metagRoot

F450756

General Info

Members	Datasets	Scaffolds	Average Seq Length
472	285	461	233

Family's Representative Sequence

Representative Sequence	3300005467\|Ga0070706_100002898\|Ga0070706_1000028982
Length	280
Sequence	MTFRNSLTKFARSKECSAQPLRFLRFCGEGVLFAPIGAHSRQGCLRSKMITIRKSEDRGHFDLGWLDTYHTFSFDQYYDPAHMHFRSLRVINEDRVQPGQGFPTHSHRDMEIITYILSGALEHRDSMGNGSVIRPGDVQRMTAGTGVSHSEFNASDTEPVHLLQIWILPNARNLPPGYEQKAFTDEERRGKLRLIASDDGREGSVTIHQDARVYATLLGAEQRAEHTLAENRYAWLQVARGAIRLNEVELKQGDGAAVSNETRLGIVARDEAEVLLFDLA

Samples

	Sample ID	Description	Type	Environment
1	2738541297	Duganella sp. GV083	Isolate	Unclassified
2	2738541357	Duganella sp. GV053	Isolate	Unclassified
3	2738543003	Duganella sp. GV066	Isolate	Unclassified
4	2738543026	Duganella sp. GV089	Isolate	Unclassified
5	2738543029	Duganella sp. GV039	Isolate	Unclassified
6	2831426010	Nostoc sp. 106C	Isolate	Unclassified
7	2848694841	Nostoc sp. RF31YmG	Isolate	Unclassified
8	2849660919	Nostoc sp. T09	Isolate	Unclassified
9	2857558681	Duganella sp. R-74565	Isolate	Unclassified
10	2857564685	Duganella sp. R-74599	Isolate	Unclassified
11	2920107658	Aquisphaera insulae JC669	Isolate	Rhizosphere
12	3300001432	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
13	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
14	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
15	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
16	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
17	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
18	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
19	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
20	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
21	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
22	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
23	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
24	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
25	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
26	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
27	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
28	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
29	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
30	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
31	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
32	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
33	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
34	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
35	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
36	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
37	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
38	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
39	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
40	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
41	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
42	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
43	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
44	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
45	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
46	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
47	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
48	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
49	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
50	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
51	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
52	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
53	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
54	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
55	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
56	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
57	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
58	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
59	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
60	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
61	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
62	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
63	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
64	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
65	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
66	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
67	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
68	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
69	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
70	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
71	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
72	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
73	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
74	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
76	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
77	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
78	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
79	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
80	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
82	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
83	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
84	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
86	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
87	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
89	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
90	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
91	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
92	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
93	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
94	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
95	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
96	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
97	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
98	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
99	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
100	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
101	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
102	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
103	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
104	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
105	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
106	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
107	3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
111	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
163	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
166	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
167	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
168	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
169	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
170	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
171	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
172	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
173	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
174	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
175	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
176	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
177	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
178	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
179	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
180	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
181	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
182	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
183	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
184	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
185	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
186	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
187	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
188	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
189	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
190	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
191	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
192	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
193	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
194	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
195	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
196	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
197	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
198	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
199	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
200	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
201	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
202	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
203	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
204	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
205	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
206	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
207	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
208	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
209	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
210	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
211	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
212	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
213	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
214	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
215	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
216	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
217	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
218	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
219	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
220	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
221	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
222	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
223	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
224	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
225	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
226	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
227	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
228	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
229	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
230	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
231	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
232	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
233	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
234	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
235	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
236	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
237	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
238	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
239	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
240	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
241	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
242	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
243	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
244	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
245	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
246	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
247	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
248	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
249	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
250	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
251	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
252	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
253	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
256	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
257	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
259	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
260	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
261	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
262	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
263	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
264	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
265	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
266	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
267	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
268	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
269	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
270	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
271	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
272	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
274	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
275	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
276	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
277	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
278	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
279	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
280	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
281	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
282	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
283	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
284	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
285	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.25
Metatranscriptomes	0.42
Isolates	2.33

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.12
Nodule	0
Rhizoplane	0
Rhizosphere	93.86
Stem	0
Stem Tuber	0
Unclassified	4.03

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24034J14986_100187	3300001432	Bacteria	3217
2	JGI24748J21848_1000073	3300002074	Bacteria	34628
3	JGI24034J26672_10000013	3300002239	Bacteria	144025
4	JGI25150J39212_1012412	3300002774	Bacteria	1510
5	JGI25153J46596_10034559	3300003215	Bacteria	1650
6	rootH2_10022708	3300003320	Bacteria	31330
7	rootH1_10018468	3300003323	Bacteria	16969
8	rootH1_10184247	3300003323	Bacteria	1646
9	Ga0065707_10098502	3300005295	Bacteria	3080
10	Ga0070658_10023581	3300005327	Bacteria	4938
11	Ga0070658_10195220	3300005327	Bacteria	1707
12	Ga0070690_100002944	3300005330	Bacteria	9208
13	Ga0070690_100009093	3300005330	Bacteria	5747
14	Ga0070690_100158270	3300005330	Bacteria	1550
15	Ga0070670_100054699	3300005331	Bacteria	3427
16	Ga0070670_100518252	3300005331	Bacteria	1061
17	Ga0068869_100066220	3300005334	Bacteria	2661
18	Ga0070666_10095169	3300005335	Bacteria	2049
19	Ga0070682_100065625	3300005337	Bacteria	2307
20	Ga0068868_100047113	3300005338	Bacteria	3376
21	Ga0068868_100352200	3300005338	Bacteria	1261
22	Ga0070689_100305446	3300005340	Bacteria	1325
23	Ga0070687_100411369	3300005343	Bacteria	890
24	Ga0070668_100494848	3300005347	Bacteria	1057
25	Ga0070675_100147342	3300005354	Bacteria	2016
26	Ga0070671_100058912	3300005355	Bacteria	3196
27	Ga0070671_100222470	3300005355	Bacteria	1601
28	Ga0070674_100155223	3300005356	Bacteria	1731
29	Ga0070673_100121740	3300005364	Bacteria	2178
30	Ga0070688_100256637	3300005365	Unclassified	1247
31	Ga0070703_10000054	3300005406	Bacteria	56789
32	Ga0070703_10136317	3300005406	Bacteria	907
33	Ga0070709_10264873	3300005434	Bacteria	1243
34	Ga0070713_100112801	3300005436	Bacteria	2372
35	Ga0070713_100124178	3300005436	Bacteria	2268
36	Ga0070713_100910527	3300005436	Bacteria	846
37	Ga0070701_10225363	3300005438	Bacteria	1120
38	Ga0070701_10262636	3300005438	Bacteria	1047
39	Ga0070711_100002325	3300005439	Bacteria	10806
40	Ga0070705_100023861	3300005440	Bacteria	3292
41	Ga0070705_100163679	3300005440	Bacteria	1490
42	Ga0070705_100169185	3300005440	Bacteria	1469
43	Ga0070700_100102309	3300005441	Bacteria	1890
44	Ga0070700_100143153	3300005441	Bacteria	1627
45	Ga0070694_100000315	3300005444	Bacteria	25990
46	Ga0070708_100089677	3300005445	Bacteria	2798
47	Ga0070708_100284090	3300005445	Bacteria	1558
48	Ga0070708_100580552	3300005445	Unclassified	1057
49	Ga0070678_100241587	3300005456	Bacteria	1510
50	Ga0070678_100474985	3300005456	Bacteria	1099
51	Ga0068867_100131208	3300005459	Bacteria	1947
52	Ga0070706_100002898	3300005467	Bacteria	17076
53	Ga0070706_100015454	3300005467	Bacteria	7049
54	Ga0070706_100016785	3300005467	Bacteria	6763
55	Ga0070707_100000197	3300005468	Bacteria	60425
56	Ga0070707_100000616	3300005468	Bacteria	35696
57	Ga0070707_100013234	3300005468	Bacteria	7714
58	Ga0070707_100117129	3300005468	Bacteria	2586
59	Ga0070707_100264291	3300005468	Bacteria	1674
60	Ga0070698_100003216	3300005471	Bacteria	18000
61	Ga0070698_100047080	3300005471	Bacteria	4409
62	Ga0070699_100002241	3300005518	Bacteria	17437
63	Ga0070699_100021444	3300005518	Bacteria	5571
64	Ga0070684_100103112	3300005535	Bacteria	2551
65	Ga0070697_100012312	3300005536	Bacteria	6701
66	Ga0070697_100045100	3300005536	Bacteria	3573
67	Ga0070697_100070526	3300005536	Bacteria	2865
68	Ga0070697_100189937	3300005536	Bacteria	1743
69	Ga0070697_100238632	3300005536	Bacteria	1552
70	Ga0070672_100141709	3300005543	Bacteria	1983
71	Ga0070686_100141061	3300005544	Bacteria	1677
72	Ga0070686_100569485	3300005544	Bacteria	888
73	Ga0070686_100673451	3300005544	Unclassified	822
74	Ga0070695_100049354	3300005545	Bacteria	2695
75	Ga0070696_100133726	3300005546	Bacteria	1807
76	Ga0070696_100222313	3300005546	Bacteria	1417
77	Ga0070665_100821607	3300005548	Bacteria	942
78	Ga0070704_100011731	3300005549	Bacteria	5386
79	Ga0070704_100214711	3300005549	Bacteria	1561
80	Ga0070704_100627703	3300005549	Bacteria	947
81	Ga0068855_100111108	3300005563	Unclassified	3146
82	Ga0068855_100149868	3300005563	Bacteria	2652
83	Ga0068855_100363597	3300005563	Bacteria	1592
84	Ga0070664_100631989	3300005564	Bacteria	994
85	Ga0068857_100102724	3300005577	Bacteria	2566
86	Ga0068856_100000421	3300005614	Bacteria	46619
87	Ga0068856_100176597	3300005614	Bacteria	2148
88	Ga0070702_100327259	3300005615	Bacteria	1070
89	Ga0068852_100562143	3300005616	Unclassified	1142
90	Ga0068859_100052334	3300005617	Bacteria	4105
91	Ga0068859_100096894	3300005617	Bacteria	3002
92	Ga0068859_100533501	3300005617	Bacteria	1268
93	Ga0068864_100121969	3300005618	Bacteria	2332
94	Ga0068864_100363247	3300005618	Bacteria	1369
95	Ga0068864_100594638	3300005618	Bacteria	1073
96	Ga0068864_100631171	3300005618	Unclassified	1042
97	Ga0068866_10050182	3300005718	Bacteria	2118
98	Ga0068863_100256398	3300005841	Bacteria	1690
99	Ga0068863_100561469	3300005841	Bacteria	1128
100	Ga0068858_100000214	3300005842	Bacteria	62487
101	Ga0068858_100038533	3300005842	Bacteria	4434
102	Ga0068858_100054151	3300005842	Bacteria	3709
103	Ga0068858_100436289	3300005842	Unclassified	1261
104	Ga0068860_100000754	3300005843	Bacteria	36689
105	Ga0068860_100016802	3300005843	Bacteria	7134
106	Ga0068860_100018984	3300005843	Bacteria	6678
107	Ga0068860_100319553	3300005843	Unclassified	1524
108	Ga0068862_100309770	3300005844	Bacteria	1455
109	Ga0068862_100873421	3300005844	Bacteria	883
110	Ga0081539_10174079	3300005985	Bacteria	1014
111	Ga0070717_10210567	3300006028	Bacteria	1706
112	Ga0070717_10872437	3300006028	Bacteria	819
113	Ga0075362_10043842	3300006177	Bacteria	1982
114	Ga0097621_100022453	3300006237	Bacteria	4899
115	Ga0068871_100014329	3300006358	Bacteria	5907
116	Ga0075428_100018794	3300006844	Bacteria	7642
117	Ga0075428_101275288	3300006844	Bacteria	773
118	Ga0075434_100223151	3300006871	Bacteria	1904
119	Ga0068865_100084320	3300006881	Bacteria	2290
120	Ga0075436_100000015	3300006914	Bacteria	174598
121	Ga0097620_100052333	3300006931	Bacteria	4105
122	Ga0097620_100096896	3300006931	Bacteria	3002
123	Ga0097620_100440850	3300006931	Bacteria	1398
124	Ga0097620_100533569	3300006931	Bacteria	1268
125	Ga0075435_100000419	3300007076	Bacteria	26191
126	Ga0075435_100155288	3300007076	Bacteria	1925
127	Ga0099794_10040405	3300007265	Bacteria	2218
128	Ga0105240_10001445	3300009093	Bacteria	40579
129	Ga0105240_10105140	3300009093	Bacteria	3427
130	Ga0105240_10194282	3300009093	Bacteria	2384
131	Ga0105240_10958012	3300009093	Bacteria	917
132	Ga0111539_10103615	3300009094	Bacteria	3339
133	Ga0111539_10133169	3300009094	Bacteria	2910
134	Ga0105245_10352652	3300009098	Bacteria	1458
135	Ga0105245_10941049	3300009098	Bacteria	907
136	Ga0105247_10000015	3300009101	Bacteria	277224
137	Ga0105247_10529475	3300009101	Bacteria	863
138	Ga0114129_10071122	3300009147	Bacteria	4851
139	Ga0114129_10093216	3300009147	Bacteria	4172
140	Ga0114129_10105757	3300009147	Bacteria	3889
141	Ga0114129_11333810	3300009147	Bacteria	888
142	Ga0105243_10000198	3300009148	Bacteria	70514
143	Ga0105243_10001478	3300009148	Bacteria	20616
144	Ga0105243_10508419	3300009148	Bacteria	1143
145	Ga0105241_10106442	3300009174	Bacteria	2238
146	Ga0105242_10000072	3300009176	Bacteria	71112
147	Ga0105242_10000163	3300009176	Bacteria	49988
148	Ga0105242_10003440	3300009176	Bacteria	12305
149	Ga0105242_10006243	3300009176	Bacteria	9181
150	Ga0105242_10023634	3300009176	Bacteria	4845
151	Ga0105242_10205597	3300009176	Bacteria	1751
152	Ga0105248_10003182	3300009177	Bacteria	18198
153	Ga0105248_10353672	3300009177	Bacteria	1654
154	Ga0105237_10014349	3300009545	Bacteria	8290
155	Ga0105238_10012487	3300009551	Bacteria	8568
156	Ga0105238_10053281	3300009551	Bacteria	4065
157	Ga0105249_10081980	3300009553	Bacteria	3000
158	Ga0105239_10017271	3300010375	Bacteria	7978
159	Ga0105239_10080374	3300010375	Bacteria	3587
160	Ga0157370_10316354	3300013104	Bacteria	1440
161	Ga0157369_10054919	3300013105	Bacteria	4300
162	Ga0157378_10000111	3300013297	Bacteria	78451
163	Ga0157378_10063430	3300013297	Unclassified	3301
164	Ga0163162_10025302	3300013306	Bacteria	5865
165	Ga0163162_10042634	3300013306	Bacteria	4543
166	Ga0163162_10549893	3300013306	Bacteria	1283
167	Ga0163162_11096192	3300013306	Bacteria	902
168	Ga0157372_10002746	3300013307	Bacteria	19022
169	Ga0157375_10006618	3300013308	Bacteria	10085
170	Ga0157375_10215673	3300013308	Bacteria	2077
171	Ga0157375_11224387	3300013308	Bacteria	881
172	Ga0163163_10358108	3300014325	Bacteria	1515
173	Ga0157377_10077737	3300014745	Bacteria	1933
174	Ga0157376_10077720	3300014969	Bacteria	2839
175	Ga0163161_10105815	3300017792	Bacteria	2099
176	Ga0163161_10318547	3300017792	Bacteria	1229
177	Ga0224712_10011657	3300022467	Bacteria	2736
178	Ga0207672_1000511	3300025223	Bacteria	4817
179	Ga0209437_105654	3300025233	Bacteria	2121
180	Ga0207425_1001276	3300025245	Bacteria	10952
181	Ga0209646_1000010	3300025246	Bacteria	573803
182	Ga0209025_1003131	3300025294	Bacteria	16180
183	Ga0209758_1002737	3300025297	Bacteria	17343
184	Ga0207655_1008385	3300025728	Bacteria	6567
185	Ga0207653_10000026	3300025885	Bacteria	114420
186	Ga0207710_10000004	3300025900	Bacteria	846540
187	Ga0207699_10586915	3300025906	Bacteria	811
188	Ga0207705_10018195	3300025909	Bacteria	5023
189	Ga0207684_10000795	3300025910	Bacteria	36509
190	Ga0207654_10194046	3300025911	Bacteria	1333
191	Ga0207707_10126884	3300025912	Bacteria	2231
192	Ga0207695_10009116	3300025913	Bacteria	12320
193	Ga0207695_10149824	3300025913	Bacteria	2273
194	Ga0207695_10286306	3300025913	Bacteria	1541
195	Ga0207662_10066284	3300025918	Bacteria	2175
196	Ga0207649_10000026	3300025920	Bacteria	177395
197	Ga0207646_10001008	3300025922	Bacteria	36058
198	Ga0207646_10001342	3300025922	Bacteria	30550
199	Ga0207646_10085935	3300025922	Bacteria	2814
200	Ga0207646_10136838	3300025922	Bacteria	2206
201	Ga0207646_10170401	3300025922	Bacteria	1966
202	Ga0207646_10203810	3300025922	Bacteria	1787
203	Ga0207681_10060253	3300025923	Bacteria	2605
204	Ga0207681_10140684	3300025923	Bacteria	1797
205	Ga0207694_10009217	3300025924	Bacteria	7448
206	Ga0207694_10012987	3300025924	Bacteria	6271
207	Ga0207694_10102626	3300025924	Bacteria	2268
208	Ga0207650_10289745	3300025925	Bacteria	1335
209	Ga0207659_10039692	3300025926	Bacteria	3286
210	Ga0207687_10155191	3300025927	Bacteria	1751
211	Ga0207687_10454504	3300025927	Bacteria	1063
212	Ga0207700_10138142	3300025928	Bacteria	1999
213	Ga0207700_10306897	3300025928	Bacteria	1372
214	Ga0207700_10818261	3300025928	Bacteria	833
215	Ga0207644_10000159	3300025931	Bacteria	49009
216	Ga0207686_10000057	3300025934	Bacteria	103125
217	Ga0207686_10000098	3300025934	Bacteria	71662
218	Ga0207686_10104827	3300025934	Bacteria	1895
219	Ga0207709_10000140	3300025935	Bacteria	101921
220	Ga0207709_10009932	3300025935	Bacteria	5241
221	Ga0207709_10411719	3300025935	Bacteria	1036
222	Ga0207670_10094184	3300025936	Bacteria	2124
223	Ga0207670_10285957	3300025936	Bacteria	1287
224	Ga0207704_10069352	3300025938	Bacteria	2227
225	Ga0207665_10068807	3300025939	Bacteria	2413
226	Ga0207691_10074342	3300025940	Bacteria	3065
227	Ga0207711_10186120	3300025941	Bacteria	1890
228	Ga0207711_10213733	3300025941	Bacteria	1762
229	Ga0207711_10247446	3300025941	Bacteria	1636
230	Ga0207689_10047352	3300025942	Bacteria	3551
231	Ga0207679_10055540	3300025945	Bacteria	2919
232	Ga0207667_10005989	3300025949	Bacteria	14795
233	Ga0207667_10092564	3300025949	Bacteria	3122
234	Ga0207667_10309716	3300025949	Bacteria	1613
235	Ga0207651_10031433	3300025960	Bacteria	3394
236	Ga0207651_10046739	3300025960	Bacteria	2914
237	Ga0207651_10221104	3300025960	Bacteria	1531
238	Ga0207658_10857629	3300025986	Bacteria	826
239	Ga0207703_10000084	3300026035	Bacteria	109254
240	Ga0207703_10137644	3300026035	Bacteria	2116
241	Ga0207703_10390645	3300026035	Bacteria	1289
242	Ga0207708_10114604	3300026075	Bacteria	2095
243	Ga0207708_10138778	3300026075	Bacteria	1905
244	Ga0207702_10289259	3300026078	Bacteria	1552
245	Ga0207648_10008101	3300026089	Bacteria	10230
246	Ga0207676_10017465	3300026095	Bacteria	5200
247	Ga0207676_10345678	3300026095	Bacteria	1374
248	Ga0207676_10449100	3300026095	Bacteria	1215
249	Ga0207676_10500444	3300026095	Bacteria	1154
250	Ga0207683_10217693	3300026121	Bacteria	1739
251	Ga0207698_10130902	3300026142	Bacteria	2143
252	Ga0209969_1000757	3300027360	Bacteria	4330
253	Ga0209967_1000508	3300027364	Bacteria	5122
254	Ga0209981_1001187	3300027378	Bacteria	3299
255	Ga0209996_1001489	3300027395	Bacteria	2836
256	Ga0209984_1003016	3300027424	Bacteria	1903
257	Ga0210000_1000253	3300027462	Bacteria	7625
258	Ga0209995_1001001	3300027471	Bacteria	4343
259	Ga0209999_1008683	3300027543	Bacteria	1835
260	Ga0209983_1008707	3300027665	Bacteria	2072
261	Ga0209971_1013470	3300027682	Bacteria	1938
262	Ga0209974_10002424	3300027876	Bacteria	6754
263	Ga0207428_10015234	3300027907	Bacteria	6652
264	Ga0207428_10072549	3300027907	Bacteria	2702
265	Ga0268265_10246820	3300028380	Bacteria	1579
266	Ga0268264_10017190	3300028381	Bacteria	5924
267	Ga0268264_10025251	3300028381	Bacteria	4853
268	Ga0265337_1002357	3300028556	Bacteria	8718
269	Ga0265334_10053352	3300028573	Bacteria	1544
270	Ga0265318_10044428	3300028577	Bacteria	1681
271	Ga0265323_10036285	3300028653	Bacteria	1813
272	Ga0265338_10000269	3300028800	Bacteria	95081
273	Ga0265338_10000690	3300028800	Bacteria	58002
274	Ga0265338_10035111	3300028800	Bacteria	4828
275	Ga0265338_10142987	3300028800	Bacteria	1871
276	Ga0265338_10164163	3300028800	Bacteria	1712
277	Ga0316181_1115615	3300030744	Bacteria	2726
278	Ga0265330_10019767	3300031235	Bacteria	3081
279	Ga0265330_10173473	3300031235	Bacteria	914
280	Ga0265332_10069212	3300031238	Bacteria	1504
281	Ga0265328_10000045	3300031239	Bacteria	82409
282	Ga0265320_10160594	3300031240	Bacteria	1012
283	Ga0265329_10006593	3300031242	Bacteria	4596
284	Ga0265331_10000067	3300031250	Bacteria	158073
285	Ga0265327_10000036	3300031251	Bacteria	312827
286	Ga0265327_10000468	3300031251	Bacteria	71547
287	Ga0265327_10005989	3300031251	Bacteria	9888
288	Ga0265327_10028608	3300031251	Bacteria	3184
289	Ga0265316_10036018	3300031344	Bacteria	4003
290	Ga0265316_10039079	3300031344	Bacteria	3815
291	Ga0307513_10084604	3300031456	Bacteria	3257
292	Ga0307408_100970391	3300031548	Bacteria	782
293	Ga0316575_10014239	3300031665	Bacteria	2982
294	Ga0265314_10000107	3300031711	Bacteria	125951
295	Ga0265314_10087327	3300031711	Bacteria	2040
296	Ga0265314_10093749	3300031711	Bacteria	1948
297	Ga0265342_10113209	3300031712	Bacteria	1534
298	Ga0316578_10137492	3300031728	Bacteria	1471
299	Ga0316577_10170216	3300031733	Bacteria	1229
300	Ga0316577_10250572	3300031733	Bacteria	1002
301	Ga0316586_1006975	3300033527	Bacteria	1636
302	Ga0373961_0029986	3300035241	Bacteria	1510
303	Ga0316574_0006105	3300035398	Bacteria	6482
304	Ga0316574_0349770	3300035398	Bacteria	935
305	Ga0316582_0007648	3300036647	Bacteria	5765
306	Ga0316584_0011569	3300036712	Bacteria	6204
307	Ga0316584_0042742	3300036712	Bacteria	3378
308	Ga0316584_0224376	3300036712	Bacteria	1379
309	Ga0395898_0000057	3300037466	Bacteria	277915
310	Ga0395905_0004885	3300037471	Bacteria	13816
311	Ga0436360_0349878	3300039438	Bacteria	1649
312	Ga0436360_0585151	3300039438	Unclassified	1397
313	Ga0436360_1306473	3300039438	Bacteria	10242
314	Ga0436361_0110464	3300039447	Bacteria	2508
315	Ga0451849_0502207	3300041505	Bacteria	4701
316	Ga0451851_0721200	3300041507	Bacteria	2484
317	Ga0451853_1085043	3300041512	Bacteria	11446
318	Ga0451853_2453938	3300041512	Bacteria	1042
319	Ga0439431_0041477	3300041997	Bacteria	1173
320	Ga0439434_0080794	3300042435	Bacteria	1031
321	Ga0451577_0015260	3300042876	Bacteria	7149
322	Ga0451577_0132771	3300042876	Bacteria	2234
323	Ga0451577_0169743	3300042876	Bacteria	1966
324	Ga0453683_0040195	3300044673	Bacteria	2937
325	Ga0453683_0048269	3300044673	Bacteria	2670
326	Ga0453683_0201246	3300044673	Bacteria	1264
327	Ga0453683_0365397	3300044673	Bacteria	928
328	Ga0466965_0005093	3300044683	Bacteria	5897
329	Ga0466966_0008814	3300044684	Bacteria	6678
330	Ga0453684_0000001	3300044712	Bacteria	2623166
331	Ga0453684_0253475	3300044712	Bacteria	2020
332	Ga0453684_0261417	3300044712	Bacteria	1982
333	Ga0453684_0548675	3300044712	Bacteria	1273
334	Ga0466959_0007576	3300045049	Bacteria	7629
335	Ga0451576_0006436	3300045051	Bacteria	14399
336	Ga0451576_0013180	3300045051	Bacteria	9251
337	Ga0451576_0020037	3300045051	Bacteria	7291
338	Ga0451576_0044694	3300045051	Bacteria	4668
339	Ga0451576_0074945	3300045051	Bacteria	3521
340	Ga0451576_0317375	3300045051	Bacteria	1630
341	Ga0451576_0896030	3300045051	Bacteria	931
342	Ga0466967_0319169	3300045976	Bacteria	1498
343	Ga0495617_000037	3300046452	Bacteria	134553
344	Ga0495590_0000001	3300046457	Bacteria	762984
345	Ga0495629_0083797	3300046459	Bacteria	2225
346	Ga0495638_0000184	3300046460	Bacteria	95341
347	Ga0495638_0151126	3300046460	Bacteria	1347
348	Ga0495651_0267276	3300046462	Bacteria	1161
349	Ga0495653_0250742	3300046463	Bacteria	1175
350	Ga0495650_0014884	3300046471	Bacteria	4015
351	Ga0495580_0505735	3300046472	Bacteria	806
352	Ga0495585_0000494	3300046492	Bacteria	37273
353	Ga0495583_0000119	3300046506	Bacteria	133447
354	Ga0495608_0005186	3300046511	Bacteria	9311
355	Ga0495610_0000003	3300046512	Bacteria	1203910
356	Ga0495630_0184518	3300046517	Bacteria	1591
357	Ga0495643_0000369	3300046522	Bacteria	61039
358	Ga0495648_0000001	3300046524	Bacteria	696872
359	Ga0495648_0044989	3300046524	Bacteria	2750
360	Ga0495642_0008377	3300046528	Bacteria	3958
361	Ga0495654_0069887	3300046530	Bacteria	1666
362	Ga0495640_0187693	3300046533	Bacteria	1315
363	Ga0495586_0002303	3300046535	Bacteria	10381
364	Ga0495586_0167748	3300046535	Bacteria	1240
365	Ga0495609_0028740	3300046538	Bacteria	2536
366	Ga0495597_0000131	3300046542	Bacteria	68056
367	Ga0495597_0000551	3300046542	Bacteria	31134
368	Ga0495645_0347197	3300046543	Bacteria	957
369	Ga0495622_0000276	3300046557	Bacteria	39002
370	Ga0495622_0013829	3300046557	Bacteria	3744
371	Ga0495622_0101500	3300046557	Bacteria	1318
372	Ga0495633_0008447	3300046558	Bacteria	5793
373	Ga0495633_0009114	3300046558	Bacteria	5509
374	Ga0495667_0060273	3300046559	Bacteria	2489
375	Ga0495667_0144741	3300046559	Bacteria	1531
376	Ga0495667_0205600	3300046559	Bacteria	1259
377	Ga0495667_0327587	3300046559	Bacteria	969
378	Ga0495667_0602680	3300046559	Bacteria	684
379	Ga0495668_0000363	3300046616	Bacteria	60009
380	Ga0495668_0000487	3300046616	Bacteria	49686
381	Ga0495634_0188699	3300046642	Bacteria	1287
382	Ga0495634_0298097	3300046642	Bacteria	975
383	Ga0495625_0000483	3300046660	Bacteria	59571
384	Ga0495625_0005524	3300046660	Bacteria	11492
385	Ga0495625_0147650	3300046660	Bacteria	1582
386	Ga0495635_0102939	3300046663	Bacteria	1951
387	Ga0495659_0012556	3300046664	Bacteria	2746
388	Ga0495623_0010453	3300046679	Bacteria	6008
389	Ga0495658_0054744	3300046683	Bacteria	2270
390	Ga0495613_0069598	3300046689	Bacteria	2565
391	Ga0495613_0097723	3300046689	Bacteria	2122
392	Ga0495589_0219644	3300046794	Bacteria	893
393	Ga0495600_0069339	3300046809	Bacteria	2304
394	Ga0495660_0171054	3300046810	Bacteria	1058
395	Ga0495604_0053116	3300047317	Bacteria	3134
396	Ga0495674_0115787	3300047319	Unclassified	2269
397	Ga0495674_0527920	3300047319	Bacteria	942
398	Ga0495672_0000097	3300047320	Bacteria	141608
399	Ga0495680_0342894	3300047322	Bacteria	1042
400	Ga0495687_006415	3300047443	Bacteria	7211
401	Ga0495675_0211127	3300047444	Bacteria	1178
402	Ga0495675_0448255	3300047444	Bacteria	747
403	Ga0495675_0571877	3300047444	Bacteria	643
404	Ga0495673_0000100	3300047469	Bacteria	173962
405	Ga0495593_0011732	3300047673	Bacteria	5026
406	Ga0495678_032567	3300049459	Bacteria	2158
407	Ga0501031_0001565	3300049568	Bacteria	14245
408	Ga0501033_0000021	3300049570	Bacteria	192208
409	Ga0501033_0218253	3300049570	Unclassified	1358
410	Ga0501034_0198514	3300049571	Bacteria	1965
411	Ga0501034_0217990	3300049571	Bacteria	1861
412	Ga0501036_0030192	3300049572	Bacteria	4580
413	Ga0501037_0000020	3300049573	Bacteria	155468
414	Ga0501039_0001756	3300049575	Bacteria	15993
415	Ga0501043_0000064	3300049579	Bacteria	93899
416	Ga0501043_0000514	3300049579	Bacteria	34829
417	Ga0501046_0003816	3300049580	Bacteria	13786
418	Ga0501046_0027952	3300049580	Bacteria	4597
419	Ga0501046_0309338	3300049580	Bacteria	1153
420	Ga0501047_0015403	3300049581	Bacteria	7284
421	Ga0501047_0252671	3300049581	Bacteria	1611
422	Ga0501047_0338922	3300049581	Bacteria	1341
423	Ga0501047_0402883	3300049581	Bacteria	1201
424	Ga0501048_0128891	3300049582	Bacteria	1789
425	Ga0501048_0495260	3300049582	Unclassified	876
426	Ga0501070_0000840	3300049586	Bacteria	27876
427	Ga0501071_0058152	3300049587	Bacteria	2795
428	Ga0501071_0132190	3300049587	Bacteria	1855
429	Ga0501073_0327788	3300049589	Bacteria	1057
430	Ga0501077_0166990	3300049593	Bacteria	1398
431	Ga0501079_0611740	3300049741	Bacteria	857
432	Ga0501080_0197274	3300049742	Bacteria	1849
433	Ga0501081_0136778	3300049743	Bacteria	1754
434	Ga0501083_0011136	3300049744	Bacteria	6314
435	Ga0501083_0033237	3300049744	Bacteria	3533
436	Ga0501035_0000216	3300049822	Bacteria	69506
437	Ga0501044_0000510	3300049823	Bacteria	47224
438	Ga0501044_0228948	3300049823	Bacteria	1807
439	Ga0501044_0337930	3300049823	Bacteria	1427
440	Ga0501044_0615171	3300049823	Bacteria	978
441	nmdc:mga03683_30406_c1	3300050489	Bacteria	2161
442	nmdc:mga05p37_1128571_c1	3300050507	Bacteria	818
443	nmdc:mga05p37_117361_c1	3300050507	Bacteria	3270
444	nmdc:mga05p37_25866_c2	3300050507	Bacteria	4617
445	nmdc:mga05p37_56487_c1	3300050507	Bacteria	4833
446	nmdc:mga05p37_583435_c1	3300050507	Bacteria	1265
447	nmdc:mga09592_87594_c1	3300050508	Bacteria	2658
448	nmdc:mga08y16_85175_c1	3300050511	Bacteria	3294
449	nmdc:mga08y16_91209_c1	3300050511	Bacteria	3176
450	nmdc:mga0n895_173680_c1	3300050512	Bacteria	2186
451	nmdc:mga0n895_571655_c1	3300050512	Bacteria	1135
452	nmdc:mga0rr50_397_c1	3300050513	Bacteria	23630
453	nmdc:mga08x19_179096_c1	3300050514	Bacteria	1446
454	nmdc:mga08x19_3_c1	3300050514	Bacteria	654433
455	Ga0495601_0005209	3300053077	Bacteria	7562
456	Ga0495601_0385054	3300053077	Bacteria	910
457	Ga0495595_0070264	3300053084	Bacteria	1654
458	Ga0495619_0002653	3300053085	Bacteria	11693
459	Ga0500636_0084116	3300053177	Bacteria	1830
460	Ga0501084_0166255	3300054114	Bacteria	1862
461	Ga0500661_027250	3300055283	Bacteria	1010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009174	Ga0105241_10106442	Ga0105241_101064422	193
2	3300046557	Ga0495622_0101500	Ga0495622_0101500_43_636	197
3	3300046559	Ga0495667_0602680	Ga0495667_0602680_73_666	197
4	3300047444	Ga0495675_0448255	Ga0495675_0448255_16_609	197
5	3300047444	Ga0495675_0571877	Ga0495675_0571877_19_612	197
6	3300046535	Ga0495586_0167748	Ga0495586_0167748_39_734	198
7	3300025911	Ga0207654_10194046	Ga0207654_101940461	207
8	3300009177	Ga0105248_10003182	Ga0105248_1000318217	215
9	3300025941	Ga0207711_10186120	Ga0207711_101861203	215
10	3300044684	Ga0466966_0008814	Ga0466966_0008814_2944_3675	218
11	3300045049	Ga0466959_0007576	Ga0466959_0007576_5323_6054	218
12	3300046542	Ga0495597_0000551	Ga0495597_0000551_5261_5962	225
13	3300005518	Ga0070699_100002241	Ga0070699_1000022415	228
14	3300005536	Ga0070697_100070526	Ga0070697_1000705263	228
15	3300050514	nmdc:mga08x19_179096_c1	nmdc:mga08x19_179096_c1_494_1180	228
16	iso_pu_bacteria	2738541297	2738829373	228
17	iso_pu_bacteria	2738541357	2739153169	228
18	iso_pu_bacteria	2738543003	2739195089	228
19	iso_pu_bacteria	2738543026	2739321565	228
20	iso_pu_bacteria	2738543029	2739339879	228
21	iso_pu_bacteria	2857558681	2857559936	228
22	iso_pu_bacteria	2857564685	2857564888	228
23	iso_pu_bacteria	2920107658	2920115202	228
24	3300006844	Ga0075428_100018794	Ga0075428_1000187946	229
25	3300003323	rootH1_10018468	rootH1_1001846810	230
26	3300005518	Ga0070699_100021444	Ga0070699_1000214448	230
27	3300005536	Ga0070697_100012312	Ga0070697_1000123126	230
28	3300005614	Ga0068856_100000421	Ga0068856_10000042123	230
29	3300005617	Ga0068859_100052334	Ga0068859_1000523345	230
30	3300006931	Ga0097620_100052333	Ga0097620_1000523332	230
31	3300009094	Ga0111539_10133169	Ga0111539_101331693	230
32	3300037466	Ga0395898_0000057	Ga0395898_0000057_166166_166858	230
33	3300044683	Ga0466965_0005093	Ga0466965_0005093_4752_5444	230
34	3300049568	Ga0501031_0001565	Ga0501031_0001565_13358_14050	230
35	3300049570	Ga0501033_0000021	Ga0501033_0000021_188247_188939	230
36	3300049572	Ga0501036_0030192	Ga0501036_0030192_2813_3505	230
37	3300049573	Ga0501037_0000020	Ga0501037_0000020_36480_37172	230
38	3300049575	Ga0501039_0001756	Ga0501039_0001756_4642_5334	230
39	3300049579	Ga0501043_0000064	Ga0501043_0000064_88090_88782	230
40	3300049579	Ga0501043_0000514	Ga0501043_0000514_3568_4260	230
41	3300049581	Ga0501047_0015403	Ga0501047_0015403_461_1153	230
42	3300049581	Ga0501047_0252671	Ga0501047_0252671_453_1145	230
43	3300049586	Ga0501070_0000840	Ga0501070_0000840_7185_7877	230
44	3300049587	Ga0501071_0058152	Ga0501071_0058152_935_1627	230
45	3300049822	Ga0501035_0000216	Ga0501035_0000216_42040_42732	230
46	3300049823	Ga0501044_0000510	Ga0501044_0000510_17512_18204	230
47	3300049823	Ga0501044_0337930	Ga0501044_0337930_542_1234	230
48	3300003323	rootH1_10184247	rootH1_101842472	231
49	3300005327	Ga0070658_10023581	Ga0070658_100235813	231
50	3300005327	Ga0070658_10195220	Ga0070658_101952201	231
51	3300005330	Ga0070690_100002944	Ga0070690_1000029449	231
52	3300005337	Ga0070682_100065625	Ga0070682_1000656252	231
53	3300005340	Ga0070689_100305446	Ga0070689_1003054462	231
54	3300005355	Ga0070671_100222470	Ga0070671_1002224702	231
55	3300005439	Ga0070711_100002325	Ga0070711_1000023259	231
56	3300005544	Ga0070686_100673451	Ga0070686_1006734511	231
57	3300005614	Ga0068856_100176597	Ga0068856_1001765972	231
58	3300005615	Ga0070702_100327259	Ga0070702_1003272592	231
59	3300005843	Ga0068860_100000754	Ga0068860_10000075410	231
60	3300005985	Ga0081539_10174079	Ga0081539_101740791	231
61	3300025909	Ga0207705_10018195	Ga0207705_100181953	231
62	3300028556	Ga0265337_1002357	Ga0265337_10023578	231
63	3300028573	Ga0265334_10053352	Ga0265334_100533523	231
64	3300028577	Ga0265318_10044428	Ga0265318_100444281	231
65	3300028653	Ga0265323_10036285	Ga0265323_100362851	231
66	3300028800	Ga0265338_10000269	Ga0265338_1000026973	231
67	3300028800	Ga0265338_10000690	Ga0265338_1000069035	231
68	3300028800	Ga0265338_10035111	Ga0265338_100351114	231
69	3300028800	Ga0265338_10142987	Ga0265338_101429872	231
70	3300031235	Ga0265330_10019767	Ga0265330_100197672	231
71	3300031235	Ga0265330_10173473	Ga0265330_101734731	231
72	3300031238	Ga0265332_10069212	Ga0265332_100692122	231
73	3300031239	Ga0265328_10000045	Ga0265328_1000004548	231
74	3300031240	Ga0265320_10160594	Ga0265320_101605942	231
75	3300031242	Ga0265329_10006593	Ga0265329_100065933	231
76	3300031251	Ga0265327_10028608	Ga0265327_100286084	231
77	3300031344	Ga0265316_10036018	Ga0265316_100360182	231
78	3300031344	Ga0265316_10039079	Ga0265316_100390793	231
79	3300031456	Ga0307513_10084604	Ga0307513_100846042	231
80	3300031711	Ga0265314_10000107	Ga0265314_100001077	231
81	3300031711	Ga0265314_10087327	Ga0265314_100873272	231
82	3300041505	Ga0451849_0502207	Ga0451849_0502207_3260_3955	231
83	3300041507	Ga0451851_0721200	Ga0451851_0721200_1188_1883	231
84	3300041512	Ga0451853_1085043	Ga0451853_1085043_9985_10680	231
85	3300042876	Ga0451577_0169743	Ga0451577_0169743_1199_1894	231
86	3300044712	Ga0453684_0000001	Ga0453684_0000001_1701536_1702291	231
87	3300045051	Ga0451576_0006436	Ga0451576_0006436_9053_9748	231
88	3300045051	Ga0451576_0020037	Ga0451576_0020037_6205_7245	231
89	3300045051	Ga0451576_0074945	Ga0451576_0074945_2123_2818	231
90	3300046517	Ga0495630_0184518	Ga0495630_0184518_491_1186	231
91	3300046533	Ga0495640_0187693	Ga0495640_0187693_343_1038	231
92	3300046543	Ga0495645_0347197	Ga0495645_0347197_34_729	231
93	3300046559	Ga0495667_0327587	Ga0495667_0327587_144_839	231
94	3300046642	Ga0495634_0298097	Ga0495634_0298097_116_811	231
95	3300046683	Ga0495658_0054744	Ga0495658_0054744_773_1474	231
96	3300049581	Ga0501047_0402883	Ga0501047_0402883_108_803	231
97	3300049742	Ga0501080_0197274	Ga0501080_0197274_460_1155	231
98	3300049744	Ga0501083_0011136	Ga0501083_0011136_1584_2279	231
99	3300053077	Ga0495601_0385054	Ga0495601_0385054_40_825	231
100	3300053177	Ga0500636_0084116	Ga0500636_0084116_1040_1735	231
101	3300001432	JGI24034J14986_100187	JGI24034J14986_1001871	232
102	3300002074	JGI24748J21848_1000073	JGI24748J21848_100007323	232
103	3300002239	JGI24034J26672_10000013	JGI24034J26672_10000013121	232
104	3300002774	JGI25150J39212_1012412	JGI25150J39212_10124121	232
105	3300003215	JGI25153J46596_10034559	JGI25153J46596_100345592	232
106	3300003320	rootH2_10022708	rootH2_1002270833	232
107	3300005295	Ga0065707_10098502	Ga0065707_100985024	232
108	3300005330	Ga0070690_100009093	Ga0070690_1000090935	232
109	3300005330	Ga0070690_100158270	Ga0070690_1001582702	232
110	3300005331	Ga0070670_100054699	Ga0070670_1000546996	232
111	3300005331	Ga0070670_100518252	Ga0070670_1005182522	232
112	3300005334	Ga0068869_100066220	Ga0068869_1000662202	232
113	3300005335	Ga0070666_10095169	Ga0070666_100951693	232
114	3300005338	Ga0068868_100047113	Ga0068868_1000471134	232
115	3300005338	Ga0068868_100352200	Ga0068868_1003522002	232
116	3300005343	Ga0070687_100411369	Ga0070687_1004113691	232
117	3300005347	Ga0070668_100494848	Ga0070668_1004948482	232
118	3300005354	Ga0070675_100147342	Ga0070675_1001473423	232
119	3300005355	Ga0070671_100058912	Ga0070671_1000589122	232
120	3300005356	Ga0070674_100155223	Ga0070674_1001552233	232
121	3300005364	Ga0070673_100121740	Ga0070673_1001217402	232
122	3300005365	Ga0070688_100256637	Ga0070688_1002566372	232
123	3300005406	Ga0070703_10000054	Ga0070703_1000005424	232
124	3300005406	Ga0070703_10136317	Ga0070703_101363171	232
125	3300005434	Ga0070709_10264873	Ga0070709_102648732	232
126	3300005436	Ga0070713_100112801	Ga0070713_1001128011	232
127	3300005436	Ga0070713_100124178	Ga0070713_1001241783	232
128	3300005436	Ga0070713_100910527	Ga0070713_1009105271	232
129	3300005438	Ga0070701_10225363	Ga0070701_102253632	232
130	3300005438	Ga0070701_10262636	Ga0070701_102626361	232
131	3300005440	Ga0070705_100023861	Ga0070705_1000238612	232
132	3300005440	Ga0070705_100163679	Ga0070705_1001636792	232
133	3300005440	Ga0070705_100169185	Ga0070705_1001691852	232
134	3300005441	Ga0070700_100102309	Ga0070700_1001023093	232
135	3300005441	Ga0070700_100143153	Ga0070700_1001431533	232
136	3300005444	Ga0070694_100000315	Ga0070694_10000031511	232
137	3300005445	Ga0070708_100089677	Ga0070708_1000896771	232
138	3300005445	Ga0070708_100284090	Ga0070708_1002840902	232
139	3300005445	Ga0070708_100580552	Ga0070708_1005805521	232
140	3300005456	Ga0070678_100241587	Ga0070678_1002415871	232
141	3300005456	Ga0070678_100474985	Ga0070678_1004749852	232
142	3300005459	Ga0068867_100131208	Ga0068867_1001312083	232
143	3300005467	Ga0070706_100002898	Ga0070706_1000028982	232
144	3300005467	Ga0070706_100015454	Ga0070706_1000154542	232
145	3300005467	Ga0070706_100016785	Ga0070706_1000167853	232
146	3300005468	Ga0070707_100000197	Ga0070707_10000019755	232
147	3300005468	Ga0070707_100000616	Ga0070707_1000006163	232
148	3300005468	Ga0070707_100013234	Ga0070707_1000132342	232
149	3300005468	Ga0070707_100117129	Ga0070707_1001171292	232
150	3300005468	Ga0070707_100264291	Ga0070707_1002642912	232
151	3300005471	Ga0070698_100003216	Ga0070698_1000032164	232
152	3300005471	Ga0070698_100047080	Ga0070698_1000470806	232
153	3300005535	Ga0070684_100103112	Ga0070684_1001031122	232
154	3300005536	Ga0070697_100045100	Ga0070697_1000451002	232
155	3300005536	Ga0070697_100189937	Ga0070697_1001899372	232
156	3300005536	Ga0070697_100238632	Ga0070697_1002386321	232
157	3300005543	Ga0070672_100141709	Ga0070672_1001417092	232
158	3300005544	Ga0070686_100141061	Ga0070686_1001410612	232
159	3300005544	Ga0070686_100569485	Ga0070686_1005694851	232
160	3300005545	Ga0070695_100049354	Ga0070695_1000493544	232
161	3300005546	Ga0070696_100133726	Ga0070696_1001337262	232
162	3300005546	Ga0070696_100222313	Ga0070696_1002223132	232
163	3300005548	Ga0070665_100821607	Ga0070665_1008216072	232
164	3300005549	Ga0070704_100011731	Ga0070704_1000117315	232
165	3300005549	Ga0070704_100214711	Ga0070704_1002147111	232
166	3300005549	Ga0070704_100627703	Ga0070704_1006277032	232
167	3300005563	Ga0068855_100111108	Ga0068855_1001111082	232
168	3300005563	Ga0068855_100149868	Ga0068855_1001498682	232
169	3300005563	Ga0068855_100363597	Ga0068855_1003635972	232
170	3300005564	Ga0070664_100631989	Ga0070664_1006319892	232
171	3300005577	Ga0068857_100102724	Ga0068857_1001027243	232
172	3300005616	Ga0068852_100562143	Ga0068852_1005621431	232
173	3300005617	Ga0068859_100096894	Ga0068859_1000968943	232
174	3300005617	Ga0068859_100533501	Ga0068859_1005335012	232
175	3300005618	Ga0068864_100121969	Ga0068864_1001219694	232
176	3300005618	Ga0068864_100363247	Ga0068864_1003632472	232
177	3300005618	Ga0068864_100594638	Ga0068864_1005946382	232
178	3300005618	Ga0068864_100631171	Ga0068864_1006311712	232
179	3300005718	Ga0068866_10050182	Ga0068866_100501822	232
180	3300005841	Ga0068863_100256398	Ga0068863_1002563982	232
181	3300005841	Ga0068863_100561469	Ga0068863_1005614692	232
182	3300005842	Ga0068858_100000214	Ga0068858_10000021411	232
183	3300005842	Ga0068858_100038533	Ga0068858_1000385334	232
184	3300005842	Ga0068858_100054151	Ga0068858_1000541514	232
185	3300005842	Ga0068858_100436289	Ga0068858_1004362892	232
186	3300005843	Ga0068860_100016802	Ga0068860_1000168024	232
187	3300005843	Ga0068860_100018984	Ga0068860_1000189844	232
188	3300005843	Ga0068860_100319553	Ga0068860_1003195532	232
189	3300005844	Ga0068862_100309770	Ga0068862_1003097702	232
190	3300005844	Ga0068862_100873421	Ga0068862_1008734211	232
191	3300006028	Ga0070717_10210567	Ga0070717_102105673	232
192	3300006028	Ga0070717_10872437	Ga0070717_108724371	232
193	3300006177	Ga0075362_10043842	Ga0075362_100438422	232
194	3300006237	Ga0097621_100022453	Ga0097621_1000224533	232
195	3300006358	Ga0068871_100014329	Ga0068871_1000143295	232
196	3300006844	Ga0075428_101275288	Ga0075428_1012752881	232
197	3300006871	Ga0075434_100223151	Ga0075434_1002231511	232
198	3300006881	Ga0068865_100084320	Ga0068865_1000843202	232
199	3300006914	Ga0075436_100000015	Ga0075436_10000001583	232
200	3300006931	Ga0097620_100096896	Ga0097620_1000968963	232
201	3300006931	Ga0097620_100440850	Ga0097620_1004408502	232
202	3300006931	Ga0097620_100533569	Ga0097620_1005335692	232
203	3300007076	Ga0075435_100000419	Ga0075435_1000004195	232
204	3300007076	Ga0075435_100155288	Ga0075435_1001552882	232
205	3300007265	Ga0099794_10040405	Ga0099794_100404051	232
206	3300009093	Ga0105240_10001445	Ga0105240_1000144537	232
207	3300009093	Ga0105240_10105140	Ga0105240_101051403	232
208	3300009093	Ga0105240_10194282	Ga0105240_101942822	232
209	3300009093	Ga0105240_10958012	Ga0105240_109580121	232
210	3300009094	Ga0111539_10103615	Ga0111539_101036153	232
211	3300009098	Ga0105245_10352652	Ga0105245_103526523	232
212	3300009098	Ga0105245_10941049	Ga0105245_109410491	232
213	3300009101	Ga0105247_10000015	Ga0105247_100000159	232
214	3300009101	Ga0105247_10529475	Ga0105247_105294751	232
215	3300009147	Ga0114129_10071122	Ga0114129_100711226	232
216	3300009147	Ga0114129_10093216	Ga0114129_100932164	232
217	3300009147	Ga0114129_10105757	Ga0114129_101057573	232
218	3300009147	Ga0114129_11333810	Ga0114129_113338101	232
219	3300009148	Ga0105243_10000198	Ga0105243_100001985	232
220	3300009148	Ga0105243_10001478	Ga0105243_100014788	232
221	3300009148	Ga0105243_10508419	Ga0105243_105084192	232
222	3300009176	Ga0105242_10000072	Ga0105242_1000007245	232
223	3300009176	Ga0105242_10000163	Ga0105242_1000016328	232
224	3300009176	Ga0105242_10003440	Ga0105242_100034407	232
225	3300009176	Ga0105242_10006243	Ga0105242_100062439	232
226	3300009176	Ga0105242_10023634	Ga0105242_100236346	232
227	3300009176	Ga0105242_10205597	Ga0105242_102055972	232
228	3300009177	Ga0105248_10353672	Ga0105248_103536722	232
229	3300009545	Ga0105237_10014349	Ga0105237_100143494	232
230	3300009551	Ga0105238_10012487	Ga0105238_100124873	232
231	3300009551	Ga0105238_10053281	Ga0105238_100532813	232
232	3300009553	Ga0105249_10081980	Ga0105249_100819802	232
233	3300010375	Ga0105239_10017271	Ga0105239_100172719	232
234	3300010375	Ga0105239_10080374	Ga0105239_100803742	232
235	3300013104	Ga0157370_10316354	Ga0157370_103163542	232
236	3300013105	Ga0157369_10054919	Ga0157369_100549192	232
237	3300013297	Ga0157378_10000111	Ga0157378_100001119	232
238	3300013297	Ga0157378_10063430	Ga0157378_100634304	232
239	3300013306	Ga0163162_10025302	Ga0163162_100253026	232
240	3300013306	Ga0163162_10042634	Ga0163162_100426343	232
241	3300013306	Ga0163162_10549893	Ga0163162_105498932	232
242	3300013306	Ga0163162_11096192	Ga0163162_110961922	232
243	3300013307	Ga0157372_10002746	Ga0157372_1000274613	232
244	3300013308	Ga0157375_10006618	Ga0157375_100066182	232
245	3300013308	Ga0157375_10215673	Ga0157375_102156733	232
246	3300013308	Ga0157375_11224387	Ga0157375_112243871	232
247	3300014325	Ga0163163_10358108	Ga0163163_103581082	232
248	3300014745	Ga0157377_10077737	Ga0157377_100777372	232
249	3300014969	Ga0157376_10077720	Ga0157376_100777203	232
250	3300017792	Ga0163161_10105815	Ga0163161_101058152	232
251	3300017792	Ga0163161_10318547	Ga0163161_103185472	232
252	3300022467	Ga0224712_10011657	Ga0224712_100116573	232
253	3300025223	Ga0207672_1000511	Ga0207672_10005114	232
254	3300025233	Ga0209437_105654	Ga0209437_1056542	232
255	3300025245	Ga0207425_1001276	Ga0207425_100127612	232
256	3300025246	Ga0209646_1000010	Ga0209646_1000010199	232
257	3300025294	Ga0209025_1003131	Ga0209025_100313117	232
258	3300025297	Ga0209758_1002737	Ga0209758_10027374	232
259	3300025728	Ga0207655_1008385	Ga0207655_10083856	232
260	3300025885	Ga0207653_10000026	Ga0207653_1000002621	232
261	3300025900	Ga0207710_10000004	Ga0207710_10000004738	232
262	3300025906	Ga0207699_10586915	Ga0207699_105869151	232
263	3300025910	Ga0207684_10000795	Ga0207684_1000079532	232
264	3300025912	Ga0207707_10126884	Ga0207707_101268843	232
265	3300025913	Ga0207695_10009116	Ga0207695_1000911611	232
266	3300025913	Ga0207695_10149824	Ga0207695_101498242	232
267	3300025913	Ga0207695_10286306	Ga0207695_102863062	232
268	3300025918	Ga0207662_10066284	Ga0207662_100662842	232
269	3300025920	Ga0207649_10000026	Ga0207649_1000002651	232
270	3300025922	Ga0207646_10001008	Ga0207646_1000100836	232
271	3300025922	Ga0207646_10001342	Ga0207646_100013427	232
272	3300025922	Ga0207646_10085935	Ga0207646_100859352	232
273	3300025922	Ga0207646_10136838	Ga0207646_101368382	232
274	3300025922	Ga0207646_10170401	Ga0207646_101704012	232
275	3300025922	Ga0207646_10203810	Ga0207646_102038102	232
276	3300025923	Ga0207681_10060253	Ga0207681_100602532	232
277	3300025923	Ga0207681_10140684	Ga0207681_101406842	232
278	3300025924	Ga0207694_10009217	Ga0207694_100092173	232
279	3300025924	Ga0207694_10012987	Ga0207694_100129873	232
280	3300025924	Ga0207694_10102626	Ga0207694_101026263	232
281	3300025925	Ga0207650_10289745	Ga0207650_102897451	232
282	3300025926	Ga0207659_10039692	Ga0207659_100396922	232
283	3300025927	Ga0207687_10155191	Ga0207687_101551913	232
284	3300025927	Ga0207687_10454504	Ga0207687_104545041	232
285	3300025928	Ga0207700_10138142	Ga0207700_101381421	232
286	3300025928	Ga0207700_10306897	Ga0207700_103068971	232
287	3300025928	Ga0207700_10818261	Ga0207700_108182611	232
288	3300025931	Ga0207644_10000159	Ga0207644_1000015940	232
289	3300025934	Ga0207686_10000057	Ga0207686_1000005715	232
290	3300025934	Ga0207686_10000098	Ga0207686_1000009840	232
291	3300025934	Ga0207686_10104827	Ga0207686_101048272	232
292	3300025935	Ga0207709_10000140	Ga0207709_1000014015	232
293	3300025935	Ga0207709_10009932	Ga0207709_100099324	232
294	3300025935	Ga0207709_10411719	Ga0207709_104117191	232
295	3300025936	Ga0207670_10094184	Ga0207670_100941843	232
296	3300025936	Ga0207670_10285957	Ga0207670_102859572	232
297	3300025938	Ga0207704_10069352	Ga0207704_100693522	232
298	3300025939	Ga0207665_10068807	Ga0207665_100688072	232
299	3300025940	Ga0207691_10074342	Ga0207691_100743425	232
300	3300025941	Ga0207711_10213733	Ga0207711_102137332	232
301	3300025941	Ga0207711_10247446	Ga0207711_102474462	232
302	3300025942	Ga0207689_10047352	Ga0207689_100473525	232
303	3300025945	Ga0207679_10055540	Ga0207679_100555403	232
304	3300025949	Ga0207667_10005989	Ga0207667_100059899	232
305	3300025949	Ga0207667_10092564	Ga0207667_100925642	232
306	3300025949	Ga0207667_10309716	Ga0207667_103097162	232
307	3300025960	Ga0207651_10031433	Ga0207651_100314333	232
308	3300025960	Ga0207651_10046739	Ga0207651_100467394	232
309	3300025960	Ga0207651_10221104	Ga0207651_102211042	232
310	3300025986	Ga0207658_10857629	Ga0207658_108576291	232
311	3300026035	Ga0207703_10000084	Ga0207703_100000849	232
312	3300026035	Ga0207703_10137644	Ga0207703_101376442	232
313	3300026035	Ga0207703_10390645	Ga0207703_103906452	232
314	3300026075	Ga0207708_10114604	Ga0207708_101146043	232
315	3300026075	Ga0207708_10138778	Ga0207708_101387782	232
316	3300026078	Ga0207702_10289259	Ga0207702_102892592	232
317	3300026089	Ga0207648_10008101	Ga0207648_100081011	232
318	3300026095	Ga0207676_10017465	Ga0207676_100174655	232
319	3300026095	Ga0207676_10345678	Ga0207676_103456782	232
320	3300026095	Ga0207676_10449100	Ga0207676_104491002	232
321	3300026095	Ga0207676_10500444	Ga0207676_105004441	232
322	3300026121	Ga0207683_10217693	Ga0207683_102176932	232
323	3300026142	Ga0207698_10130902	Ga0207698_101309022	232
324	3300027360	Ga0209969_1000757	Ga0209969_10007576	232
325	3300027364	Ga0209967_1000508	Ga0209967_10005085	232
326	3300027378	Ga0209981_1001187	Ga0209981_10011873	232
327	3300027395	Ga0209996_1001489	Ga0209996_10014893	232
328	3300027424	Ga0209984_1003016	Ga0209984_10030161	232
329	3300027462	Ga0210000_1000253	Ga0210000_10002537	232
330	3300027471	Ga0209995_1001001	Ga0209995_10010016	232
331	3300027543	Ga0209999_1008683	Ga0209999_10086834	232
332	3300027665	Ga0209983_1008707	Ga0209983_10087072	232
333	3300027682	Ga0209971_1013470	Ga0209971_10134702	232
334	3300027876	Ga0209974_10002424	Ga0209974_100024246	232
335	3300027907	Ga0207428_10015234	Ga0207428_100152346	232
336	3300027907	Ga0207428_10072549	Ga0207428_100725491	232
337	3300028380	Ga0268265_10246820	Ga0268265_102468201	232
338	3300028381	Ga0268264_10017190	Ga0268264_100171906	232
339	3300028381	Ga0268264_10025251	Ga0268264_100252512	232
340	3300028800	Ga0265338_10164163	Ga0265338_101641632	232
341	3300030744	Ga0316181_1115615	Ga0316181_11156152	232
342	3300031250	Ga0265331_10000067	Ga0265331_100000674	232
343	3300031251	Ga0265327_10000036	Ga0265327_1000003652	232
344	3300031251	Ga0265327_10000468	Ga0265327_1000046819	232
345	3300031251	Ga0265327_10005989	Ga0265327_100059892	232
346	3300031548	Ga0307408_100970391	Ga0307408_1009703911	232
347	3300031665	Ga0316575_10014239	Ga0316575_100142392	232
348	3300031711	Ga0265314_10093749	Ga0265314_100937493	232
349	3300031712	Ga0265342_10113209	Ga0265342_101132092	232
350	3300031728	Ga0316578_10137492	Ga0316578_101374922	232
351	3300031733	Ga0316577_10170216	Ga0316577_101702161	232
352	3300031733	Ga0316577_10250572	Ga0316577_102505721	232
353	3300033527	Ga0316586_1006975	Ga0316586_10069751	232
354	3300035241	Ga0373961_0029986	Ga0373961_0029986_529_1233	232
355	3300035398	Ga0316574_0006105	Ga0316574_0006105_1485_2183	232
356	3300035398	Ga0316574_0349770	Ga0316574_0349770_26_748	232
357	3300036647	Ga0316582_0007648	Ga0316582_0007648_2802_3524	232
358	3300036712	Ga0316584_0011569	Ga0316584_0011569_1397_2119	232
359	3300036712	Ga0316584_0042742	Ga0316584_0042742_646_1344	232
360	3300036712	Ga0316584_0224376	Ga0316584_0224376_556_1254	232
361	3300037471	Ga0395905_0004885	Ga0395905_0004885_7068_7766	232
362	3300039438	Ga0436360_0349878	Ga0436360_0349878_858_1556	232
363	3300039438	Ga0436360_0585151	Ga0436360_0585151_651_1349	232
364	3300039438	Ga0436360_1306473	Ga0436360_1306473_6476_7174	232
365	3300039447	Ga0436361_0110464	Ga0436361_0110464_953_1651	232
366	3300041512	Ga0451853_2453938	Ga0451853_2453938_79_777	232
367	3300041997	Ga0439431_0041477	Ga0439431_0041477_131_832	232
368	3300042435	Ga0439434_0080794	Ga0439434_0080794_195_896	232
369	3300042876	Ga0451577_0015260	Ga0451577_0015260_2628_3326	232
370	3300042876	Ga0451577_0132771	Ga0451577_0132771_886_1584	232
371	3300044673	Ga0453683_0040195	Ga0453683_0040195_2052_2750	232
372	3300044673	Ga0453683_0048269	Ga0453683_0048269_898_1596	232
373	3300044673	Ga0453683_0201246	Ga0453683_0201246_229_927	232
374	3300044673	Ga0453683_0365397	Ga0453683_0365397_56_754	232
375	3300044712	Ga0453684_0253475	Ga0453684_0253475_1262_1960	232
376	3300044712	Ga0453684_0261417	Ga0453684_0261417_667_1365	232
377	3300044712	Ga0453684_0548675	Ga0453684_0548675_483_1181	232
378	3300045051	Ga0451576_0013180	Ga0451576_0013180_5776_6474	232
379	3300045051	Ga0451576_0044694	Ga0451576_0044694_3150_3848	232
380	3300045051	Ga0451576_0317375	Ga0451576_0317375_767_1483	232
381	3300045051	Ga0451576_0896030	Ga0451576_0896030_73_771	232
382	3300045976	Ga0466967_0319169	Ga0466967_0319169_104_802	232
383	3300046452	Ga0495617_000037	Ga0495617_000037_29034_29738	232
384	3300046457	Ga0495590_0000001	Ga0495590_0000001_743885_744586	232
385	3300046459	Ga0495629_0083797	Ga0495629_0083797_1402_2103	232
386	3300046460	Ga0495638_0000184	Ga0495638_0000184_77471_78172	232
387	3300046460	Ga0495638_0151126	Ga0495638_0151126_113_898	232
388	3300046462	Ga0495651_0267276	Ga0495651_0267276_36_734	232
389	3300046463	Ga0495653_0250742	Ga0495653_0250742_90_788	232
390	3300046471	Ga0495650_0014884	Ga0495650_0014884_3233_3934	232
391	3300046472	Ga0495580_0505735	Ga0495580_0505735_32_733	232
392	3300046492	Ga0495585_0000494	Ga0495585_0000494_12582_13286	232
393	3300046506	Ga0495583_0000119	Ga0495583_0000119_17113_17814	232
394	3300046511	Ga0495608_0005186	Ga0495608_0005186_3515_4213	232
395	3300046512	Ga0495610_0000003	Ga0495610_0000003_442214_442918	232
396	3300046522	Ga0495643_0000369	Ga0495643_0000369_44086_44787	232
397	3300046524	Ga0495648_0000001	Ga0495648_0000001_26408_27109	232
398	3300046524	Ga0495648_0044989	Ga0495648_0044989_29_733	232
399	3300046528	Ga0495642_0008377	Ga0495642_0008377_1968_2669	232
400	3300046530	Ga0495654_0069887	Ga0495654_0069887_887_1591	232
401	3300046535	Ga0495586_0002303	Ga0495586_0002303_1573_2274	232
402	3300046538	Ga0495609_0028740	Ga0495609_0028740_622_1323	232
403	3300046542	Ga0495597_0000131	Ga0495597_0000131_51214_51915	232
404	3300046557	Ga0495622_0000276	Ga0495622_0000276_6302_7003	232
405	3300046557	Ga0495622_0013829	Ga0495622_0013829_2703_3404	232
406	3300046558	Ga0495633_0008447	Ga0495633_0008447_1829_2530	232
407	3300046558	Ga0495633_0009114	Ga0495633_0009114_2985_3689	232
408	3300046559	Ga0495667_0060273	Ga0495667_0060273_1678_2376	232
409	3300046559	Ga0495667_0144741	Ga0495667_0144741_175_876	232
410	3300046559	Ga0495667_0205600	Ga0495667_0205600_29_727	232
411	3300046616	Ga0495668_0000363	Ga0495668_0000363_59219_59923	232
412	3300046616	Ga0495668_0000487	Ga0495668_0000487_31588_32289	232
413	3300046642	Ga0495634_0188699	Ga0495634_0188699_389_1090	232
414	3300046660	Ga0495625_0000483	Ga0495625_0000483_16133_16834	232
415	3300046660	Ga0495625_0005524	Ga0495625_0005524_10654_11385	232
416	3300046660	Ga0495625_0147650	Ga0495625_0147650_83_787	232
417	3300046663	Ga0495635_0102939	Ga0495635_0102939_1093_1791	232
418	3300046664	Ga0495659_0012556	Ga0495659_0012556_196_894	232
419	3300046679	Ga0495623_0010453	Ga0495623_0010453_4220_4921	232
420	3300046689	Ga0495613_0069598	Ga0495613_0069598_651_1352	232
421	3300046689	Ga0495613_0097723	Ga0495613_0097723_571_1317	232
422	3300046794	Ga0495589_0219644	Ga0495589_0219644_93_797	232
423	3300046809	Ga0495600_0069339	Ga0495600_0069339_914_1615	232
424	3300046810	Ga0495660_0171054	Ga0495660_0171054_84_785	232
425	3300047317	Ga0495604_0053116	Ga0495604_0053116_697_1395	232
426	3300047319	Ga0495674_0115787	Ga0495674_0115787_1250_1948	232
427	3300047319	Ga0495674_0527920	Ga0495674_0527920_161_862	232
428	3300047320	Ga0495672_0000097	Ga0495672_0000097_58974_59675	232
429	3300047322	Ga0495680_0342894	Ga0495680_0342894_13_759	232
430	3300047443	Ga0495687_006415	Ga0495687_006415_105_806	232
431	3300047444	Ga0495675_0211127	Ga0495675_0211127_208_906	232
432	3300047469	Ga0495673_0000100	Ga0495673_0000100_144151_144936	232
433	3300047673	Ga0495593_0011732	Ga0495593_0011732_2056_2757	232
434	3300049459	Ga0495678_032567	Ga0495678_032567_1255_1956	232
435	3300049570	Ga0501033_0218253	Ga0501033_0218253_637_1338	232
436	3300049571	Ga0501034_0198514	Ga0501034_0198514_1043_1741	232
437	3300049571	Ga0501034_0217990	Ga0501034_0217990_265_966	232
438	3300049580	Ga0501046_0003816	Ga0501046_0003816_11077_11778	232
439	3300049580	Ga0501046_0027952	Ga0501046_0027952_2970_3668	232
440	3300049580	Ga0501046_0309338	Ga0501046_0309338_84_782	232
441	3300049581	Ga0501047_0338922	Ga0501047_0338922_16_717	232
442	3300049582	Ga0501048_0128891	Ga0501048_0128891_353_1054	232
443	3300049582	Ga0501048_0495260	Ga0501048_0495260_27_728	232
444	3300049587	Ga0501071_0132190	Ga0501071_0132190_464_1165	232
445	3300049589	Ga0501073_0327788	Ga0501073_0327788_208_939	232
446	3300049593	Ga0501077_0166990	Ga0501077_0166990_116_814	232
447	3300049741	Ga0501079_0611740	Ga0501079_0611740_69_779	232
448	3300049743	Ga0501081_0136778	Ga0501081_0136778_58_768	232
449	3300049744	Ga0501083_0033237	Ga0501083_0033237_809_1507	232
450	3300049823	Ga0501044_0228948	Ga0501044_0228948_588_1289	232
451	3300049823	Ga0501044_0615171	Ga0501044_0615171_157_855	232
452	3300050489	nmdc:mga03683_30406_c1	nmdc:mga03683_30406_c1_829_1560	232
453	3300050507	nmdc:mga05p37_1128571_c1	nmdc:mga05p37_1128571_c1_62_760	232
454	3300050507	nmdc:mga05p37_117361_c1	nmdc:mga05p37_117361_c1_1681_2379	232
455	3300050507	nmdc:mga05p37_25866_c2	nmdc:mga05p37_25866_c2_2299_2997	232
456	3300050507	nmdc:mga05p37_56487_c1	nmdc:mga05p37_56487_c1_1487_2185	232
457	3300050507	nmdc:mga05p37_583435_c1	nmdc:mga05p37_583435_c1_250_948	232
458	3300050508	nmdc:mga09592_87594_c1	nmdc:mga09592_87594_c1_596_1294	232
459	3300050511	nmdc:mga08y16_85175_c1	nmdc:mga08y16_85175_c1_1213_1911	232
460	3300050511	nmdc:mga08y16_91209_c1	nmdc:mga08y16_91209_c1_2377_3078	232
461	3300050512	nmdc:mga0n895_173680_c1	nmdc:mga0n895_173680_c1_1035_1733	232
462	3300050512	nmdc:mga0n895_571655_c1	nmdc:mga0n895_571655_c1_306_1004	232
463	3300050513	nmdc:mga0rr50_397_c1	nmdc:mga0rr50_397_c1_20653_21351	232
464	3300050514	nmdc:mga08x19_3_c1	nmdc:mga08x19_3_c1_81535_82233	232
465	3300053077	Ga0495601_0005209	Ga0495601_0005209_6468_7166	232
466	3300053084	Ga0495595_0070264	Ga0495595_0070264_524_1222	232
467	3300053085	Ga0495619_0002653	Ga0495619_0002653_3414_4112	232
468	3300054114	Ga0501084_0166255	Ga0501084_0166255_105_803	232
469	3300055283	Ga0500661_027250	Ga0500661_027250_108_809	232
470	iso_pu_bacteria	2831426010	2831429678	232
471	iso_pu_bacteria	2848694841	2848702104	232
472	iso_pu_bacteria	2849660919	2849666353	232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

194

279

0.99 PF02678

Pirin

51

167

0.94 PF07883

Cupin_2

Cupin domain

92

167

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1tq5-assembly1.cif.gz_A	crystal structure of yhhw from escherichia coli	0.9797	1	232
6uts-assembly1.cif.gz_A	crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli	0.9773	1	231
1tq5-assembly1.cif.gz_A	crystal structure of yhhw from escherichia coli	0.9631	1	232
6uts-assembly1.cif.gz_A	crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli	0.9606	1	231
2b8m-assembly1.cif.gz_A-2	crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution	0.8636	39	120

ID	Description	Score	Start	End	Superfamily
af_P9WI85_16_135_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9904	13	131	2.60.120.10
1tq5A02	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9892	11	135	2.60.120.10
af_P46852_133_231_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9884	144	231	2.60.120.10
1tq5A02	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9811	11	135	2.60.120.10
1tq5A01	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9781	142	232	2.60.120.10

ID	Description	Score	Start	End	GO Terms
AF-A0A059WJ16-F1-model_v4	Pirin	0.9999	1	232	GO:0046872
AF-A0A354XYT3-F1-model_v4	Pirin N-terminal domain-containing protein	0.999	7	136
AF-A0A853HJ26-F1-model_v4	deleted	0.9989	1	232
AF-A0A2W7A1N5-F1-model_v4	Quercetin 2,3-dioxygenase	0.9989	1	232	GO:0046872 GO:0051213
AF-A0A2V6RYD6-F1-model_v4	Quercetin 2,3-dioxygenase	0.9988	1	136	GO:0051213

Feature Viewer

pLDDT	pTM	Quality
97.25	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450756

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

194

279

0.99

PF02678

Pirin

Pirin

51

167

0.94

PF07883

Cupin_2

Cupin domain

92

167

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map