F450810

General Info

Members Datasets Scaffolds Average Seq Length
472 208 456 194

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10018871|Ga0163161_100188715
Length 210
Sequence MRYSKKMRLERFVEPYSTDYTGTLVTTRLFRLLALLLMLACTMPRAHAADMVEITRAYIESSEEGYKLAATYSFELNHDLDDAVQHGVPLFFTTEIELTRPRWYWFDEKAIVARQTSRLSYNVLTRQYHVSGGGLQQSFATLDDALFLIRRPSRWLVARRGELKVGQTYNVTLRMGMDRDYLPKPIQVNAFNNSDWRLASNKKTFLYTAE

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2738541297 Duganella sp. GV083 Isolate Unclassified
6 2738541357 Duganella sp. GV053 Isolate Unclassified
7 2738543003 Duganella sp. GV066 Isolate Unclassified
8 2738543026 Duganella sp. GV089 Isolate Unclassified
9 2738543029 Duganella sp. GV039 Isolate Unclassified
10 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
11 2818991436 Collimonas arenae 515 Isolate Unclassified
12 2821131069 Duganella sp. 1224 Isolate Unclassified
13 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
14 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
15 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
16 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
89 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
90 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
91 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
100 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
101 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
200 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
201 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
206 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
207 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.37
Nodule 0.21
Rhizoplane 1.06
Rhizosphere 76.48
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000040 3300002737 Bacteria 175938
2 JGI25152J39213_1003345 3300002773 Bacteria 5512
3 JGI25150J39212_1006172 3300002774 Bacteria 2496
4 JGI25159J45721_1006306 3300002987 Bacteria 3570
5 JGI25159J45721_1009296 3300002987 Bacteria 2604
6 JGI25159J45721_1009302 3300002987 Bacteria 2603
7 JGI25165J46597_1000051 3300003214 Bacteria 241012
8 JGI25160J50197_1000548 3300003354 Bacteria 21264
9 JGI25161J50226_1002570 3300003374 Bacteria 4575
10 JGI25161J50226_1003959 3300003374 Bacteria 3218
11 Ga0055538_1000025 3300003751 Bacteria 241012
12 Ga0055539_1000032 3300003752 Bacteria 241012
13 Ga0055533_1000042 3300003756 Bacteria 241012
14 Ga0055525_1000050 3300003759 Bacteria 241012
15 Ga0055526_1011051 3300003771 Bacteria 4120
16 Ga0055526_1011131 3300003771 Bacteria 4096
17 Ga0055537_1000172 3300003773 Bacteria 48382
18 Ga0055537_1012211 3300003773 Bacteria 1689
19 Ga0055524_1001210 3300003775 Bacteria 15311
20 Ga0055524_1006087 3300003775 Bacteria 5282
21 Ga0055524_1034151 3300003775 Bacteria 1412
22 Ga0055534_1000169 3300003784 Bacteria 48382
23 Ga0055534_1004001 3300003784 Bacteria 4423
24 Ga0055528_1000482 3300003790 Bacteria 31599
25 Ga0055528_1000486 3300003790 Bacteria 31484
26 Ga0055528_1005060 3300003790 Bacteria 6226
27 Ga0055530_10014837 3300003791 Bacteria 2574
28 Ga0055531_10008167 3300003794 Bacteria 5576
29 Ga0055541_1000023 3300003841 Bacteria 241012
30 Ga0055543_1005427 3300004625 Bacteria 3256
31 Ga0055543_1030296 3300004625 Bacteria 946
32 Ga0065165_1056903 3300005262 Bacteria 1085
33 Ga0070682_100095724 3300005337 Bacteria 1950
34 Ga0070660_100001210 3300005339 Bacteria 17514
35 Ga0070661_100008819 3300005344 Bacteria 6978
36 Ga0070659_100001642 3300005366 Bacteria 16115
37 Ga0070664_100083780 3300005564 Bacteria 2751
38 Ga0070717_10074351 3300006028 Bacteria 2840
39 Ga0105244_10024622 3300009036 Bacteria 3282
40 Ga0105250_10118080 3300009092 Bacteria 1089
41 Ga0105243_10106659 3300009148 Bacteria 2336
42 Ga0105242_10389115 3300009176 Bacteria 1298
43 Ga0105239_10835244 3300010375 Bacteria 1056
44 Ga0157371_10000153 3300013102 Bacteria 101298
45 Ga0182008_10000714 3300014497 Bacteria 23822
46 Ga0182008_10030062 3300014497 Bacteria 2740
47 Ga0182006_1000030 3300015261 Bacteria 242894
48 Ga0182006_1008553 3300015261 Bacteria 4638
49 Ga0182006_1025155 3300015261 Bacteria 2448
50 Ga0182007_10000037 3300015262 Bacteria 123677
51 Ga0182007_10003504 3300015262 Bacteria 7386
52 Ga0182007_10029112 3300015262 Bacteria 1892
53 Ga0182005_1000021 3300015265 Bacteria 272185
54 Ga0182005_1000072 3300015265 Bacteria 84500
55 Ga0163161_10018871 3300017792 Bacteria 4834
56 Ga0213872_10000065 3300021361 Bacteria 96648
57 Ga0213872_10000814 3300021361 Bacteria 22604
58 Ga0213872_10052768 3300021361 Bacteria 1844
59 Ga0209760_101495 3300025207 Bacteria 2438
60 Ga0209436_100389 3300025208 Bacteria 19875
61 Ga0209436_102679 3300025208 Bacteria 5166
62 Ga0209436_102691 3300025208 Bacteria 5140
63 Ga0209784_100010 3300025224 Bacteria 683664
64 Ga0209566_100008 3300025225 Bacteria 683664
65 Ga0209674_100019 3300025226 Bacteria 683664
66 Ga0209563_100021 3300025230 Bacteria 683764
67 Ga0207427_100412 3300025231 Bacteria 24713
68 Ga0209437_100019 3300025233 Bacteria 683764
69 Ga0207425_1000013 3300025245 Bacteria 497384
70 Ga0207425_1000152 3300025245 Bacteria 59354
71 Ga0207425_1010168 3300025245 Bacteria 2302
72 Ga0207425_1010508 3300025245 Bacteria 2251
73 Ga0209677_100011 3300025253 Bacteria 683664
74 Ga0209129_1000152 3300025258 Bacteria 112977
75 Ga0209129_1003996 3300025258 Bacteria 6066
76 Ga0209233_1000025 3300025261 Bacteria 683764
77 Ga0209565_1000159 3300025263 Bacteria 90295
78 Ga0209565_1000671 3300025263 Bacteria 21657
79 Ga0209565_1013856 3300025263 Bacteria 1872
80 Ga0209673_1000006 3300025273 Bacteria 650600
81 Ga0209673_1048627 3300025273 Bacteria 1140
82 Ga0209130_1000425 3300025284 Bacteria 45376
83 Ga0209130_1000499 3300025284 Bacteria 39996
84 Ga0209130_1001299 3300025284 Bacteria 17162
85 Ga0209675_1000005 3300025291 Bacteria 849192
86 Ga0209675_1001676 3300025291 Bacteria 12326
87 Ga0209025_1109666 3300025294 Bacteria 851
88 Ga0209564_1000028 3300025295 Bacteria 510986
89 Ga0209564_1000604 3300025295 Bacteria 56098
90 Ga0209564_1000634 3300025295 Bacteria 53519
91 Ga0209564_1002267 3300025295 Bacteria 15774
92 Ga0209758_1000031 3300025297 Bacteria 497252
93 Ga0209758_1000354 3300025297 Bacteria 83217
94 Ga0209050_1000525 3300025298 Bacteria 63749
95 Ga0209050_1000601 3300025298 Bacteria 57317
96 Ga0209050_1012832 3300025298 Bacteria 3794
97 Ga0209256_1000274 3300025299 Bacteria 90266
98 Ga0209256_1000414 3300025299 Bacteria 67073
99 Ga0209256_1000426 3300025299 Bacteria 66188
100 Ga0207426_1001125 3300025302 Bacteria 24348
101 Ga0207426_1026952 3300025302 Bacteria 1920
102 Ga0209051_1025440 3300025303 Bacteria 2409
103 Ga0209257_1000157 3300025304 Bacteria 181004
104 Ga0209257_1020499 3300025304 Bacteria 2441
105 Ga0207655_1004659 3300025728 Bacteria 9620
106 Ga0207684_11125724 3300025910 Bacteria 652
107 Ga0207657_10001197 3300025919 Bacteria 27574
108 Ga0207649_10006155 3300025920 Bacteria 6514
109 Ga0207690_10025335 3300025932 Bacteria 3722
110 Ga0207679_10074104 3300025945 Bacteria 2578
111 Ga0207641_10883051 3300026088 Bacteria 887
112 Ga0268265_10271353 3300028380 Bacteria 1513
113 Ga0316176_1115751 3300030732 Bacteria 1107
114 Ga0316178_1005495 3300030735 Bacteria 1443
115 Ga0316180_1100836 3300030736 Bacteria 1640
116 Ga0316182_1004325 3300030745 Bacteria 2794
117 Ga0307408_100000610 3300031548 Bacteria 30592
118 Ga0307408_100238094 3300031548 Bacteria 1494
119 Ga0307416_101471963 3300032002 Bacteria 787
120 Ga0307414_10031274 3300032004 Bacteria 3489
121 Ga0395899_0001494 3300037312 Bacteria 19857
122 Ga0395900_0069150 3300037418 Bacteria 3629
123 Ga0395901_0514138 3300038443 Bacteria 1217
124 Ga0436361_0304675 3300039447 Bacteria 999
125 Ga0436361_0537295 3300039447 Bacteria 22640
126 Ga0436361_0620883 3300039447 Bacteria 4484
127 Ga0436361_0900144 3300039447 Bacteria 143515
128 Ga0450897_005987 3300042128 Bacteria 1073
129 Ga0450898_028085 3300042134 Bacteria 1021
130 Ga0450906_007389 3300042145 Bacteria 2171
131 Ga0439446_0052955 3300042156 Bacteria 1215
132 Ga0439464_0041381 3300042439 Bacteria 1314
133 Ga0466969_0231399 3300044656 Bacteria 839
134 Ga0466972_0045763 3300044658 Bacteria 2120
135 Ga0466965_0168484 3300044683 Bacteria 1151
136 Ga0466966_0015317 3300044684 Bacteria 5070
137 Ga0466971_0006347 3300044719 Bacteria 5134
138 Ga0466968_0295300 3300044735 Bacteria 778
139 Ga0466970_0011751 3300044765 Bacteria 4467
140 Ga0466970_0111489 3300044765 Bacteria 1494
141 Ga0466957_0098408 3300044842 Bacteria 1841
142 Ga0466959_0009707 3300045049 Bacteria 6853
143 Ga0466959_0029881 3300045049 Bacteria 4036
144 Ga0495617_000011 3300046452 Bacteria 301936
145 Ga0495617_000610 3300046452 Bacteria 17970
146 Ga0495617_144193 3300046452 Bacteria 759
147 Ga0495592_0021604 3300046454 Bacteria 4896
148 Ga0495603_0219753 3300046455 Bacteria 1096
149 Ga0495590_0000144 3300046457 Bacteria 43127
150 Ga0495591_000444 3300046458 Bacteria 33698
151 Ga0495638_0000354 3300046460 Bacteria 57368
152 Ga0495638_0030351 3300046460 Bacteria 3481
153 Ga0495651_0008878 3300046462 Bacteria 7718
154 Ga0495651_0047306 3300046462 Bacteria 3326
155 Ga0495653_0000102 3300046463 Bacteria 70205
156 Ga0495653_0013444 3300046463 Bacteria 6669
157 Ga0495650_0000248 3300046471 Bacteria 106527
158 Ga0495650_0000297 3300046471 Bacteria 90619
159 Ga0495650_0000774 3300046471 Bacteria 39438
160 Ga0495580_0349538 3300046472 Bacteria 1002
161 Ga0495605_0000614 3300046474 Bacteria 27775
162 Ga0495605_0123519 3300046474 Bacteria 1172
163 Ga0495584_0000013 3300046491 Bacteria 185735
164 Ga0495584_0000951 3300046491 Bacteria 18190
165 Ga0495584_0000972 3300046491 Bacteria 17980
166 Ga0495584_0005265 3300046491 Bacteria 6853
167 Ga0495584_0007060 3300046491 Bacteria 5869
168 Ga0495584_0009352 3300046491 Bacteria 5048
169 Ga0495584_0025508 3300046491 Bacteria 2997
170 Ga0495584_0070894 3300046491 Bacteria 1751
171 Ga0495584_0167591 3300046491 Bacteria 1116
172 Ga0495585_0000150 3300046492 Bacteria 75556
173 Ga0495585_0000380 3300046492 Bacteria 42602
174 Ga0495585_0001052 3300046492 Bacteria 22828
175 Ga0495585_0001910 3300046492 Bacteria 15650
176 Ga0495585_0002646 3300046492 Bacteria 12583
177 Ga0495585_0008106 3300046492 Bacteria 6384
178 Ga0495585_0009562 3300046492 Bacteria 5803
179 Ga0495585_0017175 3300046492 Bacteria 4185
180 Ga0495585_0027998 3300046492 Bacteria 3216
181 Ga0495585_0065342 3300046492 Bacteria 1993
182 Ga0495585_0068238 3300046492 Bacteria 1943
183 Ga0495585_0080881 3300046492 Bacteria 1760
184 Ga0495585_0080991 3300046492 Bacteria 1759
185 Ga0495585_0081502 3300046492 Bacteria 1753
186 Ga0495585_0090961 3300046492 Bacteria 1643
187 Ga0495594_0263455 3300046499 Bacteria 982
188 Ga0495596_0001746 3300046500 Bacteria 12188
189 Ga0495596_0004637 3300046500 Bacteria 6651
190 Ga0495596_0010788 3300046500 Bacteria 3965
191 Ga0495607_0001581 3300046501 Bacteria 19837
192 Ga0495607_0002900 3300046501 Bacteria 13528
193 Ga0495607_0060114 3300046501 Bacteria 2164
194 Ga0495607_0075448 3300046501 Bacteria 1868
195 Ga0495607_0163423 3300046501 Bacteria 1129
196 Ga0495607_0229730 3300046501 Bacteria 903
197 Ga0495583_0000063 3300046506 Bacteria 194362
198 Ga0495583_0000161 3300046506 Bacteria 113144
199 Ga0495583_0004590 3300046506 Bacteria 9795
200 Ga0495583_0019188 3300046506 Bacteria 3575
201 Ga0495583_0043404 3300046506 Bacteria 2094
202 Ga0495583_0055124 3300046506 Bacteria 1797
203 Ga0495583_0103160 3300046506 Bacteria 1215
204 Ga0495583_0229844 3300046506 Bacteria 748
205 Ga0495606_0000169 3300046507 Bacteria 115434
206 Ga0495606_0000187 3300046507 Bacteria 108140
207 Ga0495606_0000609 3300046507 Bacteria 56606
208 Ga0495606_0001166 3300046507 Bacteria 37155
209 Ga0495606_0008871 3300046507 Bacteria 8616
210 Ga0495606_0014338 3300046507 Bacteria 6196
211 Ga0495606_0068189 3300046507 Bacteria 2251
212 Ga0495606_0099901 3300046507 Bacteria 1768
213 Ga0495608_0009162 3300046511 Bacteria 6919
214 Ga0495608_0044437 3300046511 Bacteria 2965
215 Ga0495610_0000007 3300046512 Bacteria 820919
216 Ga0495610_0001852 3300046512 Bacteria 18334
217 Ga0495610_0005691 3300046512 Bacteria 8783
218 Ga0495610_0018225 3300046512 Bacteria 3973
219 Ga0495610_0047024 3300046512 Bacteria 2124
220 Ga0495610_0061057 3300046512 Bacteria 1792
221 Ga0495616_0003244 3300046513 Bacteria 10465
222 Ga0495616_0004083 3300046513 Bacteria 9264
223 Ga0495616_0013248 3300046513 Bacteria 4659
224 Ga0495616_0046100 3300046513 Bacteria 2202
225 Ga0495616_0087793 3300046513 Bacteria 1477
226 Ga0495616_0097436 3300046513 Bacteria 1383
227 Ga0495616_0188876 3300046513 Bacteria 911
228 Ga0495616_0299364 3300046513 Bacteria 679
229 Ga0495616_0306386 3300046513 Bacteria 670
230 Ga0495620_0008670 3300046515 Bacteria 5449
231 Ga0495628_0000518 3300046516 Bacteria 35375
232 Ga0495628_0030073 3300046516 Bacteria 4400
233 Ga0495628_0332109 3300046516 Bacteria 1120
234 Ga0495631_0001381 3300046518 Bacteria 14767
235 Ga0495631_0025194 3300046518 Bacteria 2741
236 Ga0495632_0052558 3300046519 Bacteria 2003
237 Ga0495632_0250472 3300046519 Bacteria 794
238 Ga0495637_0000029 3300046520 Bacteria 143929
239 Ga0495637_0008278 3300046520 Bacteria 5113
240 Ga0495637_0027432 3300046520 Bacteria 2548
241 Ga0495643_0000245 3300046522 Bacteria 80531
242 Ga0495643_0011207 3300046522 Bacteria 5477
243 Ga0495643_0013463 3300046522 Bacteria 4891
244 Ga0495644_0001369 3300046523 Bacteria 9947
245 Ga0495644_0002162 3300046523 Bacteria 7892
246 Ga0495644_0003558 3300046523 Bacteria 6152
247 Ga0495644_0003635 3300046523 Bacteria 6075
248 Ga0495648_0000047 3300046524 Bacteria 166756
249 Ga0495648_0001788 3300046524 Bacteria 20676
250 Ga0495648_0089851 3300046524 Bacteria 1723
251 Ga0495648_0135528 3300046524 Bacteria 1303
252 Ga0495648_0142324 3300046524 Bacteria 1260
253 Ga0495648_0173346 3300046524 Bacteria 1103
254 Ga0495648_0183496 3300046524 Bacteria 1062
255 Ga0495663_0005806 3300046525 Bacteria 3416
256 Ga0495642_0005188 3300046528 Bacteria 5012
257 Ga0495642_0008089 3300046528 Bacteria 4024
258 Ga0495642_0016058 3300046528 Bacteria 2914
259 Ga0495642_0019020 3300046528 Bacteria 2689
260 Ga0495642_0057673 3300046528 Bacteria 1606
261 Ga0495652_0247256 3300046529 Bacteria 1323
262 Ga0495652_0274786 3300046529 Bacteria 1236
263 Ga0495654_0003005 3300046530 Bacteria 10534
264 Ga0495654_0005817 3300046530 Bacteria 7105
265 Ga0495609_0001074 3300046538 Bacteria 19093
266 Ga0495609_0001607 3300046538 Bacteria 14766
267 Ga0495609_0012484 3300046538 Bacteria 4030
268 Ga0495609_0034302 3300046538 Bacteria 2301
269 Ga0495609_0129676 3300046538 Bacteria 1080
270 Ga0495597_0003595 3300046542 Bacteria 8923
271 Ga0495597_0031172 3300046542 Bacteria 2427
272 Ga0495597_0052525 3300046542 Bacteria 1794
273 Ga0495597_0056410 3300046542 Bacteria 1720
274 Ga0495597_0184056 3300046542 Bacteria 843
275 Ga0495645_0030000 3300046543 Bacteria 3961
276 Ga0495645_0083955 3300046543 Bacteria 2282
277 Ga0495622_0000500 3300046557 Bacteria 24597
278 Ga0495622_0017632 3300046557 Bacteria 3324
279 Ga0495622_0017664 3300046557 Bacteria 3321
280 Ga0495633_0000465 3300046558 Bacteria 41465
281 Ga0495633_0000942 3300046558 Bacteria 24395
282 Ga0495633_0004871 3300046558 Bacteria 8395
283 Ga0495633_0006236 3300046558 Bacteria 7119
284 Ga0495633_0007939 3300046558 Bacteria 6048
285 Ga0495633_0016956 3300046558 Bacteria 3736
286 Ga0495633_0019974 3300046558 Bacteria 3378
287 Ga0495633_0036747 3300046558 Bacteria 2345
288 Ga0495633_0040334 3300046558 Bacteria 2225
289 Ga0495633_0071097 3300046558 Bacteria 1623
290 Ga0495633_0158659 3300046558 Bacteria 1044
291 Ga0495633_0179957 3300046558 Bacteria 973
292 Ga0495656_0018702 3300046615 Bacteria 2666
293 Ga0495656_0050354 3300046615 Bacteria 1778
294 Ga0495656_0054003 3300046615 Bacteria 1727
295 Ga0495656_0089033 3300046615 Bacteria 1408
296 Ga0495668_0000219 3300046616 Bacteria 83081
297 Ga0495668_0006876 3300046616 Bacteria 7374
298 Ga0495668_0012594 3300046616 Bacteria 5014
299 Ga0495668_0018565 3300046616 Bacteria 4018
300 Ga0495668_0105237 3300046616 Bacteria 1543
301 Ga0495611_0000336 3300046648 Bacteria 30672
302 Ga0495611_0004973 3300046648 Bacteria 5690
303 Ga0495611_0024173 3300046648 Bacteria 2641
304 Ga0495611_0048085 3300046648 Bacteria 1916
305 Ga0495611_0092999 3300046648 Bacteria 1394
306 Ga0495611_0101148 3300046648 Bacteria 1338
307 Ga0495611_0213975 3300046648 Bacteria 897
308 Ga0495611_0222592 3300046648 Bacteria 878
309 Ga0495625_0002389 3300046660 Bacteria 20388
310 Ga0495625_0008548 3300046660 Bacteria 8713
311 Ga0495625_0041651 3300046660 Bacteria 3341
312 Ga0495625_0314274 3300046660 Bacteria 999
313 Ga0495625_0387717 3300046660 Bacteria 875
314 Ga0495659_0000010 3300046664 Bacteria 87574
315 Ga0495659_0000622 3300046664 Bacteria 12979
316 Ga0495659_0023115 3300046664 Bacteria 2109
317 Ga0495659_0029421 3300046664 Bacteria 1907
318 Ga0495659_0030023 3300046664 Bacteria 1889
319 Ga0495661_0012598 3300046665 Bacteria 5708
320 Ga0495661_0041194 3300046665 Bacteria 2859
321 Ga0495661_0041445 3300046665 Bacteria 2848
322 Ga0495661_0058192 3300046665 Bacteria 2304
323 Ga0495661_0071470 3300046665 Bacteria 2028
324 Ga0495661_0095202 3300046665 Bacteria 1686
325 Ga0495661_0120556 3300046665 Bacteria 1449
326 Ga0495661_0284653 3300046665 Bacteria 832
327 Ga0495657_0157013 3300046675 Bacteria 1409
328 Ga0495623_0024186 3300046679 Bacteria 3917
329 Ga0495623_0099868 3300046679 Bacteria 1769
330 Ga0495623_0153140 3300046679 Bacteria 1361
331 Ga0495623_0274825 3300046679 Bacteria 939
332 Ga0495646_0005978 3300046680 Bacteria 7713
333 Ga0495658_0032942 3300046683 Bacteria 2834
334 Ga0495669_0000240 3300046684 Bacteria 32062
335 Ga0495669_0069128 3300046684 Bacteria 1607
336 Ga0495669_0153059 3300046684 Bacteria 1092
337 Ga0495624_0008507 3300046690 Bacteria 7149
338 Ga0495624_0447147 3300046690 Bacteria 774
339 Ga0495670_0002543 3300046691 Bacteria 9010
340 Ga0495670_0005258 3300046691 Bacteria 6369
341 Ga0495670_0015736 3300046691 Bacteria 3718
342 Ga0495670_0026304 3300046691 Bacteria 2879
343 Ga0495671_0006611 3300046692 Bacteria 6684
344 Ga0495671_0081898 3300046692 Bacteria 1581
345 Ga0495671_0146356 3300046692 Bacteria 1150
346 Ga0495671_0240331 3300046692 Bacteria 875
347 Ga0495649_0000644 3300046694 Bacteria 28394
348 Ga0495649_0021823 3300046694 Bacteria 3587
349 Ga0495649_0067622 3300046694 Bacteria 1917
350 Ga0495649_0095924 3300046694 Bacteria 1578
351 Ga0495649_0148672 3300046694 Bacteria 1231
352 Ga0495649_0204350 3300046694 Bacteria 1025
353 Ga0495589_0043683 3300046794 Bacteria 2229
354 Ga0495589_0087253 3300046794 Bacteria 1515
355 Ga0495589_0096064 3300046794 Bacteria 1437
356 Ga0495589_0103220 3300046794 Bacteria 1378
357 Ga0495600_0002933 3300046809 Bacteria 9942
358 Ga0495660_0000301 3300046810 Bacteria 44739
359 Ga0495660_0005048 3300046810 Bacteria 7929
360 Ga0495660_0082169 3300046810 Bacteria 1687
361 Ga0495660_0172372 3300046810 Bacteria 1053
362 Ga0495660_0254588 3300046810 Bacteria 813
363 Ga0495660_0275097 3300046810 Bacteria 772
364 Ga0495604_0033720 3300047317 Bacteria 4052
365 Ga0495604_0038065 3300047317 Bacteria 3785
366 Ga0495636_0000972 3300047318 Bacteria 10710
367 Ga0495636_0001072 3300047318 Bacteria 10285
368 Ga0495636_0003350 3300047318 Bacteria 6212
369 Ga0495636_0013465 3300047318 Bacteria 3246
370 Ga0495674_0009868 3300047319 Bacteria 9064
371 Ga0495672_0000107 3300047320 Bacteria 132267
372 Ga0495672_0000286 3300047320 Bacteria 70060
373 Ga0495672_0001423 3300047320 Bacteria 23535
374 Ga0495672_0021487 3300047320 Bacteria 4209
375 Ga0495672_0061347 3300047320 Bacteria 2167
376 Ga0495676_0051226 3300047321 Bacteria 3305
377 Ga0495676_0270825 3300047321 Bacteria 1152
378 Ga0495683_0000221 3300047323 Bacteria 53874
379 Ga0495683_0000559 3300047323 Bacteria 28050
380 Ga0495683_0002939 3300047323 Bacteria 10088
381 Ga0495683_0017250 3300047323 Bacteria 3744
382 Ga0495683_0032142 3300047323 Bacteria 2673
383 Ga0495683_0035014 3300047323 Bacteria 2552
384 Ga0495683_0056906 3300047323 Bacteria 1944
385 Ga0495683_0072905 3300047323 Bacteria 1684
386 Ga0495683_0235625 3300047323 Bacteria 809
387 Ga0495687_000562 3300047443 Bacteria 43714
388 Ga0495687_025202 3300047443 Bacteria 2815
389 Ga0495687_121510 3300047443 Bacteria 941
390 Ga0495677_0002234 3300047445 Bacteria 7655
391 Ga0495677_0002665 3300047445 Bacteria 6978
392 Ga0495677_0009315 3300047445 Bacteria 3628
393 Ga0495677_0053058 3300047445 Bacteria 1494
394 Ga0495677_0064257 3300047445 Bacteria 1363
395 Ga0495679_023671 3300047446 Bacteria 2079
396 Ga0495679_095973 3300047446 Bacteria 827
397 Ga0495685_000128 3300047447 Bacteria 26198
398 Ga0495673_0000074 3300047469 Bacteria 210788
399 Ga0495673_0000173 3300047469 Bacteria 106086
400 Ga0495673_0005143 3300047469 Bacteria 7973
401 Ga0495673_0046547 3300047469 Bacteria 1921
402 Ga0495681_0024739 3300047470 Bacteria 3153
403 Ga0495681_0026128 3300047470 Bacteria 3047
404 Ga0495681_0032410 3300047470 Bacteria 2631
405 Ga0495681_0065391 3300047470 Bacteria 1663
406 Ga0495681_0090042 3300047470 Bacteria 1356
407 Ga0495681_0149660 3300047470 Bacteria 980
408 Ga0495686_0000387 3300047472 Bacteria 70185
409 Ga0495686_0001928 3300047472 Bacteria 20665
410 Ga0495686_0006559 3300047472 Bacteria 8878
411 Ga0495686_0023856 3300047472 Bacteria 4026
412 Ga0495686_0070510 3300047472 Bacteria 2153
413 Ga0495686_0102897 3300047472 Bacteria 1721
414 Ga0495686_0122998 3300047472 Bacteria 1544
415 Ga0495602_0121927 3300048088 Bacteria 2096
416 Ga0495626_0002890 3300048091 Bacteria 11448
417 Ga0495626_0003826 3300048091 Bacteria 9441
418 Ga0495626_0011604 3300048091 Bacteria 4652
419 Ga0495626_0034461 3300048091 Bacteria 2421
420 Ga0495626_0283591 3300048091 Bacteria 657
421 Ga0496102_0006728 3300048905 Bacteria 9818
422 Ga0496112_0346276 3300048915 Bacteria 1429
423 Ga0496115_0037637 3300048918 Bacteria 3835
424 Ga0496115_0047818 3300048918 Bacteria 3421
425 Ga0496116_0021813 3300048919 Bacteria 4818
426 Ga0496117_0000056 3300048920 Bacteria 271417
427 Ga0496118_0000047 3300048921 Bacteria 271417
428 Ga0496120_0125156 3300048923 Bacteria 1324
429 Ga0496121_0095068 3300048924 Bacteria 2317
430 Ga0496122_0002132 3300048925 Bacteria 29082
431 Ga0496122_0039705 3300048925 Bacteria 3750
432 Ga0496123_0003832 3300048926 Bacteria 16407
433 Ga0496123_0005661 3300048926 Bacteria 12477
434 Ga0496124_0106931 3300048927 Bacteria 2258
435 Ga0496125_0033215 3300048928 Bacteria 4571
436 Ga0496125_0371469 3300048928 Bacteria 846
437 Ga0495678_000146 3300049459 Bacteria 85995
438 Ga0495678_011440 3300049459 Bacteria 4248
439 Ga0495682_0001101 3300049460 Bacteria 15713
440 Ga0495682_0003502 3300049460 Bacteria 6974
441 Ga0495682_0008069 3300049460 Bacteria 4160
442 Ga0495682_0018475 3300049460 Bacteria 2625
443 Ga0495682_0049699 3300049460 Bacteria 1528
444 Ga0501034_0046646 3300049571 Bacteria 4378
445 Ga0501227_004587 3300049665 Bacteria 2969
446 Ga0501257_136225 3300049686 Bacteria 668
447 Ga0501279_000540 3300049775 Bacteria 4955
448 Ga0501279_001219 3300049775 Bacteria 3380
449 Ga0501279_003330 3300049775 Bacteria 2093
450 Ga0495601_0003431 3300053077 Bacteria 9081
451 Ga0495619_0301075 3300053085 Bacteria 1111
452 Ga0500595_000507 3300053119 Bacteria 23504
453 Ga0500574_011835 3300053141 Bacteria 1980
454 Ga0500586_001667 3300053145 Bacteria 4778
455 Ga0500619_000663 3300053154 Bacteria 5851
456 Ga0466962_0006586 3300061719 Bacteria 5573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2932410948 2932415098 168
2 iso_pu_bacteria 2932416698 2932421254 168
3 3300009176 Ga0105242_10389115 Ga0105242_103891152 172
4 3300046524 Ga0495648_0142324 Ga0495648_0142324_414_932 172
5 3300046491 Ga0495584_0007060 Ga0495584_0007060_1111_1635 174
6 3300046491 Ga0495584_0025508 Ga0495584_0025508_825_1349 174
7 3300046492 Ga0495585_0008106 Ga0495585_0008106_245_769 174
8 3300046492 Ga0495585_0080991 Ga0495585_0080991_1030_1554 174
9 3300046500 Ga0495596_0001746 Ga0495596_0001746_11332_11856 174
10 3300046501 Ga0495607_0060114 Ga0495607_0060114_333_857 174
11 3300046501 Ga0495607_0163423 Ga0495607_0163423_353_877 174
12 3300046513 Ga0495616_0046100 Ga0495616_0046100_1346_1870 174
13 3300046520 Ga0495637_0027432 Ga0495637_0027432_1386_1913 174
14 3300046525 Ga0495663_0005806 Ga0495663_0005806_734_1258 174
15 3300046558 Ga0495633_0004871 Ga0495633_0004871_6366_6890 174
16 3300046558 Ga0495633_0019974 Ga0495633_0019974_724_1248 174
17 3300046615 Ga0495656_0050354 Ga0495656_0050354_151_675 174
18 3300046648 Ga0495611_0101148 Ga0495611_0101148_81_605 174
19 3300046664 Ga0495659_0029421 Ga0495659_0029421_767_1291 174
20 3300046665 Ga0495661_0120556 Ga0495661_0120556_405_929 174
21 3300046679 Ga0495623_0099868 Ga0495623_0099868_675_1202 174
22 3300046684 Ga0495669_0069128 Ga0495669_0069128_353_877 174
23 3300046684 Ga0495669_0153059 Ga0495669_0153059_319_843 174
24 3300046794 Ga0495589_0103220 Ga0495589_0103220_348_872 174
25 3300046810 Ga0495660_0172372 Ga0495660_0172372_275_799 174
26 3300047318 Ga0495636_0001072 Ga0495636_0001072_4061_4585 174
27 3300047445 Ga0495677_0009315 Ga0495677_0009315_506_1030 174
28 3300047445 Ga0495677_0053058 Ga0495677_0053058_385_909 174
29 3300047472 Ga0495686_0023856 Ga0495686_0023856_2872_3396 174
30 3300025910 Ga0207684_11125724 Ga0207684_111257241 175
31 3300047470 Ga0495681_0065391 Ga0495681_0065391_494_1021 175
32 3300048091 Ga0495626_0003826 Ga0495626_0003826_2549_3076 175
33 3300025245 Ga0207425_1010508 Ga0207425_10105082 176
34 3300025294 Ga0209025_1109666 Ga0209025_11096662 176
35 3300025297 Ga0209758_1000354 Ga0209758_100035453 176
36 3300047472 Ga0495686_0000387 Ga0495686_0000387_43481_44017 176
37 3300021361 Ga0213872_10052768 Ga0213872_100527682 177
38 3300039447 Ga0436361_0620883 Ga0436361_0620883_1221_1757 177
39 3300042439 Ga0439464_0041381 Ga0439464_0041381_354_893 177
40 3300046460 Ga0495638_0030351 Ga0495638_0030351_1072_1614 177
41 3300046463 Ga0495653_0000102 Ga0495653_0000102_8119_8661 177
42 3300046471 Ga0495650_0000774 Ga0495650_0000774_8884_9426 177
43 3300046492 Ga0495585_0001910 Ga0495585_0001910_13266_13808 177
44 3300046507 Ga0495606_0000169 Ga0495606_0000169_21191_21733 177
45 3300046507 Ga0495606_0008871 Ga0495606_0008871_7041_7577 177
46 3300046524 Ga0495648_0173346 Ga0495648_0173346_224_766 177
47 3300046530 Ga0495654_0003005 Ga0495654_0003005_7507_8049 177
48 3300046557 Ga0495622_0000500 Ga0495622_0000500_8358_8894 177
49 3300046558 Ga0495633_0040334 Ga0495633_0040334_1107_1649 177
50 3300046616 Ga0495668_0018565 Ga0495668_0018565_3179_3721 177
51 3300046665 Ga0495661_0012598 Ga0495661_0012598_1092_1634 177
52 3300046694 Ga0495649_0021823 Ga0495649_0021823_1712_2251 177
53 3300046810 Ga0495660_0005048 Ga0495660_0005048_2862_3404 177
54 3300047323 Ga0495683_0035014 Ga0495683_0035014_1715_2257 177
55 3300048924 Ga0496121_0095068 Ga0496121_0095068_912_1454 177
56 3300049665 Ga0501227_004587 Ga0501227_004587_1997_2536 177
57 3300049775 Ga0501279_000540 Ga0501279_000540_3376_3915 177
58 3300049775 Ga0501279_001219 Ga0501279_001219_2482_3021 177
59 3300053145 Ga0500586_001667 Ga0500586_001667_3888_4430 177
60 3300009148 Ga0105243_10106659 Ga0105243_101066592 178
61 3300005339 Ga0070660_100001210 Ga0070660_10000121016 179
62 3300005344 Ga0070661_100008819 Ga0070661_1000088192 179
63 3300005366 Ga0070659_100001642 Ga0070659_10000164217 179
64 3300005564 Ga0070664_100083780 Ga0070664_1000837803 179
65 3300010375 Ga0105239_10835244 Ga0105239_108352442 179
66 3300025919 Ga0207657_10001197 Ga0207657_1000119725 179
67 3300025920 Ga0207649_10006155 Ga0207649_100061554 179
68 3300025932 Ga0207690_10025335 Ga0207690_100253351 179
69 3300025945 Ga0207679_10074104 Ga0207679_100741043 179
70 3300039447 Ga0436361_0304675 Ga0436361_0304675_386_928 179
71 iso_pu_bacteria 2600255292 2601671908 181
72 iso_pu_bacteria 2821131069 2821136147 181
73 3300048923 Ga0496120_0125156 Ga0496120_0125156_125_682 182
74 3300048926 Ga0496123_0003832 Ga0496123_0003832_2326_2883 182
75 3300049571 Ga0501034_0046646 Ga0501034_0046646_1873_2550 182
76 iso_pu_bacteria 2885080285 2885082330 182
77 3300042128 Ga0450897_005987 Ga0450897_005987_223_783 184
78 3300044735 Ga0466968_0295300 Ga0466968_0295300_28_606 184
79 iso_pu_bacteria 2643221603 2644029844 184
80 iso_pu_bacteria 2643221554 2643788944 185
81 iso_pu_bacteria 2643221638 2644213001 185
82 3300030736 Ga0316180_1100836 Ga0316180_11008362 186
83 3300030745 Ga0316182_1004325 Ga0316182_10043253 186
84 3300032004 Ga0307414_10031274 Ga0307414_100312743 186
85 3300046471 Ga0495650_0000248 Ga0495650_0000248_36014_36574 186
86 3300047323 Ga0495683_0017250 Ga0495683_0017250_1730_2290 186
87 3300030732 Ga0316176_1115751 Ga0316176_11157512 187
88 3300030735 Ga0316178_1005495 Ga0316178_10054952 187
89 3300032002 Ga0307416_101471963 Ga0307416_1014719632 187
90 3300042134 Ga0450898_028085 Ga0450898_028085_416_979 187
91 3300042145 Ga0450906_007389 Ga0450906_007389_687_1250 187
92 3300042156 Ga0439446_0052955 Ga0439446_0052955_470_1033 187
93 3300046452 Ga0495617_000610 Ga0495617_000610_8652_9215 187
94 3300046452 Ga0495617_144193 Ga0495617_144193_107_670 187
95 3300046455 Ga0495603_0219753 Ga0495603_0219753_422_985 187
96 3300046457 Ga0495590_0000144 Ga0495590_0000144_32863_33426 187
97 3300046458 Ga0495591_000444 Ga0495591_000444_32990_33553 187
98 3300046472 Ga0495580_0349538 Ga0495580_0349538_67_630 187
99 3300046474 Ga0495605_0123519 Ga0495605_0123519_46_609 187
100 3300046491 Ga0495584_0000013 Ga0495584_0000013_16265_16828 187
101 3300046491 Ga0495584_0000951 Ga0495584_0000951_4292_4855 187
102 3300046491 Ga0495584_0005265 Ga0495584_0005265_3791_4354 187
103 3300046491 Ga0495584_0070894 Ga0495584_0070894_754_1317 187
104 3300046491 Ga0495584_0167591 Ga0495584_0167591_534_1097 187
105 3300046492 Ga0495585_0000150 Ga0495585_0000150_28261_28824 187
106 3300046492 Ga0495585_0000380 Ga0495585_0000380_39144_39707 187
107 3300046492 Ga0495585_0001052 Ga0495585_0001052_20646_21209 187
108 3300046492 Ga0495585_0002646 Ga0495585_0002646_1878_2441 187
109 3300046492 Ga0495585_0009562 Ga0495585_0009562_1545_2108 187
110 3300046492 Ga0495585_0017175 Ga0495585_0017175_2830_3393 187
111 3300046492 Ga0495585_0027998 Ga0495585_0027998_1056_1619 187
112 3300046492 Ga0495585_0065342 Ga0495585_0065342_1186_1749 187
113 3300046492 Ga0495585_0068238 Ga0495585_0068238_1182_1745 187
114 3300046492 Ga0495585_0080881 Ga0495585_0080881_814_1377 187
115 3300046492 Ga0495585_0090961 Ga0495585_0090961_146_709 187
116 3300046499 Ga0495594_0263455 Ga0495594_0263455_271_834 187
117 3300046500 Ga0495596_0004637 Ga0495596_0004637_2053_2616 187
118 3300046500 Ga0495596_0010788 Ga0495596_0010788_2899_3462 187
119 3300046501 Ga0495607_0002900 Ga0495607_0002900_4659_5222 187
120 3300046501 Ga0495607_0229730 Ga0495607_0229730_287_850 187
121 3300046506 Ga0495583_0000161 Ga0495583_0000161_71148_71711 187
122 3300046506 Ga0495583_0004590 Ga0495583_0004590_2978_3541 187
123 3300046506 Ga0495583_0043404 Ga0495583_0043404_29_592 187
124 3300046506 Ga0495583_0055124 Ga0495583_0055124_696_1259 187
125 3300046506 Ga0495583_0103160 Ga0495583_0103160_589_1152 187
126 3300046506 Ga0495583_0229844 Ga0495583_0229844_155_718 187
127 3300046507 Ga0495606_0000609 Ga0495606_0000609_17782_18351 187
128 3300046507 Ga0495606_0068189 Ga0495606_0068189_1594_2157 187
129 3300046507 Ga0495606_0099901 Ga0495606_0099901_519_1082 187
130 3300046512 Ga0495610_0001852 Ga0495610_0001852_17107_17676 187
131 3300046512 Ga0495610_0005691 Ga0495610_0005691_7180_7743 187
132 3300046513 Ga0495616_0003244 Ga0495616_0003244_2606_3169 187
133 3300046513 Ga0495616_0013248 Ga0495616_0013248_2133_2696 187
134 3300046513 Ga0495616_0087793 Ga0495616_0087793_461_1024 187
135 3300046513 Ga0495616_0188876 Ga0495616_0188876_75_638 187
136 3300046513 Ga0495616_0299364 Ga0495616_0299364_20_583 187
137 3300046513 Ga0495616_0306386 Ga0495616_0306386_73_636 187
138 3300046515 Ga0495620_0008670 Ga0495620_0008670_2885_3448 187
139 3300046518 Ga0495631_0001381 Ga0495631_0001381_8485_9048 187
140 3300046518 Ga0495631_0025194 Ga0495631_0025194_1911_2474 187
141 3300046519 Ga0495632_0052558 Ga0495632_0052558_506_1069 187
142 3300046520 Ga0495637_0000029 Ga0495637_0000029_126523_127086 187
143 3300046522 Ga0495643_0011207 Ga0495643_0011207_2266_2829 187
144 3300046522 Ga0495643_0013463 Ga0495643_0013463_1296_1859 187
145 3300046523 Ga0495644_0002162 Ga0495644_0002162_1912_2475 187
146 3300046523 Ga0495644_0003635 Ga0495644_0003635_1658_2221 187
147 3300046524 Ga0495648_0000047 Ga0495648_0000047_14418_14981 187
148 3300046524 Ga0495648_0089851 Ga0495648_0089851_594_1157 187
149 3300046524 Ga0495648_0135528 Ga0495648_0135528_14_577 187
150 3300046528 Ga0495642_0008089 Ga0495642_0008089_2704_3267 187
151 3300046528 Ga0495642_0016058 Ga0495642_0016058_720_1283 187
152 3300046528 Ga0495642_0019020 Ga0495642_0019020_318_881 187
153 3300046528 Ga0495642_0057673 Ga0495642_0057673_765_1328 187
154 3300046538 Ga0495609_0001074 Ga0495609_0001074_17413_17976 187
155 3300046538 Ga0495609_0012484 Ga0495609_0012484_490_1053 187
156 3300046538 Ga0495609_0129676 Ga0495609_0129676_74_637 187
157 3300046542 Ga0495597_0003595 Ga0495597_0003595_7314_7877 187
158 3300046542 Ga0495597_0052525 Ga0495597_0052525_898_1461 187
159 3300046542 Ga0495597_0056410 Ga0495597_0056410_586_1149 187
160 3300046542 Ga0495597_0184056 Ga0495597_0184056_117_680 187
161 3300046557 Ga0495622_0017632 Ga0495622_0017632_2661_3224 187
162 3300046558 Ga0495633_0000942 Ga0495633_0000942_298_861 187
163 3300046558 Ga0495633_0006236 Ga0495633_0006236_3960_4523 187
164 3300046558 Ga0495633_0016956 Ga0495633_0016956_75_638 187
165 3300046558 Ga0495633_0158659 Ga0495633_0158659_205_768 187
166 3300046558 Ga0495633_0179957 Ga0495633_0179957_288_851 187
167 3300046615 Ga0495656_0018702 Ga0495656_0018702_454_1017 187
168 3300046615 Ga0495656_0089033 Ga0495656_0089033_667_1230 187
169 3300046616 Ga0495668_0006876 Ga0495668_0006876_5404_5967 187
170 3300046616 Ga0495668_0105237 Ga0495668_0105237_906_1469 187
171 3300046648 Ga0495611_0000336 Ga0495611_0000336_17032_17595 187
172 3300046648 Ga0495611_0004973 Ga0495611_0004973_2501_3064 187
173 3300046648 Ga0495611_0048085 Ga0495611_0048085_282_845 187
174 3300046648 Ga0495611_0092999 Ga0495611_0092999_70_633 187
175 3300046648 Ga0495611_0213975 Ga0495611_0213975_25_588 187
176 3300046660 Ga0495625_0314274 Ga0495625_0314274_115_678 187
177 3300046660 Ga0495625_0387717 Ga0495625_0387717_241_804 187
178 3300046664 Ga0495659_0030023 Ga0495659_0030023_275_838 187
179 3300046665 Ga0495661_0041445 Ga0495661_0041445_707_1270 187
180 3300046665 Ga0495661_0058192 Ga0495661_0058192_819_1382 187
181 3300046665 Ga0495661_0071470 Ga0495661_0071470_230_793 187
182 3300046665 Ga0495661_0095202 Ga0495661_0095202_504_1067 187
183 3300046665 Ga0495661_0284653 Ga0495661_0284653_40_603 187
184 3300046679 Ga0495623_0274825 Ga0495623_0274825_292_855 187
185 3300046691 Ga0495670_0002543 Ga0495670_0002543_8162_8725 187
186 3300046691 Ga0495670_0005258 Ga0495670_0005258_2153_2716 187
187 3300046691 Ga0495670_0015736 Ga0495670_0015736_2392_2955 187
188 3300046692 Ga0495671_0081898 Ga0495671_0081898_579_1142 187
189 3300046692 Ga0495671_0240331 Ga0495671_0240331_51_614 187
190 3300046694 Ga0495649_0000644 Ga0495649_0000644_16649_17212 187
191 3300046694 Ga0495649_0148672 Ga0495649_0148672_377_940 187
192 3300046694 Ga0495649_0204350 Ga0495649_0204350_196_759 187
193 3300046794 Ga0495589_0043683 Ga0495589_0043683_1484_2047 187
194 3300046810 Ga0495660_0082169 Ga0495660_0082169_807_1370 187
195 3300046810 Ga0495660_0275097 Ga0495660_0275097_98_661 187
196 3300047317 Ga0495604_0038065 Ga0495604_0038065_2145_2708 187
197 3300047318 Ga0495636_0003350 Ga0495636_0003350_1490_2053 187
198 3300047319 Ga0495674_0009868 Ga0495674_0009868_5366_5929 187
199 3300047320 Ga0495672_0001423 Ga0495672_0001423_284_847 187
200 3300047320 Ga0495672_0021487 Ga0495672_0021487_960_1523 187
201 3300047321 Ga0495676_0051226 Ga0495676_0051226_37_600 187
202 3300047321 Ga0495676_0270825 Ga0495676_0270825_144_707 187
203 3300047323 Ga0495683_0000221 Ga0495683_0000221_15892_16455 187
204 3300047323 Ga0495683_0000559 Ga0495683_0000559_12034_12597 187
205 3300047323 Ga0495683_0032142 Ga0495683_0032142_1883_2446 187
206 3300047323 Ga0495683_0056906 Ga0495683_0056906_405_968 187
207 3300047323 Ga0495683_0072905 Ga0495683_0072905_281_844 187
208 3300047323 Ga0495683_0235625 Ga0495683_0235625_191_754 187
209 3300047443 Ga0495687_121510 Ga0495687_121510_129_692 187
210 3300047445 Ga0495677_0064257 Ga0495677_0064257_105_668 187
211 3300047446 Ga0495679_023671 Ga0495679_023671_1206_1769 187
212 3300047446 Ga0495679_095973 Ga0495679_095973_164_727 187
213 3300047469 Ga0495673_0046547 Ga0495673_0046547_1093_1656 187
214 3300047470 Ga0495681_0024739 Ga0495681_0024739_2109_2672 187
215 3300047470 Ga0495681_0026128 Ga0495681_0026128_744_1307 187
216 3300047470 Ga0495681_0090042 Ga0495681_0090042_777_1340 187
217 3300047470 Ga0495681_0149660 Ga0495681_0149660_365_928 187
218 3300047472 Ga0495686_0001928 Ga0495686_0001928_13752_14315 187
219 3300047472 Ga0495686_0070510 Ga0495686_0070510_1317_1880 187
220 3300048091 Ga0495626_0002890 Ga0495626_0002890_9363_9926 187
221 3300048091 Ga0495626_0011604 Ga0495626_0011604_3816_4379 187
222 3300048091 Ga0495626_0034461 Ga0495626_0034461_1579_2142 187
223 3300048091 Ga0495626_0283591 Ga0495626_0283591_40_603 187
224 3300048905 Ga0496102_0006728 Ga0496102_0006728_745_1308 187
225 3300048915 Ga0496112_0346276 Ga0496112_0346276_383_946 187
226 3300048918 Ga0496115_0037637 Ga0496115_0037637_2653_3216 187
227 3300048918 Ga0496115_0047818 Ga0496115_0047818_2436_2999 187
228 3300048928 Ga0496125_0371469 Ga0496125_0371469_171_734 187
229 3300049459 Ga0495678_000146 Ga0495678_000146_32036_32599 187
230 3300049460 Ga0495682_0018475 Ga0495682_0018475_1978_2541 187
231 3300049460 Ga0495682_0049699 Ga0495682_0049699_655_1218 187
232 3300049686 Ga0501257_136225 Ga0501257_136225_70_633 187
233 3300009036 Ga0105244_10024622 Ga0105244_100246224 188
234 3300014497 Ga0182008_10000714 Ga0182008_1000071418 188
235 3300015261 Ga0182006_1000030 Ga0182006_100003016 188
236 3300015261 Ga0182006_1008553 Ga0182006_10085532 188
237 3300015262 Ga0182007_10000037 Ga0182007_1000003770 188
238 3300015262 Ga0182007_10003504 Ga0182007_100035044 188
239 3300015262 Ga0182007_10029112 Ga0182007_100291122 188
240 3300015265 Ga0182005_1000021 Ga0182005_1000021216 188
241 3300015265 Ga0182005_1000072 Ga0182005_100007223 188
242 3300017792 Ga0163161_10018871 Ga0163161_100188715 188
243 3300021361 Ga0213872_10000814 Ga0213872_1000081417 188
244 3300039447 Ga0436361_0537295 Ga0436361_0537295_15100_15675 188
245 3300046454 Ga0495592_0021604 Ga0495592_0021604_2869_3435 188
246 3300046462 Ga0495651_0008878 Ga0495651_0008878_4082_4648 188
247 3300046462 Ga0495651_0047306 Ga0495651_0047306_2097_2663 188
248 3300046463 Ga0495653_0013444 Ga0495653_0013444_3273_3839 188
249 3300046511 Ga0495608_0009162 Ga0495608_0009162_6201_6767 188
250 3300046511 Ga0495608_0044437 Ga0495608_0044437_321_887 188
251 3300046516 Ga0495628_0000518 Ga0495628_0000518_4097_4663 188
252 3300046516 Ga0495628_0030073 Ga0495628_0030073_822_1388 188
253 3300046516 Ga0495628_0332109 Ga0495628_0332109_74_640 188
254 3300046529 Ga0495652_0247256 Ga0495652_0247256_261_827 188
255 3300046529 Ga0495652_0274786 Ga0495652_0274786_447_1013 188
256 3300046530 Ga0495654_0005817 Ga0495654_0005817_2561_3133 188
257 3300046538 Ga0495609_0034302 Ga0495609_0034302_903_1475 188
258 3300046542 Ga0495597_0031172 Ga0495597_0031172_371_943 188
259 3300046543 Ga0495645_0030000 Ga0495645_0030000_2951_3517 188
260 3300046543 Ga0495645_0083955 Ga0495645_0083955_169_735 188
261 3300046557 Ga0495622_0017664 Ga0495622_0017664_768_1400 188
262 3300046558 Ga0495633_0000465 Ga0495633_0000465_2341_2973 188
263 3300046660 Ga0495625_0008548 Ga0495625_0008548_2454_3026 188
264 3300046664 Ga0495659_0000010 Ga0495659_0000010_45889_46461 188
265 3300046675 Ga0495657_0157013 Ga0495657_0157013_691_1257 188
266 3300046679 Ga0495623_0024186 Ga0495623_0024186_3044_3610 188
267 3300046679 Ga0495623_0153140 Ga0495623_0153140_729_1295 188
268 3300046680 Ga0495646_0005978 Ga0495646_0005978_2685_3251 188
269 3300046683 Ga0495658_0032942 Ga0495658_0032942_1701_2267 188
270 3300046690 Ga0495624_0008507 Ga0495624_0008507_3906_4472 188
271 3300046690 Ga0495624_0447147 Ga0495624_0447147_183_749 188
272 3300046692 Ga0495671_0006611 Ga0495671_0006611_2957_3529 188
273 3300046794 Ga0495589_0096064 Ga0495589_0096064_840_1412 188
274 3300046809 Ga0495600_0002933 Ga0495600_0002933_8685_9251 188
275 3300046810 Ga0495660_0000301 Ga0495660_0000301_6843_7415 188
276 3300047317 Ga0495604_0033720 Ga0495604_0033720_1483_2049 188
277 3300047320 Ga0495672_0000107 Ga0495672_0000107_90612_91184 188
278 3300047469 Ga0495673_0000074 Ga0495673_0000074_146283_146864 188
279 3300047472 Ga0495686_0122998 Ga0495686_0122998_406_978 188
280 3300048088 Ga0495602_0121927 Ga0495602_0121927_1006_1572 188
281 3300048919 Ga0496116_0021813 Ga0496116_0021813_2636_3268 188
282 3300048920 Ga0496117_0000056 Ga0496117_0000056_226673_227305 188
283 3300048921 Ga0496118_0000047 Ga0496118_0000047_44113_44745 188
284 3300048925 Ga0496122_0002132 Ga0496122_0002132_14048_14680 188
285 3300048926 Ga0496123_0005661 Ga0496123_0005661_8559_9191 188
286 3300048927 Ga0496124_0106931 Ga0496124_0106931_1146_1778 188
287 3300048928 Ga0496125_0033215 Ga0496125_0033215_224_856 188
288 3300049460 Ga0495682_0008069 Ga0495682_0008069_2705_3337 188
289 3300053077 Ga0495601_0003431 Ga0495601_0003431_7028_7594 188
290 3300053085 Ga0495619_0301075 Ga0495619_0301075_513_1079 188
291 3300053119 Ga0500595_000507 Ga0500595_000507_16902_17468 188
292 3300053141 Ga0500574_011835 Ga0500574_011835_229_795 188
293 3300053154 Ga0500619_000663 Ga0500619_000663_883_1449 188
294 iso_pu_bacteria 2818991436 2819543744 188
295 3300002987 JGI25159J45721_1006306 JGI25159J45721_10063062 189
296 3300003374 JGI25161J50226_1002570 JGI25161J50226_10025702 189
297 3300003775 Ga0055524_1034151 Ga0055524_10341512 189
298 3300006028 Ga0070717_10074351 Ga0070717_100743512 189
299 3300013102 Ga0157371_10000153 Ga0157371_1000015342 189
300 3300014497 Ga0182008_10030062 Ga0182008_100300622 189
301 3300015261 Ga0182006_1025155 Ga0182006_10251552 189
302 3300025263 Ga0209565_1000159 Ga0209565_100015953 189
303 3300025273 Ga0209673_1000006 Ga0209673_100000653 189
304 3300025291 Ga0209675_1000005 Ga0209675_1000005718 189
305 3300025295 Ga0209564_1000634 Ga0209564_100063446 189
306 3300025299 Ga0209256_1000274 Ga0209256_100027453 189
307 3300028380 Ga0268265_10271353 Ga0268265_102713532 189
308 3300031548 Ga0307408_100238094 Ga0307408_1002380942 189
309 3300044765 Ga0466970_0111489 Ga0466970_0111489_737_1315 189
310 3300046520 Ga0495637_0008278 Ga0495637_0008278_2294_2872 189
311 3300049775 Ga0501279_003330 Ga0501279_003330_332_964 189
312 3300005337 Ga0070682_100095724 Ga0070682_1000957242 190
313 3300025295 Ga0209564_1000028 Ga0209564_1000028415 190
314 3300025728 Ga0207655_1004659 Ga0207655_100465910 190
315 3300046507 Ga0495606_0000187 Ga0495606_0000187_43762_44358 190
316 3300046558 Ga0495633_0036747 Ga0495633_0036747_1314_1913 190
317 3300046616 Ga0495668_0000219 Ga0495668_0000219_63032_63631 190
318 3300046694 Ga0495649_0067622 Ga0495649_0067622_994_1593 190
319 3300047472 Ga0495686_0006559 Ga0495686_0006559_7356_7955 190
320 iso_pu_bacteria 2765235838 2765567255 190
321 iso_pu_bacteria 2839094727 2839095197 190
322 3300037312 Ga0395899_0001494 Ga0395899_0001494_10028_10693 191
323 3300037418 Ga0395900_0069150 Ga0395900_0069150_1964_2629 191
324 3300038443 Ga0395901_0514138 Ga0395901_0514138_158_823 191
325 3300044656 Ga0466969_0231399 Ga0466969_0231399_165_776 191
326 3300044658 Ga0466972_0045763 Ga0466972_0045763_259_942 191
327 3300044683 Ga0466965_0168484 Ga0466965_0168484_352_1035 191
328 3300044684 Ga0466966_0015317 Ga0466966_0015317_125_808 191
329 3300044719 Ga0466971_0006347 Ga0466971_0006347_3319_4002 191
330 3300044765 Ga0466970_0011751 Ga0466970_0011751_2584_3201 191
331 3300044842 Ga0466957_0098408 Ga0466957_0098408_1188_1799 191
332 3300045049 Ga0466959_0009707 Ga0466959_0009707_4151_4768 191
333 3300045049 Ga0466959_0029881 Ga0466959_0029881_112_795 191
334 3300046460 Ga0495638_0000354 Ga0495638_0000354_43609_44238 191
335 3300046474 Ga0495605_0000614 Ga0495605_0000614_14942_15571 191
336 3300046491 Ga0495584_0000972 Ga0495584_0000972_17307_17936 191
337 3300046492 Ga0495585_0081502 Ga0495585_0081502_1087_1716 191
338 3300046501 Ga0495607_0075448 Ga0495607_0075448_1179_1808 191
339 3300046506 Ga0495583_0000063 Ga0495583_0000063_40027_40656 191
340 3300046512 Ga0495610_0018225 Ga0495610_0018225_897_1526 191
341 3300046513 Ga0495616_0097436 Ga0495616_0097436_320_949 191
342 3300046519 Ga0495632_0250472 Ga0495632_0250472_60_689 191
343 3300046523 Ga0495644_0001369 Ga0495644_0001369_6810_7439 191
344 3300046523 Ga0495644_0003558 Ga0495644_0003558_3025_3654 191
345 3300046524 Ga0495648_0001788 Ga0495648_0001788_20022_20651 191
346 3300046558 Ga0495633_0007939 Ga0495633_0007939_4127_4756 191
347 3300046558 Ga0495633_0071097 Ga0495633_0071097_222_851 191
348 3300046615 Ga0495656_0054003 Ga0495656_0054003_418_1047 191
349 3300046648 Ga0495611_0024173 Ga0495611_0024173_759_1388 191
350 3300046660 Ga0495625_0041651 Ga0495625_0041651_2537_3166 191
351 3300046664 Ga0495659_0023115 Ga0495659_0023115_119_748 191
352 3300046691 Ga0495670_0026304 Ga0495670_0026304_1150_1779 191
353 3300046692 Ga0495671_0146356 Ga0495671_0146356_418_1047 191
354 3300046794 Ga0495589_0087253 Ga0495589_0087253_421_1050 191
355 3300047318 Ga0495636_0000972 Ga0495636_0000972_2967_3596 191
356 3300047320 Ga0495672_0061347 Ga0495672_0061347_1435_2064 191
357 3300047323 Ga0495683_0002939 Ga0495683_0002939_7990_8619 191
358 3300047443 Ga0495687_000562 Ga0495687_000562_35677_36306 191
359 3300047445 Ga0495677_0002665 Ga0495677_0002665_2185_2814 191
360 3300047447 Ga0495685_000128 Ga0495685_000128_317_946 191
361 3300047469 Ga0495673_0005143 Ga0495673_0005143_2667_3296 191
362 3300047472 Ga0495686_0102897 Ga0495686_0102897_401_1030 191
363 3300049460 Ga0495682_0001101 Ga0495682_0001101_4617_5246 191
364 3300049460 Ga0495682_0003502 Ga0495682_0003502_4617_5246 191
365 3300061719 Ga0466962_0006586 Ga0466962_0006586_838_1521 191
366 3300002737 JGI25162J39368_1000040 JGI25162J39368_100004088 192
367 3300002773 JGI25152J39213_1003345 JGI25152J39213_10033453 192
368 3300002774 JGI25150J39212_1006172 JGI25150J39212_10061722 192
369 3300002987 JGI25159J45721_1009296 JGI25159J45721_10092962 192
370 3300002987 JGI25159J45721_1009302 JGI25159J45721_10093022 192
371 3300003214 JGI25165J46597_1000051 JGI25165J46597_1000051111 192
372 3300003354 JGI25160J50197_1000548 JGI25160J50197_100054817 192
373 3300003374 JGI25161J50226_1003959 JGI25161J50226_10039592 192
374 3300003751 Ga0055538_1000025 Ga0055538_1000025122 192
375 3300003752 Ga0055539_1000032 Ga0055539_1000032111 192
376 3300003756 Ga0055533_1000042 Ga0055533_1000042122 192
377 3300003759 Ga0055525_1000050 Ga0055525_1000050122 192
378 3300003771 Ga0055526_1011051 Ga0055526_10110512 192
379 3300003771 Ga0055526_1011131 Ga0055526_10111312 192
380 3300003773 Ga0055537_1000172 Ga0055537_100017252 192
381 3300003773 Ga0055537_1012211 Ga0055537_10122111 192
382 3300003775 Ga0055524_1001210 Ga0055524_100121014 192
383 3300003775 Ga0055524_1006087 Ga0055524_10060875 192
384 3300003784 Ga0055534_1000169 Ga0055534_10001692 192
385 3300003784 Ga0055534_1004001 Ga0055534_10040013 192
386 3300003790 Ga0055528_1000482 Ga0055528_100048233 192
387 3300003790 Ga0055528_1000486 Ga0055528_10004862 192
388 3300003790 Ga0055528_1005060 Ga0055528_10050602 192
389 3300003791 Ga0055530_10014837 Ga0055530_100148372 192
390 3300003794 Ga0055531_10008167 Ga0055531_100081673 192
391 3300003841 Ga0055541_1000023 Ga0055541_1000023121 192
392 3300004625 Ga0055543_1005427 Ga0055543_10054273 192
393 3300004625 Ga0055543_1030296 Ga0055543_10302962 192
394 3300005262 Ga0065165_1056903 Ga0065165_10569032 192
395 3300009092 Ga0105250_10118080 Ga0105250_101180802 192
396 3300021361 Ga0213872_10000065 Ga0213872_1000006546 192
397 3300025207 Ga0209760_101495 Ga0209760_1014952 192
398 3300025208 Ga0209436_100389 Ga0209436_10038917 192
399 3300025208 Ga0209436_102679 Ga0209436_1026792 192
400 3300025208 Ga0209436_102691 Ga0209436_1026913 192
401 3300025224 Ga0209784_100010 Ga0209784_100010499 192
402 3300025225 Ga0209566_100008 Ga0209566_100008499 192
403 3300025226 Ga0209674_100019 Ga0209674_100019499 192
404 3300025230 Ga0209563_100021 Ga0209563_100021499 192
405 3300025231 Ga0207427_100412 Ga0207427_10041223 192
406 3300025233 Ga0209437_100019 Ga0209437_100019499 192
407 3300025245 Ga0207425_1000013 Ga0207425_100001356 192
408 3300025245 Ga0207425_1000152 Ga0207425_100015246 192
409 3300025245 Ga0207425_1010168 Ga0207425_10101682 192
410 3300025253 Ga0209677_100011 Ga0209677_100011499 192
411 3300025258 Ga0209129_1000152 Ga0209129_100015257 192
412 3300025258 Ga0209129_1003996 Ga0209129_10039962 192
413 3300025261 Ga0209233_1000025 Ga0209233_1000025499 192
414 3300025263 Ga0209565_1000671 Ga0209565_100067117 192
415 3300025263 Ga0209565_1013856 Ga0209565_10138562 192
416 3300025273 Ga0209673_1048627 Ga0209673_10486271 192
417 3300025284 Ga0209130_1000425 Ga0209130_100042528 192
418 3300025284 Ga0209130_1000499 Ga0209130_100049933 192
419 3300025284 Ga0209130_1001299 Ga0209130_100129912 192
420 3300025291 Ga0209675_1001676 Ga0209675_10016764 192
421 3300025295 Ga0209564_1000604 Ga0209564_100060442 192
422 3300025295 Ga0209564_1002267 Ga0209564_10022678 192
423 3300025297 Ga0209758_1000031 Ga0209758_1000031408 192
424 3300025298 Ga0209050_1000525 Ga0209050_100052511 192
425 3300025298 Ga0209050_1000601 Ga0209050_100060149 192
426 3300025298 Ga0209050_1012832 Ga0209050_10128321 192
427 3300025299 Ga0209256_1000414 Ga0209256_100041415 192
428 3300025299 Ga0209256_1000426 Ga0209256_100042625 192
429 3300025302 Ga0207426_1001125 Ga0207426_100112511 192
430 3300025302 Ga0207426_1026952 Ga0207426_10269521 192
431 3300025303 Ga0209051_1025440 Ga0209051_10254402 192
432 3300025304 Ga0209257_1000157 Ga0209257_1000157130 192
433 3300025304 Ga0209257_1020499 Ga0209257_10204991 192
434 3300026088 Ga0207641_10883051 Ga0207641_108830512 192
435 3300031548 Ga0307408_100000610 Ga0307408_10000061015 192
436 3300039447 Ga0436361_0900144 Ga0436361_0900144_135285_135923 192
437 3300046452 Ga0495617_000011 Ga0495617_000011_241787_242395 192
438 3300046471 Ga0495650_0000297 Ga0495650_0000297_50836_51462 192
439 3300046491 Ga0495584_0009352 Ga0495584_0009352_2758_3363 192
440 3300046501 Ga0495607_0001581 Ga0495607_0001581_8408_9013 192
441 3300046506 Ga0495583_0019188 Ga0495583_0019188_1558_2163 192
442 3300046507 Ga0495606_0001166 Ga0495606_0001166_18451_19086 192
443 3300046507 Ga0495606_0014338 Ga0495606_0014338_5252_5887 192
444 3300046512 Ga0495610_0000007 Ga0495610_0000007_760335_760943 192
445 3300046512 Ga0495610_0047024 Ga0495610_0047024_296_931 192
446 3300046512 Ga0495610_0061057 Ga0495610_0061057_1128_1763 192
447 3300046513 Ga0495616_0004083 Ga0495616_0004083_453_1058 192
448 3300046522 Ga0495643_0000245 Ga0495643_0000245_36215_36850 192
449 3300046524 Ga0495648_0183496 Ga0495648_0183496_209_838 192
450 3300046528 Ga0495642_0005188 Ga0495642_0005188_2118_2723 192
451 3300046538 Ga0495609_0001607 Ga0495609_0001607_12621_13226 192
452 3300046616 Ga0495668_0012594 Ga0495668_0012594_566_1171 192
453 3300046648 Ga0495611_0222592 Ga0495611_0222592_37_642 192
454 3300046660 Ga0495625_0002389 Ga0495625_0002389_5281_5886 192
455 3300046664 Ga0495659_0000622 Ga0495659_0000622_1685_2290 192
456 3300046665 Ga0495661_0041194 Ga0495661_0041194_1915_2520 192
457 3300046684 Ga0495669_0000240 Ga0495669_0000240_21848_22453 192
458 3300046694 Ga0495649_0095924 Ga0495649_0095924_407_1012 192
459 3300046810 Ga0495660_0254588 Ga0495660_0254588_21_626 192
460 3300047318 Ga0495636_0013465 Ga0495636_0013465_564_1169 192
461 3300047320 Ga0495672_0000286 Ga0495672_0000286_66971_67606 192
462 3300047443 Ga0495687_025202 Ga0495687_025202_22_627 192
463 3300047445 Ga0495677_0002234 Ga0495677_0002234_22_627 192
464 3300047469 Ga0495673_0000173 Ga0495673_0000173_61075_61683 192
465 3300047470 Ga0495681_0032410 Ga0495681_0032410_302_907 192
466 3300048925 Ga0496122_0039705 Ga0496122_0039705_1864_2472 192
467 3300049459 Ga0495678_011440 Ga0495678_011440_1179_1814 192
468 iso_pu_bacteria 2738541297 2738827893 192
469 iso_pu_bacteria 2738541357 2739151689 192
470 iso_pu_bacteria 2738543003 2739193609 192
471 iso_pu_bacteria 2738543026 2739320085 192
472 iso_pu_bacteria 2738543029 2739338326 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14334

DUF4390

Domain of unknown function (DUF4390)

49

206

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eer-assembly1.cif.gz_B crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms 0.6092 35 191
8h7g-assembly1.cif.gz_D cryo-em structure of the human saga complex 0.607 74 131
1px3-assembly1.cif.gz_B e. coli (lacz) beta-galactosidase (g794a) 0.6054 32 191
7brs-assembly4.cif.gz_D e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.603 32 190
7brs-assembly2.cif.gz_B e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.6026 32 191
ID Description Score Start End Superfamily
af_P71662_1_248_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7756 100 122 3.50.50.60
af_A8WHA8_19_129_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5981 32 191 2.60.40.10
af_A0A0R4INU9_142_237_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5799 34 191 2.60.40.10
af_Q5ALL8_1_94_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5744 34 54 2.30.29.30
af_Q7YTU0_40_142_2.60.40.2950 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5724 36 192 2.60.40.2950
ID Description Score Start End GO Terms
AF-A0A127QS40-F1-model_v4 deleted 0.9865 37 192
AF-A0A377RKR6-F1-model_v4 DUF4390 domain-containing protein 0.9825 33 192
AF-A0A377RKR6-F1-model_v4 DUF4390 domain-containing protein 0.9704 33 192
AF-A0A127QS40-F1-model_v4 deleted 0.968 37 192
AF-Q5P4P9-F1-model_v4 DUF4390 domain-containing protein 0.9679 50 190

Feature Viewer

pLDDT pTM Quality
85.37 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map