ga0070690_100140717 3300005330 Bacteria 1638
40 Ga0068869_100026218 3300005334 Bacteria 4055
41 Ga0070666_10021790 3300005335 Bacteria 4154
42 Ga0070680_100303696 3300005336 Bacteria 1353
43 Ga0070682_100193582 3300005337 Bacteria 1429
44 Ga0068868_100000621 3300005338 Bacteria 23844
45 Ga0068868_100099927 3300005338 Bacteria 2347
46 Ga0070689_100112712 3300005340 Bacteria 2165
47 Ga0070691_10051356 3300005341 Bacteria 1968
48 Ga0070687_100069208 3300005343 Bacteria 1889
49 Ga0070668_100003154 3300005347 Bacteria 12154
50 Ga0070669_100039005 3300005353 Bacteria 3450
51 Ga0070669_100122889 3300005353 Bacteria 1983
52 Ga0070669_101213452 3300005353 Bacteria 652
53 Ga0070671_100045764 3300005355 Bacteria 3638
54 Ga0070671_101364893 3300005355 Bacteria 626
55 Ga0070674_100001308 3300005356 Bacteria 13100
56 Ga0070673_100225728 3300005364 Bacteria 1623
57 Ga0070688_100009317 3300005365 Bacteria 5365
58 Ga0070659_100030107 3300005366 Bacteria 4200
59 Ga0070659_100805889 3300005366 Bacteria 817
60 Ga0070659_100854394 3300005366 Bacteria 793
61 Ga0070667_100004899 3300005367 Bacteria 11213
62 Ga0070709_10045906 3300005434 Bacteria 2714
63 Ga0070709_10741276 3300005434 Bacteria 767
64 Ga0070714_100050717 3300005435 Bacteria 3536
65 Ga0070714_101474673 3300005435 Bacteria 664
66 Ga0070713_100025838 3300005436 Bacteria 4599
67 Ga0070713_100342544 3300005436 Bacteria 1385
68 Ga0070710_10042698 3300005437 Bacteria 2508
69 Ga0070710_10276654 3300005437 Bacteria 1088
70 Ga0070701_10002927 3300005438 Bacteria 6664
71 Ga0070711_100026759 3300005439 Bacteria 3782
72 Ga0070711_100630739 3300005439 Bacteria 897
73 Ga0070705_100004772 3300005440 Bacteria 6599
74 Ga0070694_100008875 3300005444 Bacteria 6159
75 Ga0070663_100018458 3300005455 Bacteria 4575
76 Ga0070662_100012376 3300005457 Bacteria 5657
77 Ga0070681_10004462 3300005458 Bacteria 13334
78 Ga0070681_10285733 3300005458 Bacteria 1560
79 Ga0068867_100002277 3300005459 Bacteria 13498
80 Ga0070706_100166726 3300005467 Bacteria 2057
81 Ga0070706_100312221 3300005467 Bacteria 1467
82 Ga0070706_101102983 3300005467 Bacteria 730
83 Ga0070707_101924716 3300005468 Bacteria 559
84 Ga0070698_100007614 3300005471 Bacteria 11720
85 Ga0070698_100080964 3300005471 Bacteria 3242
86 Ga0070699_100024380 3300005518 Bacteria 5212
87 Ga0070699_100307097 3300005518 Bacteria 1424
88 Ga0070679_100121456 3300005530 Bacteria 2597
89 Ga0070679_100935262 3300005530 Bacteria 810
90 Ga0070684_100550068 3300005535 Bacteria 1071
91 Ga0070697_100096553 3300005536 Bacteria 2452
92 Ga0068853_100014607 3300005539 Bacteria 6439
93 Ga0068853_100519904 3300005539 Bacteria 1125
94 Ga0070686_101400742 3300005544 Bacteria 587
95 Ga0070695_100044157 3300005545 Bacteria 2835
96 Ga0070695_100982275 3300005545 Bacteria 686
97 Ga0070696_100001491 3300005546 Bacteria 15341
98 Ga0070696_100327661 3300005546 Bacteria 1180
99 Ga0070693_100097438 3300005547 Bacteria 1785
100 Ga0070665_100010877 3300005548 Bacteria 9204
101 Ga0070665_100595357 3300005548 Bacteria 1119
102 Ga0070704_100003045 3300005549 Bacteria 9540
103 Ga0068855_100019150 3300005563 Bacteria 8226
104 Ga0068855_100078481 3300005563 Bacteria 3830
105 Ga0068855_100148327 3300005563 Bacteria 2669
106 Ga0068855_100364678 3300005563 Bacteria 1589
107 Ga0068857_100202631 3300005577 Bacteria 1809
108 Ga0068854_100001213 3300005578 Bacteria 15465
109 Ga0068856_100260832 3300005614 Bacteria 1748
110 Ga0068856_101903863 3300005614 Bacteria 606
111 Ga0070702_100312898 3300005615 Bacteria 1091
112 Ga0068852_100105818 3300005616 Bacteria 2549
113 Ga0068859_100259295 3300005617 Bacteria 1829
114 Ga0068866_10001491 3300005718 Bacteria 9966
115 Ga0068861_100002962 3300005719 Bacteria 11204
116 Ga0068861_100502221 3300005719 Bacteria 1097
117 Ga0068858_100008104 3300005842 Bacteria 10109
118 Ga0068860_100003769 3300005843 Bacteria 15595
119 Ga0068862_100001439 3300005844 Bacteria 21985
120 Ga0068862_100395676 3300005844 Bacteria 1291
121 Ga0081455_10000751 3300005937 Bacteria 42140
122 Ga0081455_10006286 3300005937 Bacteria 12771
123 Ga0081455_10008690 3300005937 Bacteria 10520
124 Ga0081540_1022748 3300005983 Bacteria 3694
125 Ga0081539_10001500 3300005985 Bacteria 39463
126 Ga0070717_10149800 3300006028 Bacteria 2018
127 Ga0070717_10273474 3300006028 Bacteria 1496
128 Ga0075365_10004011 3300006038 Bacteria 7718
129 Ga0075365_10065613 3300006038 Bacteria 2433
130 Ga0075365_10558870 3300006038 Bacteria 809
131 Ga0075363_100433563 3300006048 Bacteria 775
132 Ga0075364_10203731 3300006051 Bacteria 1341
133 Ga0070715_10001393 3300006163 Bacteria 6993
134 Ga0070715_10004658 3300006163 Bacteria 4524
135 Ga0070715_10676273 3300006163 Bacteria 614
136 Ga0070716_100033325 3300006173 Bacteria 2816
137 Ga0070716_100036738 3300006173 Bacteria 2702
138 Ga0070712_100002730 3300006175 Bacteria 10895
139 Ga0070712_100936470 3300006175 Bacteria 748
140 Ga0075362_10005802 3300006177 Bacteria 4551
141 Ga0075362_10044960 3300006177 Bacteria 1960
142 Ga0075362_10090109 3300006177 Bacteria 1423
143 Ga0075362_10161940 3300006177 Bacteria 1078
144 Ga0075367_10007892 3300006178 Bacteria 5481
145 Ga0075367_10180108 3300006178 Bacteria 1317
146 Ga0075369_10005479 3300006186 Bacteria 4746
147 Ga0075369_10005586 3300006186 Bacteria 4709
148 Ga0075366_10140990 3300006195 Bacteria 1457
149 Ga0097621_100497298 3300006237 Bacteria 1104
150 Ga0075370_10002650 3300006353 Bacteria 8360
151 Ga0075370_10036478 3300006353 Bacteria 2761
152 Ga0075370_10209723 3300006353 Bacteria 1150
153 Ga0068871_100324689 3300006358 Bacteria 1356
154 Ga0068871_101002871 3300006358 Bacteria 778
155 Ga0075430_100035410 3300006846 Bacteria 4235
156 Ga0075430_100537402 3300006846 Bacteria 964
157 Ga0075431_100011129 3300006847 Bacteria 9057
158 Ga0075433_11247139 3300006852 Bacteria 645
159 Ga0075434_100142883 3300006871 Bacteria 2413
160 Ga0075434_100253332 3300006871 Bacteria 1779
161 Ga0075434_101539908 3300006871 Bacteria 674
162 Ga0068865_100005355 3300006881 Bacteria 7773
163 Ga0097620_100259290 3300006931 Bacteria 1829
164 Ga0075435_100113138 3300007076 Bacteria 2258
165 Ga0075435_100545254 3300007076 Bacteria 1004
166 Ga0099794_10311258 3300007265 Bacteria 816
167 Ga0099794_10335516 3300007265 Bacteria 785
168 Ga0099795_10090979 3300007788 Bacteria 1183
169 Ga0105244_10087110 3300009036 Bacteria 1539
170 Ga0105240_10009535 3300009093 Bacteria 13746
171 Ga0105240_10069622 3300009093 Bacteria 4354
172 Ga0105240_10088929 3300009093 Bacteria 3778
173 Ga0105240_10148562 3300009093 Bacteria 2793
174 Ga0105240_10346484 3300009093 Bacteria 1686
175 Ga0105240_10716529 3300009093 Bacteria 1091
176 Ga0105245_10005075 3300009098 Bacteria 11573
177 Ga0105247_10010247 3300009101 Bacteria 5673
178 Ga0114129_10039882 3300009147 Bacteria 6624
179 Ga0114129_10100186 3300009147 Bacteria 4009
180 Ga0105243_10002770 3300009148 Bacteria 14577
181 Ga0105241_10228726 3300009174 Bacteria 1567
182 Ga0105241_10339091 3300009174 Bacteria 1302
183 Ga0105237_10048401 3300009545 Bacteria 4273
184 Ga0105237_10111424 3300009545 Bacteria 2729
185 Ga0105237_11020416 3300009545 Bacteria 834
186 Ga0105238_10001577 3300009551 Bacteria 22832
187 Ga0105238_10194028 3300009551 Bacteria 2007
188 Ga0105238_10236546 3300009551 Bacteria 1804
189 Ga0105238_10272260 3300009551 Bacteria 1674
190 Ga0105238_10392791 3300009551 Bacteria 1379
191 Ga0105238_10395476 3300009551 Bacteria 1375
192 Ga0105238_11091213 3300009551 Bacteria 821
193 Ga0105249_10005355 3300009553 Bacteria 11070
194 Ga0123341_1000011 3300009765 Bacteria 108023
195 Ga0123342_1014751 3300009766 Bacteria 7351
196 Ga0105028_106552 3300009993 Bacteria 1217
197 Ga0099796_10112485 3300010159 Bacteria 1038
198 Ga0105239_10025294 3300010375 Bacteria 6537
199 Ga0105246_10062869 3300011119 Bacteria 2587
200 Ga0157371_10048625 3300013102 Bacteria 3015
201 Ga0157371_11498725 3300013102 Bacteria 526
202 Ga0157370_10158381 3300013104 Bacteria 2107
203 Ga0157369_10054328 3300013105 Unclassified 4326
204 Ga0157369_10416856 3300013105 Bacteria 1392
205 Ga0157378_10010147 3300013297 Bacteria 8214
206 Ga0157378_11447437 3300013297 Bacteria 731
207 Ga0163162_10013011 3300013306 Bacteria 8120
208 Ga0157372_10030901 3300013307 Bacteria 5861
209 Ga0157372_10113002 3300013307 Bacteria 3112
210 Ga0157372_10349830 3300013307 Bacteria 1722
211 Ga0157380_10002053 3300014326 Bacteria 13479
212 Ga0157376_10238731 3300014969 Bacteria 1692
213 Ga0157376_10243421 3300014969 Bacteria 1676
214 Ga0182006_1008452 3300015261 Bacteria 4663
215 Ga0182007_10000951 3300015262 Bacteria 15906
216 Ga0206356_10469543 3300020070 Bacteria 991
217 Ga0206352_10230278 3300020078 Bacteria 595
218 Ga0213876_10060623 3300021384 Bacteria 1996
219 Ga0213875_10000127 3300021388 Bacteria 84034
220 Ga0213875_10002313 3300021388 Bacteria 11530
221 Ga0213875_10085345 3300021388 Bacteria 1473
222 Ga0213871_10074701 3300021441 Bacteria 963
223 Ga0224712_10487108 3300022467 Bacteria 595
224 Ga0228598_1051516 3300024227 Bacteria 817
225 Ga0209672_102876 3300025228 Bacteria 3868
226 Ga0209258_100240 3300025242 Bacteria 100990
227 Ga0207425_1001365 3300025245 Bacteria 10355
228 Ga0209148_1000033 3300025254 Bacteria 555508
229 Ga0209129_1000082 3300025258 Bacteria 183436
230 Ga0209129_1000300 3300025258 Bacteria 46275
231 Ga0209673_1000478 3300025273 Bacteria 66832
232 Ga0209673_1005739 3300025273 Bacteria 6182
233 Ga0209673_1018770 3300025273 Bacteria 2504
234 Ga0209676_1013256 3300025292 Bacteria 3181
235 Ga0209025_1000974 3300025294 Bacteria 42899
236 Ga0209025_1003754 3300025294 Bacteria 13922
237 Ga0209025_1009995 3300025294 Bacteria 6502
238 Ga0209564_1000215 3300025295 Bacteria 132838
239 Ga0209564_1024494 3300025295 Bacteria 2060
240 Ga0209564_1062803 3300025295 Bacteria 820
241 Ga0209758_1000390 3300025297 Bacteria 75869
242 Ga0209758_1000766 3300025297 Bacteria 46275
243 Ga0209758_1016608 3300025297 Bacteria 3728
244 Ga0209256_1000155 3300025299 Bacteria 144379
245 Ga0209256_1008655 3300025299 Bacteria 4659
246 Ga0207426_1000386 3300025302 Bacteria 75890
247 Ga0209051_1009625 3300025303 Bacteria 4961
248 Ga0209051_1015254 3300025303 Bacteria 3544
249 Ga0209051_1067772 3300025303 Bacteria 1089
250 Ga0207656_10001162 3300025321 Bacteria 8647
251 Ga0207692_10050217 3300025898 Bacteria 2108
252 Ga0207647_10047497 3300025904 Bacteria 2670
253 Ga0207685_10039896 3300025905 Bacteria 1746
254 Ga0207699_10067558 3300025906 Bacteria 2173
255 Ga0207699_10550070 3300025906 Bacteria 837
256 Ga0207645_10647705 3300025907 Bacteria 718
257 Ga0207705_10009513 3300025909 Bacteria 7072
258 Ga0207684_10202807 3300025910 Bacteria 1711
259 Ga0207684_10559592 3300025910 Bacteria 978
260 Ga0207684_11491740 3300025910 Bacteria 551
261 Ga0207707_10015407 3300025912 Bacteria 6659
262 Ga0207707_11121194 3300025912 Bacteria 640
263 Ga0207695_10009800 3300025913 Bacteria 11775
264 Ga0207695_10082992 3300025913 Bacteria 3238
265 Ga0207695_10123019 3300025913 Bacteria 2560
266 Ga0207695_10233198 3300025913 Bacteria 1744
267 Ga0207695_10962367 3300025913 Bacteria 733
268 Ga0207671_10314711 3300025914 Bacteria 1238
269 Ga0207693_10017843 3300025915 Bacteria 5658
270 Ga0207660_10031141 3300025917 Bacteria 3670
271 Ga0207657_10494931 3300025919 Bacteria 958
272 Ga0207652_10040999 3300025921 Bacteria 3934
273 Ga0207652_10535845 3300025921 Bacteria 1053
274 Ga0207646_10034893 3300025922 Bacteria 4547
275 Ga0207681_10934352 3300025923 Bacteria 727
276 Ga0207694_10003346 3300025924 Bacteria 12758
277 Ga0207694_10023226 3300025924 Bacteria 4708
278 Ga0207694_10131228 3300025924 Bacteria 2008
279 Ga0207694_10307127 3300025924 Bacteria 1307
280 Ga0207700_10133778 3300025928 Bacteria 2028
281 Ga0207700_10239047 3300025928 Bacteria 1547
282 Ga0207700_11237792 3300025928 Bacteria 666
283 Ga0207664_10015330 3300025929 Bacteria 5557
284 Ga0207664_10380901 3300025929 Bacteria 1252
285 Ga0207690_10071243 3300025932 Bacteria 2397
286 Ga0207690_10458229 3300025932 Bacteria 1026
287 Ga0207686_10270624 3300025934 Bacteria 1249
288 Ga0207665_10020120 3300025939 Bacteria 4383
289 Ga0207711_10245733 3300025941 Bacteria 1642
290 Ga0207689_10521549 3300025942 Bacteria 996
291 Ga0207679_10314266 3300025945 Bacteria 1354
292 Ga0207667_10105282 3300025949 Bacteria 2910
293 Ga0207667_11472749 3300025949 Bacteria 652
294 Ga0207668_10627394 3300025972 Bacteria 939
295 Ga0207640_10048204 3300025981 Bacteria 2753
296 Ga0207677_10247473 3300026023 Bacteria 1446
297 Ga0207678_11496587 3300026067 Bacteria 596
298 Ga0207702_10014094 3300026078 Bacteria 6638
299 Ga0207428_10448476 3300027907 Bacteria 941
300 Ga0268266_10052346 3300028379 Bacteria 3506
301 Ga0268266_10157660 3300028379 Bacteria 2051
302 Ga0265318_10006980 3300028577 Bacteria 5148
303 Ga0265338_10009082 3300028800 Bacteria 11954
304 Ga0265338_10466789 3300028800 Bacteria 892
305 Ga0265338_10554274 3300028800 Bacteria 804
306 Ga0265332_10134957 3300031238 Bacteria 1035
307 Ga0265325_10077749 3300031241 Bacteria 1654
308 Ga0265325_10120863 3300031241 Bacteria 1263
309 Ga0265340_10001562 3300031247 Bacteria 13158
310 Ga0265340_10010366 3300031247 Bacteria 4985
311 Ga0265339_10012876 3300031249 Bacteria 5086
312 Ga0265331_10477702 3300031250 Bacteria 560
313 Ga0265327_10001467 3300031251 Bacteria 29538
314 Ga0265327_10026394 3300031251 Bacteria 3364
315 Ga0265316_10463064 3300031344 Bacteria 908
316 Ga0265313_10002513 3300031595 Bacteria 15770
317 Ga0265313_10011774 3300031595 Bacteria 5410
318 Ga0265314_10005255 3300031711 Bacteria 11721
319 Ga0265342_10084582 3300031712 Bacteria 1826
320 Ga0265342_10096065 3300031712 Bacteria 1694
321 Ga0307507_10482147 3300033179 Bacteria 674
322 Ga0373934_0112941 3300035086 Bacteria 1103
323 Ga0373932_0012814 3300035112 Bacteria 2072
324 Ga0373932_0041846 3300035112 Bacteria 1326
325 Ga0373954_0077580 3300035118 Bacteria 1585
326 Ga0373946_0005307 3300035171 Bacteria 4644
327 Ga0373933_0054146 3300035724 Bacteria 2404
328 Ga0373937_0013496 3300036401 Bacteria 7195
329 Ga0373937_0232535 3300036401 Bacteria 1736
330 Ga0395899_0000208 3300037312 Bacteria 85734
331 Ga0395899_0004890 3300037312 Bacteria 10430
332 Ga0395899_0054286 3300037312 Bacteria 2965
333 Ga0395899_0133621 3300037312 Bacteria 1770
334 Ga0395900_0085392 3300037418 Bacteria 3243
335 Ga0395900_0548194 3300037418 Bacteria 1101
336 Ga0395898_0071298 3300037466 Bacteria 3357
337 Ga0395898_0256544 3300037466 Bacteria 1667
338 Ga0395905_0027618 3300037471 Bacteria 5352
339 Ga0436364_0512696 3300037853 Bacteria 1548
340 Ga0436364_0883536 3300037853 Bacteria 58970
341 Ga0436364_0924986 3300037853 Bacteria 560
342 Ga0436364_1230766 3300037853 Bacteria 152032
343 Ga0436364_1458773 3300037853 Bacteria 2815
344 Ga0395901_0089482 3300038443 Bacteria 3221
345 Ga0395901_0426398 3300038443 Bacteria 1359
346 Ga0395901_0477295 3300038443 Bacteria 1272
347 Ga0436365_0879212 3300039437 Bacteria 2642
348 Ga0436365_1141363 3300039437 Bacteria 685
349 Ga0436360_0061864 3300039438 Bacteria 1206
350 Ga0436360_0428857 3300039438 Bacteria 3140
351 Ga0436360_0493072 3300039438 Bacteria 968
352 Ga0436360_0662283 3300039438 Bacteria 1049
353 Ga0436360_0672600 3300039438 Bacteria 2006
354 Ga0436360_1080240 3300039438 Bacteria 1129
355 Ga0436361_0360740 3300039447 Bacteria 1685
356 Ga0436361_0375010 3300039447 Bacteria 710
357 Ga0436361_0864187 3300039447 Bacteria 1315
358 Ga0436363_1614627 3300039450 Bacteria 625
359 Ga0436362_0032085 3300039453 Bacteria 1063
360 Ga0436362_0085803 3300039453 Bacteria 697
361 Ga0436362_0245696 3300039453 Bacteria 1057
362 Ga0436362_1127741 3300039453 Bacteria 916
363 Ga0439432_074483 3300042006 Bacteria 1033
364 Ga0439449_0003003 3300042007 Bacteria 6582
365 Ga0439462_0107495 3300042015 Bacteria 771
366 Ga0466957_0562317 3300044842 Bacteria 796
367 Ga0466967_1503240 3300045976 Bacteria 671
368 Ga0495650_0007691 3300046471 Bacteria 6422
369 Ga0495606_0085507 3300046507 Bacteria 1951
370 Ga0495632_0000099 3300046519 Bacteria 88415
371 Ga0495613_0057297 3300046689 Bacteria 2861
372 Ga0495686_0005316 3300047472 Bacteria 10202
373 Ga0496100_0288047 3300048903 Bacteria 1226
374 Ga0496101_0019632 3300048904 Bacteria 4618
375 Ga0496102_1028364 3300048905 Bacteria 744
376 Ga0496103_0250809 3300048906 Bacteria 1139
377 Ga0496104_0057204 3300048907 Bacteria 3690
378 Ga0496105_0593312 3300048908 Bacteria 860
379 Ga0496106_0061100 3300048909 Bacteria 2858
380 Ga0496107_0399573 3300048910 Bacteria 1022
381 Ga0496109_1392375 3300048912 Bacteria 637
382 Ga0496110_0287642 3300048913 Bacteria 1497
383 Ga0496110_1434085 3300048913 Bacteria 600
384 Ga0496112_0089452 3300048915 Bacteria 3047
385 Ga0496112_0617786 3300048915 Bacteria 1015
386 Ga0496114_0024921 3300048917 Bacteria 4885
387 Ga0496114_0104896 3300048917 Bacteria 2417
388 Ga0496115_0043065 3300048918 Bacteria 3599
389 Ga0496115_0648554 3300048918 Bacteria 835
390 Ga0496116_0014481 3300048919 Bacteria 6293
391 Ga0496117_0070078 3300048920 Bacteria 2357
392 Ga0496118_0039883 3300048921 Bacteria 3741
393 Ga0496119_0010175 3300048922 Bacteria 7942
394 Ga0496121_0039997 3300048924 Bacteria 4120
395 Ga0496121_0049302 3300048924 Bacteria 3571
396 Ga0496122_0060260 3300048925 Bacteria 2796
397 Ga0496122_0131871 3300048925 Bacteria 1585
398 Ga0496123_0066798 3300048926 Bacteria 2276
399 Ga0496123_0088604 3300048926 Bacteria 1847
400 Ga0496123_0357918 3300048926 Bacteria 676
401 Ga0496124_0056881 3300048927 Bacteria 3297
402 Ga0496124_0110964 3300048927 Bacteria 2207
403 Ga0496124_0153928 3300048927 Bacteria 1800
404 Ga0496125_0090654 3300048928 Bacteria 2293
405 Ga0496126_0012221 3300048929 Bacteria 8809
406 Ga0496126_0438334 3300048929 Bacteria 1053
407 Ga0496126_0441819 3300048929 Bacteria 1048
408 Ga0501032_0013121 3300049569 Bacteria 5900
409 Ga0501033_0002748 3300049570 Bacteria 14756
410 Ga0501033_0098362 3300049570 Bacteria 2137
411 Ga0501033_0249988 3300049570 Bacteria 1257
412 Ga0501034_0027868 3300049571 Bacteria 5744
413 Ga0501034_0282859 3300049571 Bacteria 1598
414 Ga0501036_0009731 3300049572 Bacteria 7916
415 Ga0501037_0027209 3300049573 Bacteria 4224
416 Ga0501037_0076237 3300049573 Bacteria 2435
417 Ga0501038_0030008 3300049574 Bacteria 4813
418 Ga0501038_0084570 3300049574 Bacteria 2669
419 Ga0501039_0003974 3300049575 Bacteria 11111
420 Ga0501043_0017319 3300049579 Bacteria 5653
421 Ga0501046_0003218 3300049580 Bacteria 15007
422 Ga0501047_0033927 3300049581 Bacteria 4926
423 Ga0501047_0060743 3300049581 Bacteria 3646
424 Ga0501047_0170396 3300049581 Bacteria 2046
425 Ga0501047_0271806 3300049581 Bacteria 1541
426 Ga0501048_0070194 3300049582 Bacteria 2475
427 Ga0501068_0396227 3300049584 Bacteria 890
428 Ga0501069_0002766 3300049585 Bacteria 8965
429 Ga0501070_0018548 3300049586 Bacteria 5837
430 Ga0501072_0485359 3300049588 Bacteria 977
431 Ga0501073_0027851 3300049589 Bacteria 4038
432 Ga0501074_0010456 3300049590 Bacteria 6736
433 Ga0501079_0180104 3300049741 Bacteria 1649
434 Ga0501080_0006297 3300049742 Bacteria 10650
435 Ga0501080_0178082 3300049742 Bacteria 1958
436 Ga0501080_0430473 3300049742 Bacteria 1184
437 Ga0501083_0001592 3300049744 Bacteria 15511
438 Ga0501035_0026955 3300049822 Bacteria 5254
439 Ga0501044_0004090 3300049823 Bacteria 16361
440 Ga0501044_0532702 3300049823 Bacteria 1073
441 nmdc:mga06z11_182438_c1 3300050494 Bacteria 1211
442 nmdc:mga07m45_121069_c1 3300050496 Bacteria 1511
443 nmdc:mga07m45_31419_c1 3300050496 Bacteria 2943
444 nmdc:mga05p37_30515_c1 3300050507 Bacteria 6577
445 nmdc:mga0qj67_470918_c1 3300050509 Bacteria 1011
446 nmdc:mga0n895_203457_c1 3300050512 Bacteria 2010
447 nmdc:mga0n895_984941_c1 3300050512 Bacteria 825
448 nmdc:mga0sz30_35457_c1 3300050516 Bacteria 2082
449 Ga0495601_0602890 3300053077 Bacteria 705
450 Ga0500595_013826 3300053119 Bacteria 3081
451 Ga0500618_001320 3300053125 Bacteria 11330
452 Ga0500618_027643 3300053125 Bacteria 1348
453 Ga0500642_0034680 3300053130 Bacteria 2137
454 Ga0500658_0334844 3300053134 Bacteria 695
455 Ga0500588_0015244 3300053146 Bacteria 1964
456 Ga0501084_0055528 3300054114 Bacteria 3313
457 Ga0587084_078516 3300059477 Bacteria 635
458 Ga0587088_063290 3300059508 Bacteria 755
459 Ga0587076_153308 3300059645 Bacteria 561
460 Ga0501082_0047619 3300060353 Bacteria 3694
461 Ga0501082_0703644 3300060353 Bacteria 884
462 2513229177 2513020051 Bacteria 6053213
463 2513593218 2513237087 Bacteria 5817514
464 2552112847 2551306166 Bacteria 9731570
465 2585258533 2582581304 Bacteria 5831370
466 2644242245 2643221643 Bacteria 5749658
467 2644399280 2643221672 Bacteria 6322190
468 2738799802 2738541293 Bacteria 7065685
469 2765468674 2765235802 Bacteria 5618596
470 2840764386 2840764183 Bacteria 6358399
471 2840767337 2840764183 Bacteria 6358399
472 8005259067 8005258706 Bacteria 6184835
473 Ga0436364_0303346
474 JGI24743J22301_10031262
475 JGI24744J21845_10000106
476 JGI24742J22300_10001800
477 JGI25152J39213_1002889
478 JGI25152J39213_1003142
479 JGI25152J39213_1005233
480 JGI25159J45721_1002828
481 JGI25151J46595_10006059
482 JGI25151J46595_10008801
483 JGI25151J46595_10020606
484 JGI25151J46595_10032391
485 JGI25151J46595_10051180
486 JGI25406J46586_10022065
487 JGI25153J46596_10001179
488 JGI25153J46596_10005841
489 JGI25153J46596_10006733
490 JGI25160J50197_1001479
491 Ga0055535_1000221
492 Ga0055542_1000129
493 Ga0055526_1012634
494 Ga0055526_1016577
495 Ga0055524_1019687
496 Ga0055524_1033825
497 Ga0055536_1009252
498 Ga0055534_1002468
499 Ga0055528_1000525
500 Ga0055528_1035134
501 Ga0055530_10010358
502 Ga0055540_1003024
503 Ga0055540_1032178
504 Ga0055531_10002327
505 Ga0055543_1000419
506 Ga0055543_1002078
507 Ga0065165_1005994
508 Ga0065165_1037555
509 Ga0070676_10016236
510 Ga0070676_10852173
511 Ga0070690_100140717
512 Ga0068869_100026218
513 Ga0070666_10021790
514 Ga0070680_100303696
515 Ga0070682_100193582
516 Ga0068868_100000621
517 Ga0068868_100099927
518 Ga0070689_100112712
519 Ga0070691_10051356
520 Ga0070687_100069208
521 Ga0070668_100003154
522 Ga0070669_100039005
523 Ga0070669_100122889
524 Ga0070669_101213452
525 Ga0070671_100045764
526 Ga0070671_101364893
527 Ga0070674_100001308
528 Ga0070673_100225728
529 Ga0070688_100009317
530 Ga0070659_100030107
531 Ga0070659_100805889
532 Ga0070659_100854394
533 Ga0070667_100004899
534 Ga0070709_10045906
535 Ga0070709_10741276
536 Ga0070714_100050717
537 Ga0070714_101474673
538 Ga0070713_100025838
539 Ga0070713_100342544
540 Ga0070710_10042698
541 Ga0070710_10276654
542 Ga0070701_10002927
543 Ga0070711_100026759
544 Ga0070711_100630739
545 Ga0070705_100004772
546 Ga0070694_100008875
547 Ga0070663_100018458
548 Ga0070662_100012376
549 Ga0070681_10004462
550 Ga0070681_10285733
551 Ga0068867_100002277
552 Ga0070706_100166726
553 Ga0070706_100312221
554 Ga0070706_101102983
555 Ga0070707_101924716
556 Ga0070698_100007614
557 Ga0070698_100080964
558 Ga0070699_100024380
559 Ga0070699_100307097
560 Ga0070679_100121456
561 Ga0070679_100935262
562 Ga0070684_100550068
563 Ga0070697_100096553
564 Ga0068853_100014607
565 Ga0068853_100519904
566 Ga0070686_101400742
567 Ga0070695_100044157
568 Ga0070695_100982275
569 Ga0070696_100001491
570 Ga0070696_100327661
571 Ga0070693_100097438
572 Ga0070665_100010877
573 Ga0070665_100595357
574 Ga0070704_100003045
575 Ga0068855_100019150
576 Ga0068855_100078481
577 Ga0068855_100148327
578 Ga0068855_100364678
579 Ga0068857_100202631
580 Ga0068854_100001213
581 Ga0068856_100260832
582 Ga0068856_101903863
583 Ga0070702_100312898
584 Ga0068852_100105818
585 Ga0068859_100259295
586 Ga0068866_10001491
587 Ga0068861_100002962
588 Ga0068861_100502221
589 Ga0068858_100008104
590 Ga0068860_100003769
591 Ga0068862_100001439
592 Ga0068862_100395676
593 Ga0081455_10000751
594 Ga0081455_10006286
595 Ga0081455_10008690
596 Ga0081540_1022748
597 Ga0081539_10001500
598 Ga0070717_10149800
599 Ga0070717_10273474
600 Ga0075365_10004011
601 Ga0075365_10065613
602 Ga0075365_10558870
603 Ga0075363_100433563
604 Ga0075364_10203731
605 Ga0070715_10001393
606 Ga0070715_10004658
607 Ga0070715_10676273
608 Ga0070716_100033325
609 Ga0070716_100036738
610 Ga0070712_100002730
611 Ga0070712_100936470
612 Ga0075362_10005802
613 Ga0075362_10044960
614 Ga0075362_10090109
615 Ga0075362_10161940
616 Ga0075367_10007892
617 Ga0075367_10180108
618 Ga0075369_10005479
619 Ga0075369_10005586
620 Ga0075366_10140990
621 Ga0097621_100497298
622 Ga0075370_10002650
623 Ga0075370_10036478
624 Ga0075370_10209723
625 Ga0068871_100324689
626 Ga0068871_101002871
627 Ga0075430_100035410
628 Ga0075430_100537402
629 Ga0075431_100011129
630 Ga0075433_11247139
631 Ga0075434_100142883
632 Ga0075434_100253332
633 Ga0075434_101539908
634 Ga0068865_100005355
635 Ga0097620_100259290
636 Ga0075435_100113138
637 Ga0075435_100545254
638 Ga0099794_10311258
639 Ga0099794_10335516
640 Ga0099795_10090979
641 Ga0105244_10087110
642 Ga0105240_10009535
643 Ga0105240_10069622
644 Ga0105240_10088929
645 Ga0105240_10148562
646 Ga0105240_10346484
647 Ga0105240_10716529
648 Ga0105245_10005075
649 Ga0105247_10010247
650 Ga0114129_10039882
651 Ga0114129_10100186
652 Ga0105243_10002770
653 Ga0105241_10228726
654 Ga0105241_10339091
655 Ga0105237_10048401
656 Ga0105237_10111424
657 Ga0105237_11020416
658 Ga0105238_10001577
659 Ga0105238_10194028
660 Ga0105238_10236546
661 Ga0105238_10272260
662 Ga0105238_10392791
663 Ga0105238_10395476
664 Ga0105238_11091213
665 Ga0105249_10005355
666 Ga0123341_1000011
667 Ga0123342_1014751
668 Ga0105028_106552
669 Ga0099796_10112485
670 Ga0105239_10025294
671 Ga0105246_10062869
672 Ga0157371_10048625
673 Ga0157371_11498725
674 Ga0157370_10158381
675 Ga0157369_10054328
676 Ga0157369_10416856
677 Ga0157378_10010147
678 Ga0157378_11447437
679 Ga0163162_10013011
680 Ga0157372_10030901
681 Ga0157372_10113002
682 Ga0157372_10349830
683 Ga0157380_10002053
684 Ga0157376_10238731
685 Ga0157376_10243421
686 Ga0182006_1008452
687 Ga0182007_10000951
688 Ga0206356_10469543
689 Ga0206352_10230278
690 Ga0213876_10060623
691 Ga0213875_10000127
692 Ga0213875_10002313
693 Ga0213875_10085345
694 Ga0213871_10074701
695 Ga0224712_10487108
696 Ga0228598_1051516
697 Ga0209672_102876
698 Ga0209258_100240
699 Ga0207425_1001365
700 Ga0209148_1000033
701 Ga0209129_1000082
702 Ga0209129_1000300
703 Ga0209673_1000478
704 Ga0209673_1005739
705 Ga0209673_1018770
706 Ga0209676_1013256
707 Ga0209025_1000974
708 Ga0209025_1003754
709 Ga0209025_1009995
710 Ga0209564_1000215
711 Ga0209564_1024494
712 Ga0209564_1062803
713 Ga0209758_1000390
714 Ga0209758_1000766
715 Ga0209758_1016608
716 Ga0209256_1000155
717 Ga0209256_1008655
718 Ga0207426_1000386
719 Ga0209051_1009625
720 Ga0209051_1015254
721 Ga0209051_1067772
722 Ga0207656_10001162
723 Ga0207692_10050217
724 Ga0207647_10047497
725 Ga0207685_10039896
726 Ga0207699_10067558
727 Ga0207699_10550070
728 Ga0207645_10647705
729 Ga0207705_10009513
730 Ga0207684_10202807
731 Ga0207684_10559592
732 Ga0207684_11491740
733 Ga0207707_10015407
734 Ga0207707_11121194
735 Ga0207695_10009800
736 Ga0207695_10082992
737 Ga0207695_10123019
738 Ga0207695_10233198
739 Ga0207695_10962367
740 Ga0207671_10314711
741 Ga0207693_10017843
742 Ga0207660_10031141
743 Ga0207657_10494931
744 Ga0207652_10040999
745 Ga0207652_10535845
746 Ga0207646_10034893
747 Ga0207681_10934352
748 Ga0207694_10003346
749 Ga0207694_10023226
750 Ga0207694_10131228
751 Ga0207694_10307127
752 Ga0207700_10133778
753 Ga0207700_10239047
754 Ga0207700_11237792
755 Ga0207664_10015330
756 Ga0207664_10380901
757 Ga0207690_10071243
758 Ga0207690_10458229
759 Ga0207686_10270624
760 Ga0207665_10020120
761 Ga0207711_10245733
762 Ga0207689_10521549
763 Ga0207679_10314266
764 Ga0207667_10105282
765 Ga0207667_11472749
766 Ga0207668_10627394
767 Ga0207640_10048204
768 Ga0207677_10247473
769 Ga0207678_11496587
770 Ga0207702_10014094
771 Ga0207428_10448476
772 Ga0268266_10052346
773 Ga0268266_10157660
774 Ga0265318_10006980
775 Ga0265338_10009082
776 Ga0265338_10466789
777 Ga0265338_10554274
778 Ga0265332_10134957
779 Ga0265325_10077749
780 Ga0265325_10120863
781 Ga0265340_10001562
782 Ga0265340_10010366
783 Ga0265339_10012876
784 Ga0265331_10477702
785 Ga0265327_10001467
786 Ga0265327_10026394
787 Ga0265316_10463064
788 Ga0265313_10002513
789 Ga0265313_10011774
790 Ga0265314_10005255
791 Ga0265342_10084582
792 Ga0265342_10096065
793 Ga0307507_10482147
794 Ga0373934_0112941
795 Ga0373932_0012814
796 Ga0373932_0041846
797 Ga0373954_0077580
798 Ga0373946_0005307
799 Ga0373933_0054146
800 Ga0373937_0013496
801 Ga0373937_0232535
802 Ga0395899_0000208
803 Ga0395899_0004890
804 Ga0395899_0054286
805 Ga0395899_0133621
806 Ga0395900_0085392
807 Ga0395900_0548194
808 Ga0395898_0071298
809 Ga0395898_0256544
810 Ga0395905_0027618
811 Ga0436364_0512696
812 Ga0436364_0883536
813 Ga0436364_0924986
814 Ga0436364_1230766
815 Ga0436364_1458773
816 Ga0395901_0089482
817 Ga0395901_0426398
818 Ga0395901_0477295
819 Ga0436365_0879212
820 Ga0436365_1141363
821 Ga0436360_0061864
822 Ga0436360_0428857
823 Ga0436360_0493072
824 Ga0436360_0662283
825 Ga0436360_0672600
826 Ga0436360_1080240
827 Ga0436361_0360740
828 Ga0436361_0375010
829 Ga0436361_0864187
830 Ga0436363_1614627
831 Ga0436362_0032085
832 Ga0436362_0085803
833 Ga0436362_0245696
834 Ga0436362_1127741
835 Ga0439432_074483
836 Ga0439449_0003003
837 Ga0439462_0107495
838 Ga0466957_0562317
839 Ga0466967_1503240
840 Ga0495650_0007691
841 Ga0495606_0085507
842 Ga0495632_0000099
843 Ga0495613_0057297
844 Ga0495686_0005316
845 Ga0496100_0288047
846 Ga0496101_0019632
847 Ga0496102_1028364
848 Ga0496103_0250809
849 Ga0496104_0057204
850 Ga0496105_0593312
851 Ga0496106_0061100
852 Ga0496107_0399573
853 Ga0496109_1392375
854 Ga0496110_0287642
855 Ga0496110_1434085
856 Ga0496112_0089452
857 Ga0496112_0617786
858 Ga0496114_0024921
859 Ga0496114_0104896
860 Ga0496115_0043065
861 Ga0496115_0648554
862 Ga0496116_0014481
863 Ga0496117_0070078
864 Ga0496118_0039883
865 Ga0496119_0010175
866 Ga0496121_0039997
867 Ga0496121_0049302
868 Ga0496122_0060260
869 Ga0496122_0131871
870 Ga0496123_0066798
871 Ga0496123_0088604
872 Ga0496123_0357918
873 Ga0496124_0056881
874 Ga0496124_0110964
875 Ga0496124_0153928
876 Ga0496125_0090654
877 Ga0496126_0012221
878 Ga0496126_0438334
879 Ga0496126_0441819
880 Ga0501032_0013121
881 Ga0501033_0002748
882 Ga0501033_0098362
883 Ga0501033_0249988
884 Ga0501034_0027868
885 Ga0501034_0282859
886 Ga0501036_0009731
887 Ga0501037_0027209
888 Ga0501037_0076237
889 Ga0501038_0030008
890 Ga0501038_0084570
891 Ga0501039_0003974
892 Ga0501043_0017319
893 Ga0501046_0003218
894 Ga0501047_0033927
895 Ga0501047_0060743
896 Ga0501047_0170396
897 Ga0501047_0271806
898 Ga0501048_0070194
899 Ga0501068_0396227
900 Ga0501069_0002766
901 Ga0501070_0018548
902 Ga0501072_0485359
903 Ga0501073_0027851
904 Ga0501074_0010456
905 Ga0501079_0180104
906 Ga0501080_0006297
907 Ga0501080_0178082
908 Ga0501080_0430473
909 Ga0501083_0001592
910 Ga0501035_0026955
911 Ga0501044_0004090
912 Ga0501044_0532702
913 nmdc:mga06z11_182438_c1
914 nmdc:mga07m45_121069_c1
915 nmdc:mga07m45_31419_c1
916 nmdc:mga05p37_30515_c1
917 nmdc:mga0qj67_470918_c1
918 nmdc:mga0n895_203457_c1
919 nmdc:mga0n895_984941_c1
920 nmdc:mga0sz30_35457_c1
921 Ga0495601_0602890
922 Ga0500595_013826
923 Ga0500618_001320
924 Ga0500618_027643
925 Ga0500642_0034680
926 Ga0500658_0334844
927 Ga0500588_0015244
928 Ga0501084_0055528
929 Ga0587084_078516
930 Ga0587088_063290
931 Ga0587076_153308
932 Ga0501082_0047619
933 Ga0501082_0703644
934 2513229177
935 2513593218
936 2552112847
937 2585258533
938 2644242245
939 2644399280
940 2738799802
941 2765468674
942 2840764386
943 2840767337
944 8005259067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

87

161

0.89

PF00190

Cupin_1

Cupin

78

178

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.8741 47 122
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.8734 47 127
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8416 47 126
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.8372 47 124
7x85-assembly2.cif.gz_C crystal structure of chicken cenp-c cupin domain 0.8302 27 126
ID Description Score Start End Superfamily
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8817 47 124 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8571 30 126 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8563 30 124 2.60.120.10
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.853 47 127 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8406 30 126 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2T0M1V3-F1-model_v4 Mannose-6-phosphate isomerase-like protein (Cupin superfamily) 0.881 47 125 GO:0016853
AF-A0A177FKT9-F1-model_v4 Cupin type-2 domain-containing protein 0.8693 47 125 GO:0046872
AF-A0A7X1P4J6-F1-model_v4 Cupin domain-containing protein 0.8661 47 129
AF-A0A4Q4CK21-F1-model_v4 Cupin domain-containing protein 0.865 8 124
AF-A0A1Z9TAN9-F1-model_v4 Mannose-6-phosphate isomerase type II C-terminal domain-containing protein 0.861 27 127

Map