F450843

General Info

Members Datasets Scaffolds Average Seq Length
472 285 944 164

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0307584|Ga0373931_0307584_254_811
Length 185
Sequence MVMRAAGTLGSPTVTAEEIHVSTTDSDASAWLSQEAHDRLQAELAELIANRPVIAAEINARREEGDLRENGGYHAAREEQGKMEGRIRYLQELLRTAHVGDAPTADAVAPGTVVTIYFEDDADDVETFLLGSREIAATTELTVYSPESALGNAILGARAGESVTYTAPNGKDIKVTVVSFEPYAG

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
144 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
228 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
229 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
230 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
231 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
235 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
236 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
237 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
239 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
240 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
241 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
242 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
243 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
244 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
245 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
246 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
247 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
248 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
249 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
250 2855683550 Micromonospora sp. RP3T Isolate Unclassified
251 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
252 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
253 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
254 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
255 2858868258 Micromonospora sp. MH33 Isolate Unclassified
256 2858882152 Micromonospora noduli MED15 Isolate Nodule
257 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
258 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
259 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
260 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
261 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
262 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
263 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
264 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
265 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
266 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
267 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
268 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
269 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
270 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
271 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
272 2902582711 Micromonospora sp. AP08 Isolate Unclassified
273 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
274 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
275 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
276 649633069 Micromonospora sp. L5 Isolate Unclassified
277 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
278 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
279 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
280 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
281 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
282 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
283 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
284 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
285 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.08
Metatranscriptomes 2.75
Isolates 10.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 1.27
Rhizoplane 2.97
Rhizosphere 80.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0307584 3300035691 Bacteria 981
2 LJQas_1009938 3300000549 Bacteria 1143
3 JGI25406J46586_10045279 3300003203 Bacteria 1516
4 JGI25406J46586_10054472 3300003203 Bacteria 1323
5 JGI25406J46586_10070373 3300003203 Bacteria 1100
6 rootH2_10107141 3300003320 Bacteria 1962
7 Ga0070658_11552145 3300005327 Bacteria 574
8 Ga0070676_10039725 3300005328 Bacteria 2722
9 Ga0070683_100049181 3300005329 Bacteria 3899
10 Ga0068869_100032614 3300005334 Bacteria 3671
11 Ga0068869_101127989 3300005334 Bacteria 687
12 Ga0070680_100111295 3300005336 Bacteria 2280
13 Ga0070680_100236011 3300005336 Bacteria 1545
14 Ga0070680_100421251 3300005336 Bacteria 1139
15 Ga0068868_100001291 3300005338 Bacteria 17250
16 Ga0070660_100012492 3300005339 Bacteria 6066
17 Ga0070689_101006213 3300005340 Bacteria 742
18 Ga0070691_10372733 3300005341 Bacteria 798
19 Ga0070687_100120407 3300005343 Bacteria 1500
20 Ga0070661_100026958 3300005344 Bacteria 4136
21 Ga0070668_100162484 3300005347 Bacteria 1813
22 Ga0070668_100165317 3300005347 Bacteria 1798
23 Ga0070668_100649479 3300005347 Bacteria 927
24 Ga0070669_100429760 3300005353 Bacteria 1085
25 Ga0070675_100038452 3300005354 Bacteria 3899
26 Ga0070674_101244641 3300005356 Bacteria 662
27 Ga0070673_100991622 3300005364 Bacteria 782
28 Ga0070659_100011891 3300005366 Bacteria 6444
29 Ga0070659_100049975 3300005366 Bacteria 3289
30 Ga0070667_100067994 3300005367 Bacteria 3031
31 Ga0070667_100143341 3300005367 Bacteria 2094
32 Ga0070714_100694347 3300005435 Bacteria 982
33 Ga0070713_100477783 3300005436 Bacteria 1174
34 Ga0070713_102166792 3300005436 Bacteria 539
35 Ga0070700_100044444 3300005441 Bacteria 2736
36 Ga0070694_100474794 3300005444 Bacteria 991
37 Ga0070708_100661554 3300005445 Bacteria 984
38 Ga0070663_100130734 3300005455 Bacteria 1906
39 Ga0070663_100602676 3300005455 Bacteria 924
40 Ga0070678_100792375 3300005456 Bacteria 860
41 Ga0070678_100830283 3300005456 Bacteria 841
42 Ga0070662_100342024 3300005457 Bacteria 1224
43 Ga0070681_11664964 3300005458 Bacteria 564
44 Ga0070698_101122173 3300005471 Bacteria 735
45 Ga0070679_100326804 3300005530 Bacteria 1482
46 Ga0070684_100002107 3300005535 Bacteria 14652
47 Ga0070684_100013293 3300005535 Bacteria 6633
48 Ga0070684_100024491 3300005535 Bacteria 5063
49 Ga0070684_101058456 3300005535 Bacteria 762
50 Ga0070672_100173417 3300005543 Bacteria 1795
51 Ga0070672_100714359 3300005543 Bacteria 878
52 Ga0070686_100473721 3300005544 Bacteria 967
53 Ga0070693_100218538 3300005547 Bacteria 1247
54 Ga0070665_100043653 3300005548 Bacteria 4504
55 Ga0070665_101494596 3300005548 Bacteria 684
56 Ga0068855_100525667 3300005563 Bacteria 1283
57 Ga0070664_100004626 3300005564 Bacteria 11046
58 Ga0070664_100094531 3300005564 Bacteria 2592
59 Ga0070664_100100962 3300005564 Bacteria 2509
60 Ga0070664_100103486 3300005564 Bacteria 2478
61 Ga0070664_101005654 3300005564 Bacteria 784
62 Ga0068857_100046738 3300005577 Bacteria 3841
63 Ga0068857_100052154 3300005577 Bacteria 3629
64 Ga0068857_100225828 3300005577 Bacteria 1711
65 Ga0068857_100274456 3300005577 Bacteria 1550
66 Ga0070702_100034757 3300005615 Bacteria 2780
67 Ga0070702_100488036 3300005615 Bacteria 902
68 Ga0068852_100257589 3300005616 Bacteria 1674
69 Ga0068852_100350822 3300005616 Bacteria 1441
70 Ga0068859_100117343 3300005617 Bacteria 2726
71 Ga0068859_100285543 3300005617 Bacteria 1743
72 Ga0068864_100042511 3300005618 Bacteria 3889
73 Ga0068864_100404620 3300005618 Bacteria 1298
74 Ga0068864_100441559 3300005618 Bacteria 1243
75 Ga0068866_10197627 3300005718 Bacteria 1199
76 Ga0068861_100489716 3300005719 Bacteria 1109
77 Ga0068861_100882636 3300005719 Bacteria 846
78 Ga0068863_100065850 3300005841 Bacteria 3428
79 Ga0068863_100073639 3300005841 Bacteria 3231
80 Ga0068863_100147892 3300005841 Bacteria 2248
81 Ga0068863_101295455 3300005841 Bacteria 735
82 Ga0068858_100198617 3300005842 Bacteria 1896
83 Ga0068860_100445742 3300005843 Bacteria 1287
84 Ga0068862_100158618 3300005844 Bacteria 2018
85 Ga0068862_100314837 3300005844 Bacteria 1443
86 Ga0068862_100330665 3300005844 Bacteria 1409
87 Ga0081540_1000693 3300005983 Bacteria 31415
88 Ga0081540_1016358 3300005983 Bacteria 4645
89 Ga0081540_1019268 3300005983 Bacteria 4155
90 Ga0081539_10000213 3300005985 Bacteria 136148
91 Ga0081539_10001793 3300005985 Bacteria 34022
92 Ga0081539_10007110 3300005985 Bacteria 10345
93 Ga0081539_10007156 3300005985 Bacteria 10293
94 Ga0081539_10018986 3300005985 Bacteria 4733
95 Ga0070717_10404446 3300006028 Bacteria 1227
96 Ga0070712_100287268 3300006175 Bacteria 1327
97 Ga0097621_101237766 3300006237 Bacteria 704
98 Ga0068871_100963435 3300006358 Bacteria 793
99 Ga0075428_100001119 3300006844 Bacteria 28604
100 Ga0075428_100003093 3300006844 Bacteria 18154
101 Ga0075428_100040143 3300006844 Bacteria 5150
102 Ga0075428_100054376 3300006844 Bacteria 4387
103 Ga0075428_100256253 3300006844 Bacteria 1885
104 Ga0075428_100409492 3300006844 Bacteria 1453
105 Ga0075428_100804509 3300006844 Bacteria 999
106 Ga0075428_101037715 3300006844 Bacteria 867
107 Ga0075430_100016105 3300006846 Bacteria 6366
108 Ga0075430_100094058 3300006846 Bacteria 2506
109 Ga0075430_100217889 3300006846 Bacteria 1584
110 Ga0075430_100315035 3300006846 Bacteria 1294
111 Ga0075430_100802111 3300006846 Bacteria 776
112 Ga0075431_100040847 3300006847 Bacteria 4782
113 Ga0075431_100158822 3300006847 Bacteria 2325
114 Ga0075431_100263745 3300006847 Bacteria 1748
115 Ga0075431_100407503 3300006847 Bacteria 1360
116 Ga0075431_100657012 3300006847 Bacteria 1028
117 Ga0075433_10759223 3300006852 Bacteria 848
118 Ga0075429_100018479 3300006880 Bacteria 6039
119 Ga0075429_100021226 3300006880 Bacteria 5630
120 Ga0075429_100512621 3300006880 Bacteria 1051
121 Ga0075429_101194781 3300006880 Bacteria 664
122 Ga0097620_100117351 3300006931 Bacteria 2726
123 Ga0097620_100285538 3300006931 Bacteria 1743
124 Ga0105251_10108207 3300009011 Bacteria 1268
125 Ga0111539_10022434 3300009094 Bacteria 7757
126 Ga0111539_10864020 3300009094 Bacteria 1052
127 Ga0111539_10894112 3300009094 Bacteria 1033
128 Ga0111539_12335523 3300009094 Bacteria 620
129 Ga0105245_10037581 3300009098 Bacteria 4305
130 Ga0114129_10000544 3300009147 Bacteria 46212
131 Ga0114129_10002321 3300009147 Bacteria 26414
132 Ga0114129_10034979 3300009147 Bacteria 7096
133 Ga0114129_10070977 3300009147 Bacteria 4856
134 Ga0114129_10235560 3300009147 Bacteria 2463
135 Ga0114129_10237851 3300009147 Bacteria 2449
136 Ga0114129_11177306 3300009147 Bacteria 956
137 Ga0105243_11562430 3300009148 Bacteria 685
138 Ga0105241_10787212 3300009174 Bacteria 875
139 Ga0105248_10015227 3300009177 Bacteria 8475
140 Ga0105248_10092424 3300009177 Bacteria 3408
141 Ga0105248_10446217 3300009177 Bacteria 1458
142 Ga0105248_11233179 3300009177 Bacteria 846
143 Ga0105237_10242405 3300009545 Bacteria 1804
144 Ga0105237_10682317 3300009545 Bacteria 1034
145 Ga0105238_11621223 3300009551 Bacteria 677
146 Ga0105249_10085256 3300009553 Bacteria 2943
147 Ga0105239_10364842 3300010375 Bacteria 1632
148 Ga0105239_10380280 3300010375 Bacteria 1596
149 Ga0105239_11195788 3300010375 Bacteria 876
150 Ga0105246_10514400 3300011119 Bacteria 1019
151 Ga0157369_10022871 3300013105 Bacteria 6971
152 Ga0157374_11242567 3300013296 Bacteria 766
153 Ga0157378_11595562 3300013297 Bacteria 698
154 Ga0163162_10583309 3300013306 Bacteria 1245
155 Ga0157372_10375923 3300013307 Bacteria 1656
156 Ga0163163_10150881 3300014325 Bacteria 2368
157 Ga0163163_11153259 3300014325 Bacteria 838
158 Ga0157377_10016228 3300014745 Bacteria 3827
159 Ga0157377_10127051 3300014745 Bacteria 1552
160 Ga0157377_10257790 3300014745 Bacteria 1133
161 Ga0157379_10143085 3300014968 Bacteria 2156
162 Ga0157379_10554357 3300014968 Bacteria 1070
163 Ga0197907_10914371 3300020069 Bacteria 954
164 Ga0206356_10849231 3300020070 Bacteria 580
165 Ga0206349_1690891 3300020075 Bacteria 1595
166 Ga0206355_1623745 3300020076 Bacteria 605
167 Ga0206352_10511523 3300020078 Bacteria 1815
168 Ga0206350_10933741 3300020080 Bacteria 861
169 Ga0206354_11241192 3300020081 Bacteria 2207
170 Ga0206353_11816468 3300020082 Bacteria 705
171 Ga0154015_1198087 3300020610 Bacteria 567
172 Ga0154015_1636708 3300020610 Bacteria 989
173 Ga0224712_10040316 3300022467 Bacteria 1756
174 Ga0224712_10584991 3300022467 Bacteria 544
175 Ga0207684_10547767 3300025910 Bacteria 990
176 Ga0207707_10095780 3300025912 Bacteria 2594
177 Ga0207671_10230373 3300025914 Bacteria 1453
178 Ga0207693_10080607 3300025915 Bacteria 2548
179 Ga0207660_10057059 3300025917 Bacteria 2796
180 Ga0207660_10551016 3300025917 Bacteria 938
181 Ga0207662_10217655 3300025918 Bacteria 1242
182 Ga0207657_10181818 3300025919 Bacteria 1699
183 Ga0207657_10449809 3300025919 Bacteria 1011
184 Ga0207649_10109732 3300025920 Bacteria 1841
185 Ga0207652_10069294 3300025921 Bacteria 3062
186 Ga0207652_10456581 3300025921 Bacteria 1151
187 Ga0207681_10528984 3300025923 Bacteria 968
188 Ga0207681_11554218 3300025923 Bacteria 554
189 Ga0207694_10104243 3300025924 Bacteria 2250
190 Ga0207650_11083382 3300025925 Bacteria 682
191 Ga0207659_10032671 3300025926 Bacteria 3574
192 Ga0207700_10535181 3300025928 Bacteria 1039
193 Ga0207700_11580070 3300025928 Bacteria 581
194 Ga0207664_10080981 3300025929 Bacteria 2641
195 Ga0207690_10010008 3300025932 Bacteria 5633
196 Ga0207690_10111614 3300025932 Bacteria 1970
197 Ga0207690_10953447 3300025932 Bacteria 713
198 Ga0207706_10149465 3300025933 Bacteria 2054
199 Ga0207669_10733333 3300025937 Bacteria 815
200 Ga0207665_10831423 3300025939 Bacteria 730
201 Ga0207691_10441053 3300025940 Bacteria 1108
202 Ga0207711_10717965 3300025941 Bacteria 932
203 Ga0207711_10806190 3300025941 Bacteria 874
204 Ga0207689_10025844 3300025942 Bacteria 4919
205 Ga0207689_10985080 3300025942 Bacteria 711
206 Ga0207661_10001872 3300025944 Bacteria 14421
207 Ga0207661_10010221 3300025944 Bacteria 6748
208 Ga0207661_10627754 3300025944 Bacteria 987
209 Ga0207679_10051634 3300025945 Bacteria 3010
210 Ga0207679_10668776 3300025945 Bacteria 940
211 Ga0207667_10686137 3300025949 Bacteria 1027
212 Ga0207651_10997184 3300025960 Bacteria 748
213 Ga0207712_10284539 3300025961 Bacteria 1350
214 Ga0207668_10004296 3300025972 Bacteria 8364
215 Ga0207668_10043699 3300025972 Bacteria 3043
216 Ga0207668_10108001 3300025972 Bacteria 2082
217 Ga0207668_10632653 3300025972 Bacteria 935
218 Ga0207658_10341049 3300025986 Bacteria 1302
219 Ga0207677_10047665 3300026023 Bacteria 2879
220 Ga0207703_10411727 3300026035 Bacteria 1256
221 Ga0207703_11066677 3300026035 Bacteria 776
222 Ga0207703_11472414 3300026035 Bacteria 655
223 Ga0207678_10153478 3300026067 Bacteria 1966
224 Ga0207678_10195312 3300026067 Bacteria 1730
225 Ga0207678_10594476 3300026067 Bacteria 970
226 Ga0207708_10066403 3300026075 Bacteria 2758
227 Ga0207702_10283021 3300026078 Bacteria 1568
228 Ga0207702_10333276 3300026078 Bacteria 1448
229 Ga0207641_10042166 3300026088 Bacteria 3827
230 Ga0207641_10288160 3300026088 Bacteria 1547
231 Ga0207641_10435023 3300026088 Bacteria 1265
232 Ga0207641_11277884 3300026088 Bacteria 734
233 Ga0207641_11317812 3300026088 Bacteria 723
234 Ga0207676_10236887 3300026095 Bacteria 1635
235 Ga0207676_10719725 3300026095 Bacteria 968
236 Ga0207676_10737450 3300026095 Bacteria 957
237 Ga0207674_10026088 3300026116 Bacteria 6216
238 Ga0207674_10046541 3300026116 Bacteria 4453
239 Ga0207674_10074314 3300026116 Bacteria 3411
240 Ga0207674_10089853 3300026116 Bacteria 3064
241 Ga0207674_10419921 3300026116 Bacteria 1292
242 Ga0207674_10630396 3300026116 Bacteria 1035
243 Ga0207674_10659405 3300026116 Bacteria 1010
244 Ga0207675_100511542 3300026118 Bacteria 1196
245 Ga0207675_100695152 3300026118 Bacteria 1025
246 Ga0207683_10094949 3300026121 Bacteria 2658
247 Ga0207698_10085604 3300026142 Bacteria 2560
248 Ga0207698_10759120 3300026142 Bacteria 969
249 Ga0207428_10036326 3300027907 Bacteria 4019
250 Ga0268266_10061186 3300028379 Bacteria 3247
251 Ga0268266_10289654 3300028379 Bacteria 1525
252 Ga0268266_10378129 3300028379 Bacteria 1335
253 Ga0268265_10161780 3300028380 Bacteria 1902
254 Ga0268265_10196290 3300028380 Bacteria 1747
255 Ga0268265_10225403 3300028380 Bacteria 1643
256 Ga0268265_10229957 3300028380 Bacteria 1629
257 Ga0268264_10084301 3300028381 Bacteria 2724
258 Ga0268264_11338751 3300028381 Bacteria 726
259 Ga0307517_10033811 3300028786 Bacteria 5851
260 Ga0307515_10001363 3300028794 Bacteria 55232
261 Ga0307515_10010013 3300028794 Bacteria 18244
262 Ga0307515_10051405 3300028794 Bacteria 6145
263 Ga0307511_10216545 3300030521 Bacteria 969
264 Ga0307512_10020029 3300030522 Bacteria 6072
265 Ga0316177_1194607 3300030731 Bacteria 1906
266 Ga0316181_1263731 3300030744 Bacteria 1048
267 Ga0316182_1211122 3300030745 Bacteria 1094
268 Ga0307513_10018095 3300031456 Bacteria 8432
269 Ga0307513_10048536 3300031456 Bacteria 4607
270 Ga0307509_10011938 3300031507 Bacteria 10438
271 Ga0307509_10177935 3300031507 Bacteria 1997
272 Ga0307408_100011801 3300031548 Bacteria 5779
273 Ga0307508_10004259 3300031616 Bacteria 14042
274 Ga0307508_10013606 3300031616 Bacteria 7434
275 Ga0307508_10029730 3300031616 Bacteria 4938
276 Ga0307508_10078040 3300031616 Bacteria 2891
277 Ga0307514_10407289 3300031649 Bacteria 691
278 Ga0307514_10424135 3300031649 Bacteria 667
279 Ga0307516_10027383 3300031730 Bacteria 5779
280 Ga0307405_10037303 3300031731 Bacteria 2920
281 Ga0307405_10315476 3300031731 Bacteria 1192
282 Ga0307405_11410550 3300031731 Bacteria 609
283 Ga0307413_10008177 3300031824 Bacteria 4920
284 Ga0307413_10168603 3300031824 Bacteria 1547
285 Ga0307413_10793527 3300031824 Bacteria 795
286 Ga0307518_10115806 3300031838 Bacteria 1904
287 Ga0307410_10031107 3300031852 Bacteria 3421
288 Ga0307410_10069450 3300031852 Bacteria 2437
289 Ga0307410_10953251 3300031852 Bacteria 738
290 Ga0326468_10001845 3300031889 Bacteria 1792
291 Ga0307406_10002065 3300031901 Bacteria 10965
292 Ga0307406_10004429 3300031901 Bacteria 7643
293 Ga0307406_10497201 3300031901 Bacteria 988
294 Ga0307406_11180924 3300031901 Bacteria 664
295 Ga0307407_10143938 3300031903 Bacteria 1541
296 Ga0307407_10752503 3300031903 Bacteria 738
297 Ga0307409_100049923 3300031995 Bacteria 3192
298 Ga0307409_100092190 3300031995 Bacteria 2485
299 Ga0307409_101023642 3300031995 Bacteria 845
300 Ga0307416_100013327 3300032002 Bacteria 5583
301 Ga0307416_100344255 3300032002 Bacteria 1505
302 Ga0307416_100345785 3300032002 Bacteria 1502
303 Ga0307416_100464789 3300032002 Bacteria 1321
304 Ga0307415_100004987 3300032126 Bacteria 6984
305 Ga0307415_100047418 3300032126 Bacteria 2892
306 Ga0307415_100054684 3300032126 Bacteria 2727
307 Ga0307415_100358556 3300032126 Bacteria 1230
308 Ga0307415_100695779 3300032126 Bacteria 917
309 Ga0307415_100697488 3300032126 Bacteria 916
310 Ga0307415_101045725 3300032126 Bacteria 761
311 Ga0307507_10033471 3300033179 Bacteria 5336
312 Ga0373939_0172118 3300035114 Bacteria 802
313 Ga0373941_0011945 3300035115 Bacteria 2258
314 Ga0373943_0086646 3300035170 Bacteria 1615
315 Ga0373942_0012982 3300035207 Bacteria 1997
316 Ga0373962_0148708 3300035242 Bacteria 765
317 Ga0373924_0035336 3300035410 Bacteria 2027
318 Ga0373935_0007925 3300035692 Bacteria 6371
319 Ga0373933_0391103 3300035724 Bacteria 906
320 Ga0373947_0920886 3300035725 Bacteria 597
321 Ga0373925_0114052 3300037068 Bacteria 2091
322 Ga0395899_0025039 3300037312 Bacteria 4506
323 Ga0395900_0232037 3300037418 Bacteria 1855
324 Ga0395898_0007503 3300037466 Bacteria 11588
325 Ga0395905_0021450 3300037471 Bacteria 6106
326 Ga0395905_0715279 3300037471 Bacteria 904
327 Ga0395905_1062827 3300037471 Bacteria 713
328 Ga0395901_0014954 3300038443 Bacteria 7886
329 Ga0395901_0051896 3300038443 Bacteria 4263
330 Ga0436365_1223630 3300039437 Bacteria 859
331 Ga0439436_0014432 3300041404 Bacteria 2383
332 Ga0439438_081214 3300041405 Bacteria 795
333 Ga0439439_0233600 3300041406 Bacteria 541
334 Ga0451791_1267938 3300041451 Bacteria 667
335 Ga0451843_1074442 3300041509 Bacteria 924
336 Ga0451843_1541869 3300041509 Bacteria 646
337 Ga0451853_0235382 3300041512 Bacteria 3842
338 Ga0439442_015027 3300042002 Bacteria 1595
339 Ga0439449_0002742 3300042007 Bacteria 6849
340 Ga0439449_0031267 3300042007 Bacteria 1984
341 Ga0466957_0006912 3300044842 Bacteria 6414
342 Ga0495629_0206139 3300046459 Bacteria 1359
343 Ga0495580_0487527 3300046472 Bacteria 824
344 Ga0495594_0169468 3300046499 Bacteria 1242
345 Ga0495594_0217486 3300046499 Bacteria 1089
346 Ga0495606_0002032 3300046507 Bacteria 24800
347 Ga0495668_0000182 3300046616 Bacteria 93763
348 Ga0495625_0002539 3300046660 Bacteria 19633
349 Ga0495672_0123161 3300047320 Bacteria 1375
350 Ga0495593_0031162 3300047673 Bacteria 2915
351 Ga0495626_0000113 3300048091 Bacteria 105218
352 Ga0496104_0092920 3300048907 Bacteria 2885
353 Ga0496104_0312773 3300048907 Bacteria 1483
354 Ga0496105_0231471 3300048908 Bacteria 1502
355 Ga0496108_0000016 3300048911 Bacteria 237051
356 Ga0496108_0002361 3300048911 Bacteria 15117
357 Ga0496109_0005119 3300048912 Bacteria 10951
358 Ga0496110_0022604 3300048913 Bacteria 5341
359 Ga0496111_0260694 3300048914 Bacteria 1286
360 Ga0496112_0028057 3300048915 Bacteria 5430
361 Ga0496112_0306369 3300048915 Bacteria 1533
362 Ga0496112_0344427 3300048915 Bacteria 1433
363 Ga0496112_0654773 3300048915 Bacteria 980
364 Ga0496113_0098025 3300048916 Bacteria 2269
365 Ga0501032_0049731 3300049569 Bacteria 2828
366 Ga0501034_1134260 3300049571 Bacteria 662
367 Ga0501036_0147701 3300049572 Bacteria 1983
368 Ga0501036_1066888 3300049572 Bacteria 660
369 Ga0501038_0100251 3300049574 Bacteria 2413
370 Ga0501046_0067432 3300049580 Bacteria 2787
371 Ga0501047_0012045 3300049581 Bacteria 8184
372 Ga0501047_0579941 3300049581 Bacteria 944
373 Ga0501070_0591435 3300049586 Bacteria 885
374 Ga0501073_0317617 3300049589 Bacteria 1075
375 Ga0501074_0025225 3300049590 Bacteria 4319
376 Ga0501076_0545650 3300049592 Bacteria 956
377 Ga0501044_0082889 3300049823 Bacteria 3243
378 Ga0501044_0964996 3300049823 Bacteria 725
379 nmdc:mga0yw44_762745_c1 3300050492 Bacteria 657
380 nmdc:mga05p37_133886_c1 3300050507 Bacteria 3040
381 nmdc:mga05p37_154_c1 3300050507 Bacteria 65419
382 nmdc:mga05p37_2233_c1 3300050507 Bacteria 22562
383 nmdc:mga05p37_26410_c1 3300050507 Bacteria 7063
384 nmdc:mga05p37_381180_c1 3300050507 Bacteria 1652
385 nmdc:mga09592_1053881_c1 3300050508 Bacteria 678
386 nmdc:mga09592_268528_c1 3300050508 Bacteria 1480
387 nmdc:mga09592_35649_c1 3300050508 Bacteria 4165
388 nmdc:mga09592_36_c3 3300050508 Bacteria 51356
389 nmdc:mga09592_933978_c1 3300050508 Bacteria 728
390 nmdc:mga09592_98401_c1 3300050508 Bacteria 2504
391 nmdc:mga0qj67_1029_c1 3300050509 Bacteria 19287
392 nmdc:mga0qj67_16665_c1 3300050509 Bacteria 5577
393 nmdc:mga0qj67_42513_c1 3300050509 Bacteria 3577
394 nmdc:mga0qj67_42_c1 3300050509 Bacteria 46863
395 nmdc:mga0qj67_461341_c1 3300050509 Bacteria 1023
396 nmdc:mga0qj67_723046_c1 3300050509 Bacteria 791
397 nmdc:mga06r32_42_c2 3300050510 Bacteria 56690
398 nmdc:mga06r32_44559_c1 3300050510 Bacteria 4225
399 nmdc:mga06r32_550736_c1 3300050510 Bacteria 1127
400 nmdc:mga06r32_82602_c1 3300050510 Bacteria 3130
401 nmdc:mga08y16_1559582_c1 3300050511 Bacteria 619
402 nmdc:mga08y16_22301_c1 3300050511 Bacteria 6682
403 nmdc:mga08y16_690931_c1 3300050511 Bacteria 1021
404 Ga0495619_0004111 3300053085 Bacteria 9311
405 Ga0500644_0032248 3300053088 Bacteria 1673
406 Ga0500646_0000139 3300053090 Bacteria 21207
407 Ga0500646_0034340 3300053090 Bacteria 1406
408 Ga0500583_0122858 3300053092 Bacteria 1285
409 Ga0500583_0396009 3300053092 Bacteria 663
410 Ga0500651_0215670 3300053093 Bacteria 1127
411 Ga0500641_0011244 3300053096 Bacteria 3247
412 Ga0500641_0073347 3300053096 Bacteria 1444
413 Ga0500650_0130446 3300053098 Bacteria 1169
414 Ga0500654_065157 3300053099 Bacteria 1827
415 Ga0500660_089784 3300053100 Bacteria 1377
416 Ga0500562_107955 3300053108 Bacteria 758
417 Ga0500569_146509 3300053109 Bacteria 795
418 Ga0500594_0000685 3300053118 Bacteria 7222
419 Ga0500652_039342 3300053131 Bacteria 1896
420 Ga0500577_0333187 3300053142 Bacteria 663
421 Ga0500588_0006392 3300053146 Bacteria 2668
422 Ga0500588_0080439 3300053146 Bacteria 1089
423 Ga0500630_130303 3300053159 Bacteria 1100
424 Ga0587066_139105 3300059490 Bacteria 591
425 2515493713 2515154088 Bacteria 5526283
426 2515720532 2515154129 Bacteria 5584369
427 2515755102 2515154137 Bacteria 5711575
428 2516084099 2515154202 Bacteria 5471270
429 2516087755 2515154203 Bacteria 5458536
430 2623586686 2622736626 Bacteria 7181580
431 2753265375 2751185782 Bacteria 11227053
432 2772641885 2772190715 Bacteria 6959372
433 2831938795 2831935698 Bacteria 5963223
434 2832006664 2832004796 Bacteria 6538017
435 2855671517 2855670206 Bacteria 7120389
436 2855680583 2855676851 Bacteria 7063653
437 2855688487 2855683550 Bacteria 7134265
438 2856860605 2856858025 Bacteria 7255264
439 2857292214 2857288857 Bacteria 7189066
440 2857484149 2857481737 Bacteria 4761446
441 2858853405 2858848962 Bacteria 6963058
442 2858869338 2858868258 Bacteria 7683772
443 2858883630 2858882152 Bacteria 7230291
444 2858890527 2858888857 Bacteria 7060307
445 2858901156 2858895516 Bacteria 7378898
446 2858907619 2858902515 Bacteria 7086037
447 2861524682 2861520306 Bacteria 8348283
448 2866067256 2866065130 Bacteria 6518152
449 2867304044 2867302475 Bacteria 7087181
450 2867313111 2867312974 Bacteria 7058875
451 2867325965 2867319477 Bacteria 7069771
452 2867509546 2867507094 Bacteria 6506033
453 2869048622 2869048445 Bacteria 6875584
454 2869065072 2869061728 Bacteria 7112407
455 2869070345 2869068681 Bacteria 7205615
456 2880493509 2880489317 Bacteria 7096270
457 2880498800 2880495981 Bacteria 7340502
458 2887484055 2887478801 Bacteria 8972725
459 2902586136 2902582711 Bacteria 6187705
460 2929220803 2929219909 Bacteria 6984360
461 2929227379 2929226422 Bacteria 7248583
462 2996227109 2996221748 Bacteria 6799777
463 649811340 649633069 Bacteria 6962533
464 8003832604 8003830390 Bacteria 6541657
465 8003862368 8003856774 Bacteria 7675274
466 8003871464 8003870546 Bacteria 7396674
467 8054707043 8054704163 Bacteria 7247792
468 8054727615 8054727385 Bacteria 7558670
469 8054740285 8054734606 Bacteria 6947278
470 8055413971 8055412473 Bacteria 6257500
471 8056058578 8056054917 Bacteria 5736694
472 8057569726 8057568493 Bacteria 7221719
473 Ga0373931_0307584
474 LJQas_1009938
475 JGI25406J46586_10045279
476 JGI25406J46586_10054472
477 JGI25406J46586_10070373
478 rootH2_10107141
479 Ga0070658_11552145
480 Ga0070676_10039725
481 Ga0070683_100049181
482 Ga0068869_100032614
483 Ga0068869_101127989
484 Ga0070680_100111295
485 Ga0070680_100236011
486 Ga0070680_100421251
487 Ga0068868_100001291
488 Ga0070660_100012492
489 Ga0070689_101006213
490 Ga0070691_10372733
491 Ga0070687_100120407
492 Ga0070661_100026958
493 Ga0070668_100162484
494 Ga0070668_100165317
495 Ga0070668_100649479
496 Ga0070669_100429760
497 Ga0070675_100038452
498 Ga0070674_101244641
499 Ga0070673_100991622
500 Ga0070659_100011891
501 Ga0070659_100049975
502 Ga0070667_100067994
503 Ga0070667_100143341
504 Ga0070714_100694347
505 Ga0070713_100477783
506 Ga0070713_102166792
507 Ga0070700_100044444
508 Ga0070694_100474794
509 Ga0070708_100661554
510 Ga0070663_100130734
511 Ga0070663_100602676
512 Ga0070678_100792375
513 Ga0070678_100830283
514 Ga0070662_100342024
515 Ga0070681_11664964
516 Ga0070698_101122173
517 Ga0070679_100326804
518 Ga0070684_100002107
519 Ga0070684_100013293
520 Ga0070684_100024491
521 Ga0070684_101058456
522 Ga0070672_100173417
523 Ga0070672_100714359
524 Ga0070686_100473721
525 Ga0070693_100218538
526 Ga0070665_100043653
527 Ga0070665_101494596
528 Ga0068855_100525667
529 Ga0070664_100004626
530 Ga0070664_100094531
531 Ga0070664_100100962
532 Ga0070664_100103486
533 Ga0070664_101005654
534 Ga0068857_100046738
535 Ga0068857_100052154
536 Ga0068857_100225828
537 Ga0068857_100274456
538 Ga0070702_100034757
539 Ga0070702_100488036
540 Ga0068852_100257589
541 Ga0068852_100350822
542 Ga0068859_100117343
543 Ga0068859_100285543
544 Ga0068864_100042511
545 Ga0068864_100404620
546 Ga0068864_100441559
547 Ga0068866_10197627
548 Ga0068861_100489716
549 Ga0068861_100882636
550 Ga0068863_100065850
551 Ga0068863_100073639
552 Ga0068863_100147892
553 Ga0068863_101295455
554 Ga0068858_100198617
555 Ga0068860_100445742
556 Ga0068862_100158618
557 Ga0068862_100314837
558 Ga0068862_100330665
559 Ga0081540_1000693
560 Ga0081540_1016358
561 Ga0081540_1019268
562 Ga0081539_10000213
563 Ga0081539_10001793
564 Ga0081539_10007110
565 Ga0081539_10007156
566 Ga0081539_10018986
567 Ga0070717_10404446
568 Ga0070712_100287268
569 Ga0097621_101237766
570 Ga0068871_100963435
571 Ga0075428_100001119
572 Ga0075428_100003093
573 Ga0075428_100040143
574 Ga0075428_100054376
575 Ga0075428_100256253
576 Ga0075428_100409492
577 Ga0075428_100804509
578 Ga0075428_101037715
579 Ga0075430_100016105
580 Ga0075430_100094058
581 Ga0075430_100217889
582 Ga0075430_100315035
583 Ga0075430_100802111
584 Ga0075431_100040847
585 Ga0075431_100158822
586 Ga0075431_100263745
587 Ga0075431_100407503
588 Ga0075431_100657012
589 Ga0075433_10759223
590 Ga0075429_100018479
591 Ga0075429_100021226
592 Ga0075429_100512621
593 Ga0075429_101194781
594 Ga0097620_100117351
595 Ga0097620_100285538
596 Ga0105251_10108207
597 Ga0111539_10022434
598 Ga0111539_10864020
599 Ga0111539_10894112
600 Ga0111539_12335523
601 Ga0105245_10037581
602 Ga0114129_10000544
603 Ga0114129_10002321
604 Ga0114129_10034979
605 Ga0114129_10070977
606 Ga0114129_10235560
607 Ga0114129_10237851
608 Ga0114129_11177306
609 Ga0105243_11562430
610 Ga0105241_10787212
611 Ga0105248_10015227
612 Ga0105248_10092424
613 Ga0105248_10446217
614 Ga0105248_11233179
615 Ga0105237_10242405
616 Ga0105237_10682317
617 Ga0105238_11621223
618 Ga0105249_10085256
619 Ga0105239_10364842
620 Ga0105239_10380280
621 Ga0105239_11195788
622 Ga0105246_10514400
623 Ga0157369_10022871
624 Ga0157374_11242567
625 Ga0157378_11595562
626 Ga0163162_10583309
627 Ga0157372_10375923
628 Ga0163163_10150881
629 Ga0163163_11153259
630 Ga0157377_10016228
631 Ga0157377_10127051
632 Ga0157377_10257790
633 Ga0157379_10143085
634 Ga0157379_10554357
635 Ga0197907_10914371
636 Ga0206356_10849231
637 Ga0206349_1690891
638 Ga0206355_1623745
639 Ga0206352_10511523
640 Ga0206350_10933741
641 Ga0206354_11241192
642 Ga0206353_11816468
643 Ga0154015_1198087
644 Ga0154015_1636708
645 Ga0224712_10040316
646 Ga0224712_10584991
647 Ga0207684_10547767
648 Ga0207707_10095780
649 Ga0207671_10230373
650 Ga0207693_10080607
651 Ga0207660_10057059
652 Ga0207660_10551016
653 Ga0207662_10217655
654 Ga0207657_10181818
655 Ga0207657_10449809
656 Ga0207649_10109732
657 Ga0207652_10069294
658 Ga0207652_10456581
659 Ga0207681_10528984
660 Ga0207681_11554218
661 Ga0207694_10104243
662 Ga0207650_11083382
663 Ga0207659_10032671
664 Ga0207700_10535181
665 Ga0207700_11580070
666 Ga0207664_10080981
667 Ga0207690_10010008
668 Ga0207690_10111614
669 Ga0207690_10953447
670 Ga0207706_10149465
671 Ga0207669_10733333
672 Ga0207665_10831423
673 Ga0207691_10441053
674 Ga0207711_10717965
675 Ga0207711_10806190
676 Ga0207689_10025844
677 Ga0207689_10985080
678 Ga0207661_10001872
679 Ga0207661_10010221
680 Ga0207661_10627754
681 Ga0207679_10051634
682 Ga0207679_10668776
683 Ga0207667_10686137
684 Ga0207651_10997184
685 Ga0207712_10284539
686 Ga0207668_10004296
687 Ga0207668_10043699
688 Ga0207668_10108001
689 Ga0207668_10632653
690 Ga0207658_10341049
691 Ga0207677_10047665
692 Ga0207703_10411727
693 Ga0207703_11066677
694 Ga0207703_11472414
695 Ga0207678_10153478
696 Ga0207678_10195312
697 Ga0207678_10594476
698 Ga0207708_10066403
699 Ga0207702_10283021
700 Ga0207702_10333276
701 Ga0207641_10042166
702 Ga0207641_10288160
703 Ga0207641_10435023
704 Ga0207641_11277884
705 Ga0207641_11317812
706 Ga0207676_10236887
707 Ga0207676_10719725
708 Ga0207676_10737450
709 Ga0207674_10026088
710 Ga0207674_10046541
711 Ga0207674_10074314
712 Ga0207674_10089853
713 Ga0207674_10419921
714 Ga0207674_10630396
715 Ga0207674_10659405
716 Ga0207675_100511542
717 Ga0207675_100695152
718 Ga0207683_10094949
719 Ga0207698_10085604
720 Ga0207698_10759120
721 Ga0207428_10036326
722 Ga0268266_10061186
723 Ga0268266_10289654
724 Ga0268266_10378129
725 Ga0268265_10161780
726 Ga0268265_10196290
727 Ga0268265_10225403
728 Ga0268265_10229957
729 Ga0268264_10084301
730 Ga0268264_11338751
731 Ga0307517_10033811
732 Ga0307515_10001363
733 Ga0307515_10010013
734 Ga0307515_10051405
735 Ga0307511_10216545
736 Ga0307512_10020029
737 Ga0316177_1194607
738 Ga0316181_1263731
739 Ga0316182_1211122
740 Ga0307513_10018095
741 Ga0307513_10048536
742 Ga0307509_10011938
743 Ga0307509_10177935
744 Ga0307408_100011801
745 Ga0307508_10004259
746 Ga0307508_10013606
747 Ga0307508_10029730
748 Ga0307508_10078040
749 Ga0307514_10407289
750 Ga0307514_10424135
751 Ga0307516_10027383
752 Ga0307405_10037303
753 Ga0307405_10315476
754 Ga0307405_11410550
755 Ga0307413_10008177
756 Ga0307413_10168603
757 Ga0307413_10793527
758 Ga0307518_10115806
759 Ga0307410_10031107
760 Ga0307410_10069450
761 Ga0307410_10953251
762 Ga0326468_10001845
763 Ga0307406_10002065
764 Ga0307406_10004429
765 Ga0307406_10497201
766 Ga0307406_11180924
767 Ga0307407_10143938
768 Ga0307407_10752503
769 Ga0307409_100049923
770 Ga0307409_100092190
771 Ga0307409_101023642
772 Ga0307416_100013327
773 Ga0307416_100344255
774 Ga0307416_100345785
775 Ga0307416_100464789
776 Ga0307415_100004987
777 Ga0307415_100047418
778 Ga0307415_100054684
779 Ga0307415_100358556
780 Ga0307415_100695779
781 Ga0307415_100697488
782 Ga0307415_101045725
783 Ga0307507_10033471
784 Ga0373939_0172118
785 Ga0373941_0011945
786 Ga0373943_0086646
787 Ga0373942_0012982
788 Ga0373962_0148708
789 Ga0373924_0035336
790 Ga0373935_0007925
791 Ga0373933_0391103
792 Ga0373947_0920886
793 Ga0373925_0114052
794 Ga0395899_0025039
795 Ga0395900_0232037
796 Ga0395898_0007503
797 Ga0395905_0021450
798 Ga0395905_0715279
799 Ga0395905_1062827
800 Ga0395901_0014954
801 Ga0395901_0051896
802 Ga0436365_1223630
803 Ga0439436_0014432
804 Ga0439438_081214
805 Ga0439439_0233600
806 Ga0451791_1267938
807 Ga0451843_1074442
808 Ga0451843_1541869
809 Ga0451853_0235382
810 Ga0439442_015027
811 Ga0439449_0002742
812 Ga0439449_0031267
813 Ga0466957_0006912
814 Ga0495629_0206139
815 Ga0495580_0487527
816 Ga0495594_0169468
817 Ga0495594_0217486
818 Ga0495606_0002032
819 Ga0495668_0000182
820 Ga0495625_0002539
821 Ga0495672_0123161
822 Ga0495593_0031162
823 Ga0495626_0000113
824 Ga0496104_0092920
825 Ga0496104_0312773
826 Ga0496105_0231471
827 Ga0496108_0000016
828 Ga0496108_0002361
829 Ga0496109_0005119
830 Ga0496110_0022604
831 Ga0496111_0260694
832 Ga0496112_0028057
833 Ga0496112_0306369
834 Ga0496112_0344427
835 Ga0496112_0654773
836 Ga0496113_0098025
837 Ga0501032_0049731
838 Ga0501034_1134260
839 Ga0501036_0147701
840 Ga0501036_1066888
841 Ga0501038_0100251
842 Ga0501046_0067432
843 Ga0501047_0012045
844 Ga0501047_0579941
845 Ga0501070_0591435
846 Ga0501073_0317617
847 Ga0501074_0025225
848 Ga0501076_0545650
849 Ga0501044_0082889
850 Ga0501044_0964996
851 nmdc:mga0yw44_762745_c1
852 nmdc:mga05p37_133886_c1
853 nmdc:mga05p37_154_c1
854 nmdc:mga05p37_2233_c1
855 nmdc:mga05p37_26410_c1
856 nmdc:mga05p37_381180_c1
857 nmdc:mga09592_1053881_c1
858 nmdc:mga09592_268528_c1
859 nmdc:mga09592_35649_c1
860 nmdc:mga09592_36_c3
861 nmdc:mga09592_933978_c1
862 nmdc:mga09592_98401_c1
863 nmdc:mga0qj67_1029_c1
864 nmdc:mga0qj67_16665_c1
865 nmdc:mga0qj67_42513_c1
866 nmdc:mga0qj67_42_c1
867 nmdc:mga0qj67_461341_c1
868 nmdc:mga0qj67_723046_c1
869 nmdc:mga06r32_42_c2
870 nmdc:mga06r32_44559_c1
871 nmdc:mga06r32_550736_c1
872 nmdc:mga06r32_82602_c1
873 nmdc:mga08y16_1559582_c1
874 nmdc:mga08y16_22301_c1
875 nmdc:mga08y16_690931_c1
876 Ga0495619_0004111
877 Ga0500644_0032248
878 Ga0500646_0000139
879 Ga0500646_0034340
880 Ga0500583_0122858
881 Ga0500583_0396009
882 Ga0500651_0215670
883 Ga0500641_0011244
884 Ga0500641_0073347
885 Ga0500650_0130446
886 Ga0500654_065157
887 Ga0500660_089784
888 Ga0500562_107955
889 Ga0500569_146509
890 Ga0500594_0000685
891 Ga0500652_039342
892 Ga0500577_0333187
893 Ga0500588_0006392
894 Ga0500588_0080439
895 Ga0500630_130303
896 Ga0587066_139105
897 2515493713
898 2515720532
899 2515755102
900 2516084099
901 2516087755
902 2623586686
903 2753265375
904 2772641885
905 2831938795
906 2832006664
907 2855671517
908 2855680583
909 2855688487
910 2856860605
911 2857292214
912 2857484149
913 2858853405
914 2858869338
915 2858883630
916 2858890527
917 2858901156
918 2858907619
919 2861524682
920 2866067256
921 2867304044
922 2867313111
923 2867325965
924 2867509546
925 2869048622
926 2869065072
927 2869070345
928 2880493509
929 2880498800
930 2887484055
931 2902586136
932 2929220803
933 2929227379
934 2996227109
935 649811340
936 8003832604
937 8003862368
938 8003871464
939 8054707043
940 8054727615
941 8054740285
942 8055413971
943 8056058578
944 8057569726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

30

99

0.98

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

102

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d8s-assembly1.cif.gz_C-2 2.55a resolution structure of bfrb (e85a) from pseudomonas aeruginosa 0.9267 18 76
5d8q-assembly1.cif.gz_E 2.20a resolution structure of bfrb (l68a) from pseudomonas aeruginosa 0.9236 18 76
5d8x-assembly1.cif.gz_O 1.50a resolution structure of bfrb (l68a e81a) from pseudomonas aeruginosa 0.923 18 76
4tod-assembly1.cif.gz_W 2.05a resolution structure of bfrb (d34f) from pseudomonas aeruginosa 0.9212 18 76
4to9-assembly1.cif.gz_F 2.0a resolution structure of bfrb (n148l) from pseudomonas aeruginosa 0.9191 18 76
ID Description Score Start End Superfamily
af_P9WMT9_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9661 10 81 1.10.287.180
af_P9WMT9_79_159_3.10.50.30 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.9402 83 160 3.10.50.30
af_P9WMT9_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9163 10 81 1.10.287.180
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9101 10 80 1.10.287.180
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.909 9 80 1.10.287.180
ID Description Score Start End GO Terms
AF-A0A7K1FFI9-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9595 7 167 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A7K1FFI9-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.948 7 167 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-E3ITI8-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9389 8 166 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A6J6IP27-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9388 6 167 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A4V2S773-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9326 3 167 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063

Map