F450723

General Info

Members Datasets Scaffolds Average Seq Length
472 269 944 133

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10016132|Ga0070676_100161322
Length 148
Sequence MTQPTELTNRAPAQQIELLQPEGWARPRGYANGVAVRGRQVFIAGMIGWDGQGVFHSDDFAAQARQALANIVEVLREAGGRPEHIVRMTWYVTDKREYLAAGREVGRAYRELIGVYNAAMTAVQVSALIEDRAKVEIEATAVIPDEAH

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
165 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
170 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
171 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.19
Nodule 0
Rhizoplane 2.12
Rhizosphere 76.69
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10016132 3300005328 Bacteria 4127
2 JGI24033J26618_1063784 3300002155 Bacteria 545
3 JGI25159J45721_1020594 3300002987 Bacteria 1265
4 rootL2_10023607 3300003322 Bacteria 1996
5 Ga0055534_1002655 3300003784 Bacteria 6066
6 Ga0055540_1051089 3300003792 Bacteria 853
7 Ga0055531_10042708 3300003794 Bacteria 1292
8 Ga0065712_10222236 3300005290 Bacteria 1037
9 Ga0065715_10101265 3300005293 Bacteria 3223
10 Ga0065715_10904585 3300005293 Bacteria 573
11 Ga0070658_11063882 3300005327 Bacteria 704
12 Ga0070676_10013008 3300005328 Bacteria 4559
13 Ga0070676_10118566 3300005328 Bacteria 1658
14 Ga0070676_10258373 3300005328 Bacteria 1165
15 Ga0070670_100017395 3300005331 Bacteria 6167
16 Ga0070670_100321664 3300005331 Bacteria 1355
17 Ga0070677_10002731 3300005333 Bacteria 5640
18 Ga0070677_10539525 3300005333 Bacteria 638
19 Ga0068869_100038694 3300005334 Bacteria 3402
20 Ga0068869_100683000 3300005334 Bacteria 874
21 Ga0068869_100777082 3300005334 Bacteria 822
22 Ga0068868_100038505 3300005338 Bacteria 3712
23 Ga0068868_100065870 3300005338 Bacteria 2879
24 Ga0068868_101271402 3300005338 Bacteria 683
25 Ga0070689_101477275 3300005340 Bacteria 615
26 Ga0070669_100020300 3300005353 Bacteria 4745
27 Ga0070669_100607251 3300005353 Bacteria 917
28 Ga0070675_100001523 3300005354 Bacteria 17138
29 Ga0070675_100052924 3300005354 Bacteria 3339
30 Ga0070671_100001817 3300005355 Bacteria 16238
31 Ga0070671_100013339 3300005355 Bacteria 6623
32 Ga0070674_100004763 3300005356 Bacteria 7771
33 Ga0070674_100024673 3300005356 Bacteria 3905
34 Ga0070673_100149200 3300005364 Bacteria 1979
35 Ga0070673_100162114 3300005364 Bacteria 1902
36 Ga0070688_100595032 3300005365 Bacteria 846
37 Ga0070667_100378389 3300005367 Bacteria 1286
38 Ga0070667_100381376 3300005367 Bacteria 1280
39 Ga0070701_10231430 3300005438 Bacteria 1107
40 Ga0070708_100912090 3300005445 Bacteria 825
41 Ga0070663_100031961 3300005455 Bacteria 3623
42 Ga0070663_100252371 3300005455 Bacteria 1396
43 Ga0070663_100547406 3300005455 Bacteria 967
44 Ga0070663_101696607 3300005455 Bacteria 565
45 Ga0070678_100006035 3300005456 Bacteria 7067
46 Ga0070678_100372909 3300005456 Bacteria 1233
47 Ga0070662_100004592 3300005457 Bacteria 8742
48 Ga0070662_100089534 3300005457 Bacteria 2308
49 Ga0068867_100027400 3300005459 Bacteria 4094
50 Ga0068867_100237998 3300005459 Bacteria 1475
51 Ga0068867_101269052 3300005459 Bacteria 679
52 Ga0068867_102020035 3300005459 Bacteria 545
53 Ga0070685_10098806 3300005466 Bacteria 1779
54 Ga0070706_100004588 3300005467 Bacteria 13260
55 Ga0070707_100044228 3300005468 Bacteria 4263
56 Ga0070679_100786204 3300005530 Bacteria 895
57 Ga0070684_100978321 3300005535 Bacteria 794
58 Ga0068853_100904015 3300005539 Bacteria 848
59 Ga0068853_101708428 3300005539 Bacteria 610
60 Ga0070672_100000622 3300005543 Bacteria 20786
61 Ga0070672_100085623 3300005543 Bacteria 2533
62 Ga0070665_100064396 3300005548 Bacteria 3676
63 Ga0070664_100572433 3300005564 Bacteria 1046
64 Ga0070664_100662217 3300005564 Bacteria 971
65 Ga0068857_100016674 3300005577 Bacteria 6436
66 Ga0068857_100130495 3300005577 Bacteria 2266
67 Ga0068856_102355606 3300005614 Bacteria 540
68 Ga0068856_102594146 3300005614 Unclassified 513
69 Ga0068852_100223490 3300005616 Bacteria 1792
70 Ga0068859_100391314 3300005617 Bacteria 1486
71 Ga0068859_101521796 3300005617 Bacteria 739
72 Ga0068864_100032202 3300005618 Bacteria 4453
73 Ga0068864_100053800 3300005618 Bacteria 3474
74 Ga0068864_100102886 3300005618 Bacteria 2535
75 Ga0068864_102399747 3300005618 Bacteria 534
76 Ga0068861_101689232 3300005719 Bacteria 626
77 Ga0068861_102152789 3300005719 Bacteria 558
78 Ga0068851_10169328 3300005834 Bacteria 1205
79 Ga0068863_100494796 3300005841 Bacteria 1204
80 Ga0068858_100302129 3300005842 Bacteria 1527
81 Ga0068860_100022349 3300005843 Bacteria 6120
82 Ga0068860_101274329 3300005843 Bacteria 756
83 Ga0068860_102195956 3300005843 Bacteria 573
84 Ga0075365_10389072 3300006038 Bacteria 984
85 Ga0075365_10616021 3300006038 Bacteria 767
86 Ga0075368_10079927 3300006042 Bacteria 1330
87 Ga0075368_10119515 3300006042 Bacteria 1091
88 Ga0075368_10150609 3300006042 Bacteria 972
89 Ga0075363_100039920 3300006048 Bacteria 2473
90 Ga0075363_100231514 3300006048 Bacteria 1061
91 Ga0075362_10076729 3300006177 Bacteria 1534
92 Ga0075367_10031384 3300006178 Bacteria 3051
93 Ga0075367_10033502 3300006178 Bacteria 2961
94 Ga0075367_10057518 3300006178 Bacteria 2312
95 Ga0075367_10184839 3300006178 Bacteria 1300
96 Ga0075369_10069822 3300006186 Bacteria 1545
97 Ga0075366_10004645 3300006195 Bacteria 7379
98 Ga0075366_10012686 3300006195 Bacteria 4786
99 Ga0075366_10023357 3300006195 Bacteria 3602
100 Ga0075366_10065091 3300006195 Bacteria 2168
101 Ga0075366_10326653 3300006195 Bacteria 940
102 Ga0075366_10332957 3300006195 Bacteria 931
103 Ga0097621_100022055 3300006237 Bacteria 4938
104 Ga0097621_100134722 3300006237 Bacteria 2106
105 Ga0075370_10000751 3300006353 Bacteria 12970
106 Ga0075370_10001016 3300006353 Bacteria 11635
107 Ga0075370_10008874 3300006353 Bacteria 5192
108 Ga0075370_10021839 3300006353 Bacteria 3508
109 Ga0075370_10034523 3300006353 Bacteria 2835
110 Ga0075370_10304100 3300006353 Bacteria 949
111 Ga0075370_10589122 3300006353 Bacteria 673
112 Ga0068871_100013983 3300006358 Bacteria 5970
113 Ga0068871_100567710 3300006358 Bacteria 1029
114 Ga0068871_100905448 3300006358 Bacteria 818
115 Ga0068871_102035853 3300006358 Bacteria 547
116 Ga0068865_100054742 3300006881 Bacteria 2774
117 Ga0097620_100391306 3300006931 Bacteria 1486
118 Ga0097620_101521793 3300006931 Bacteria 739
119 Ga0075435_101449032 3300007076 Bacteria 602
120 Ga0105240_10074571 3300009093 Bacteria 4187
121 Ga0105245_10775638 3300009098 Bacteria 996
122 Ga0105243_10118405 3300009148 Bacteria 2228
123 Ga0105243_12281768 3300009148 Unclassified 579
124 Ga0105248_10037700 3300009177 Bacteria 5408
125 Ga0105248_10559580 3300009177 Bacteria 1290
126 Ga0105248_10985087 3300009177 Bacteria 952
127 Ga0105237_10030351 3300009545 Bacteria 5491
128 Ga0105239_10009426 3300010375 Bacteria 11005
129 Ga0157326_1023074 3300012513 Bacteria 781
130 Ga0157374_10315240 3300013296 Bacteria 1549
131 Ga0157374_11794736 3300013296 Bacteria 639
132 Ga0157378_10329504 3300013297 Bacteria 1486
133 Ga0157378_10557968 3300013297 Bacteria 1152
134 Ga0163162_10267357 3300013306 Bacteria 1841
135 Ga0163162_10448001 3300013306 Bacteria 1423
136 Ga0163162_11173410 3300013306 Bacteria 871
137 Ga0157375_10359113 3300013308 Bacteria 1623
138 Ga0157375_10408740 3300013308 Bacteria 1524
139 Ga0163163_11468538 3300014325 Bacteria 743
140 Ga0157380_10966247 3300014326 Bacteria 883
141 Ga0157379_12407671 3300014968 Bacteria 525
142 Ga0157376_10104863 3300014969 Bacteria 2478
143 Ga0157376_11141108 3300014969 Bacteria 806
144 Ga0163161_10012867 3300017792 Bacteria 5814
145 Ga0163161_10228064 3300017792 Bacteria 1445
146 Ga0213872_10000035 3300021361 Bacteria 133053
147 Ga0209673_1085373 3300025273 Bacteria 712
148 Ga0209675_1003661 3300025291 Bacteria 7196
149 Ga0209676_1008534 3300025292 Bacteria 4551
150 Ga0209051_1012424 3300025303 Bacteria 4119
151 Ga0209257_1008346 3300025304 Bacteria 5919
152 Ga0207697_10010767 3300025315 Bacteria 3895
153 Ga0207656_10252762 3300025321 Bacteria 864
154 Ga0207682_10004717 3300025893 Bacteria 5655
155 Ga0207682_10042146 3300025893 Bacteria 1864
156 Ga0207680_11141407 3300025903 Bacteria 556
157 Ga0207645_10006912 3300025907 Bacteria 8092
158 Ga0207645_10114195 3300025907 Bacteria 1750
159 Ga0207645_10129955 3300025907 Bacteria 1639
160 Ga0207643_10250431 3300025908 Bacteria 1091
161 Ga0207684_10003996 3300025910 Bacteria 14110
162 Ga0207654_10867076 3300025911 Bacteria 654
163 Ga0207695_10623119 3300025913 Bacteria 960
164 Ga0207671_10065378 3300025914 Bacteria 2705
165 Ga0207649_11583559 3300025920 Bacteria 519
166 Ga0207646_10101109 3300025922 Bacteria 2584
167 Ga0207681_10003674 3300025923 Bacteria 9538
168 Ga0207681_11411916 3300025923 Bacteria 584
169 Ga0207694_10115695 3300025924 Bacteria 2137
170 Ga0207650_10000710 3300025925 Bacteria 25994
171 Ga0207650_10139439 3300025925 Bacteria 1905
172 Ga0207650_10848649 3300025925 Bacteria 775
173 Ga0207659_10000755 3300025926 Bacteria 19190
174 Ga0207644_10009167 3300025931 Bacteria 6490
175 Ga0207644_10060664 3300025931 Bacteria 2737
176 Ga0207644_10266988 3300025931 Bacteria 1370
177 Ga0207690_11670986 3300025932 Bacteria 532
178 Ga0207706_10005983 3300025933 Bacteria 11312
179 Ga0207706_10041643 3300025933 Bacteria 4071
180 Ga0207709_10440786 3300025935 Bacteria 1004
181 Ga0207709_10805628 3300025935 Bacteria 758
182 Ga0207709_11182847 3300025935 Bacteria 630
183 Ga0207669_10017625 3300025937 Bacteria 3669
184 Ga0207669_10277217 3300025937 Bacteria 1263
185 Ga0207704_10123434 3300025938 Bacteria 1778
186 Ga0207704_11523341 3300025938 Bacteria 574
187 Ga0207691_10002176 3300025940 Bacteria 19165
188 Ga0207691_10005596 3300025940 Bacteria 12143
189 Ga0207711_10144759 3300025941 Bacteria 2141
190 Ga0207711_10310072 3300025941 Bacteria 1457
191 Ga0207689_10070812 3300025942 Bacteria 2864
192 Ga0207689_10295356 3300025942 Bacteria 1342
193 Ga0207651_10065830 3300025960 Bacteria 2543
194 Ga0207651_11363054 3300025960 Bacteria 638
195 Ga0207640_10442913 3300025981 Bacteria 1069
196 Ga0207658_10000596 3300025986 Bacteria 32369
197 Ga0207658_10144401 3300025986 Bacteria 1930
198 Ga0207658_10187094 3300025986 Bacteria 1718
199 Ga0207658_10338213 3300025986 Bacteria 1308
200 Ga0207658_10461493 3300025986 Bacteria 1126
201 Ga0207658_10810258 3300025986 Bacteria 850
202 Ga0207677_10003077 3300026023 Bacteria 8808
203 Ga0207677_10054776 3300026023 Bacteria 2724
204 Ga0207677_10794624 3300026023 Bacteria 847
205 Ga0207703_10218935 3300026035 Bacteria 1701
206 Ga0207639_10666347 3300026041 Bacteria 963
207 Ga0207678_10037587 3300026067 Bacteria 4210
208 Ga0207678_10227035 3300026067 Bacteria 1598
209 Ga0207678_11034366 3300026067 Bacteria 727
210 Ga0207641_10386035 3300026088 Bacteria 1342
211 Ga0207641_10492065 3300026088 Bacteria 1190
212 Ga0207648_10027496 3300026089 Bacteria 5049
213 Ga0207648_10036825 3300026089 Bacteria 4310
214 Ga0207648_10052966 3300026089 Bacteria 3548
215 Ga0207648_10229722 3300026089 Bacteria 1650
216 Ga0207676_10082413 3300026095 Bacteria 2616
217 Ga0207676_10096934 3300026095 Bacteria 2435
218 Ga0207676_10596297 3300026095 Bacteria 1060
219 Ga0207676_10925723 3300026095 Bacteria 856
220 Ga0207674_10026676 3300026116 Bacteria 6129
221 Ga0207674_10033573 3300026116 Bacteria 5371
222 Ga0207674_10118429 3300026116 Bacteria 2618
223 Ga0207674_10245211 3300026116 Bacteria 1739
224 Ga0207675_101888041 3300026118 Bacteria 616
225 Ga0207683_10008284 3300026121 Bacteria 8892
226 Ga0207683_10149595 3300026121 Bacteria 2107
227 Ga0207683_11134515 3300026121 Bacteria 725
228 Ga0207698_10522956 3300026142 Bacteria 1158
229 Ga0209813_10057559 3300027866 Bacteria 1233
230 Ga0209813_10131724 3300027866 Bacteria 880
231 Ga0268266_10446898 3300028379 Bacteria 1228
232 Ga0268266_10488648 3300028379 Bacteria 1174
233 Ga0268266_11340799 3300028379 Bacteria 691
234 Ga0268264_10029783 3300028381 Bacteria 4474
235 Ga0268264_10886677 3300028381 Bacteria 895
236 Ga0268264_11717046 3300028381 Bacteria 638
237 Ga0268264_11827897 3300028381 Bacteria 617
238 Ga0307517_10149718 3300028786 Bacteria 1606
239 Ga0307515_10001163 3300028794 Bacteria 60305
240 Ga0307515_10017024 3300028794 Bacteria 13278
241 Ga0307515_10169382 3300028794 Bacteria 2185
242 Ga0307515_10394267 3300028794 Bacteria 1012
243 Ga0307515_10434686 3300028794 Bacteria 930
244 Ga0307515_10487695 3300028794 Bacteria 844
245 Ga0307515_10630809 3300028794 Bacteria 683
246 Ga0265332_10016033 3300031238 Bacteria 3306
247 Ga0265329_10186818 3300031242 Bacteria 679
248 Ga0307513_10211500 3300031456 Bacteria 1770
249 Ga0307513_10316211 3300031456 Bacteria 1321
250 Ga0307513_10414091 3300031456 Bacteria 1079
251 Ga0307513_10604179 3300031456 Bacteria 806
252 Ga0307513_10753383 3300031456 Bacteria 679
253 Ga0307509_10006562 3300031507 Bacteria 15585
254 Ga0307509_10051603 3300031507 Bacteria 4396
255 Ga0307509_10078613 3300031507 Bacteria 3417
256 Ga0307509_10090801 3300031507 Bacteria 3128
257 Ga0307509_10402316 3300031507 Bacteria 1075
258 Ga0307509_10961468 3300031507 Bacteria 520
259 Ga0307408_100264820 3300031548 Bacteria 1424
260 Ga0307408_100317438 3300031548 Bacteria 1311
261 Ga0307408_100418535 3300031548 Bacteria 1155
262 Ga0307508_10000047 3300031616 Bacteria 137805
263 Ga0307508_10033444 3300031616 Bacteria 4640
264 Ga0307508_10040477 3300031616 Bacteria 4183
265 Ga0307508_10311711 3300031616 Bacteria 1166
266 Ga0307514_10003965 3300031649 Bacteria 13844
267 Ga0265314_10024895 3300031711 Bacteria 4527
268 Ga0265342_10284475 3300031712 Bacteria 874
269 Ga0307516_10050071 3300031730 Bacteria 4100
270 Ga0307405_10006217 3300031731 Bacteria 5853
271 Ga0307405_10651820 3300031731 Bacteria 866
272 Ga0307405_10992613 3300031731 Bacteria 716
273 Ga0307413_10029061 3300031824 Bacteria 3088
274 Ga0307413_10100161 3300031824 Bacteria 1912
275 Ga0307410_10099598 3300031852 Bacteria 2081
276 Ga0307410_10105014 3300031852 Bacteria 2032
277 Ga0307410_10649633 3300031852 Bacteria 885
278 Ga0307410_10764057 3300031852 Bacteria 819
279 Ga0307410_11192030 3300031852 Bacteria 663
280 Ga0307406_10003030 3300031901 Bacteria 9141
281 Ga0307406_10645229 3300031901 Bacteria 878
282 Ga0307406_11272361 3300031901 Bacteria 641
283 Ga0307407_10016740 3300031903 Bacteria 3658
284 Ga0307412_10015153 3300031911 Bacteria 4562
285 Ga0307412_10613195 3300031911 Bacteria 923
286 Ga0307412_10627389 3300031911 Bacteria 914
287 Ga0307409_100092727 3300031995 Bacteria 2479
288 Ga0307416_100064596 3300032002 Bacteria 3003
289 Ga0307416_100395564 3300032002 Bacteria 1417
290 Ga0307416_101017620 3300032002 Bacteria 932
291 Ga0307416_101069641 3300032002 Bacteria 911
292 Ga0307416_101163556 3300032002 Bacteria 877
293 Ga0307416_101652840 3300032002 Bacteria 745
294 Ga0307416_103277885 3300032002 Bacteria 542
295 Ga0307414_10018316 3300032004 Bacteria 4307
296 Ga0307414_10047402 3300032004 Bacteria 2957
297 Ga0307414_10235977 3300032004 Bacteria 1511
298 Ga0307414_10524893 3300032004 Bacteria 1051
299 Ga0307411_10016616 3300032005 Bacteria 4168
300 Ga0307411_10289886 3300032005 Bacteria 1307
301 Ga0307411_10628570 3300032005 Bacteria 927
302 Ga0307415_100294466 3300032126 Bacteria 1341
303 Ga0307415_100364485 3300032126 Bacteria 1221
304 Ga0307507_10050674 3300033179 Bacteria 4005
305 Ga0307507_10078721 3300033179 Bacteria 2919
306 Ga0373930_0094031 3300034816 Bacteria 706
307 Ga0373944_0105516 3300035089 Bacteria 957
308 Ga0373949_0107032 3300035090 Bacteria 772
309 Ga0373939_0038486 3300035114 Bacteria 1427
310 Ga0373946_0376007 3300035171 Bacteria 714
311 Ga0373931_0951192 3300035691 Bacteria 579
312 Ga0373925_0418876 3300037068 Bacteria 1094
313 Ga0395900_0000025 3300037418 Bacteria 321217
314 Ga0395898_0000949 3300037466 Bacteria 46173
315 Ga0395905_0005121 3300037471 Bacteria 13466
316 Ga0395905_0042743 3300037471 Bacteria 4251
317 Ga0395905_0529968 3300037471 Bacteria 1078
318 Ga0395905_0940644 3300037471 Bacteria 767
319 Ga0395901_0743162 3300038443 Bacteria 975
320 Ga0395901_1607007 3300038443 Bacteria 603
321 Ga0436365_1382151 3300039437 Bacteria 1212
322 Ga0436361_1219541 3300039447 Bacteria 53058
323 Ga0439453_0029577 3300041408 Bacteria 1032
324 Ga0439465_0176435 3300041413 Bacteria 772
325 Ga0451795_0023604 3300041456 Bacteria 796
326 Ga0451839_0122580 3300041496 Bacteria 563
327 Ga0451839_1594168 3300041496 Bacteria 866
328 Ga0451843_0199040 3300041509 Bacteria 732
329 Ga0451853_0661535 3300041512 Bacteria 611
330 Ga0439445_0038145 3300042004 Bacteria 1270
331 Ga0439451_105144 3300042009 Bacteria 571
332 Ga0450888_032948 3300042126 Bacteria 699
333 Ga0450899_003147 3300042135 Bacteria 1779
334 Ga0439446_0193459 3300042156 Bacteria 684
335 Ga0466969_0000024 3300044656 Bacteria 96283
336 Ga0466972_0532840 3300044658 Bacteria 554
337 Ga0466965_0045089 3300044683 Bacteria 2180
338 Ga0466966_0013307 3300044684 Bacteria 5446
339 Ga0466961_0030567 3300044693 Bacteria 3461
340 Ga0466963_0008285 3300044694 Bacteria 6228
341 Ga0466963_1203180 3300044694 Bacteria 532
342 Ga0466964_0000368 3300044706 Bacteria 13629
343 Ga0453684_0226976 3300044712 Bacteria 2159
344 Ga0466971_0071419 3300044719 Bacteria 1576
345 Ga0466968_0112250 3300044735 Bacteria 1227
346 Ga0466970_0085969 3300044765 Bacteria 1704
347 Ga0466957_0212352 3300044842 Bacteria 1274
348 Ga0466959_0016878 3300045049 Bacteria 5342
349 Ga0466959_0017141 3300045049 Bacteria 5305
350 Ga0466958_0056024 3300045836 Bacteria 2393
351 Ga0495590_0064058 3300046457 Bacteria 1286
352 Ga0495629_0503375 3300046459 Bacteria 817
353 Ga0495641_0327357 3300046461 Bacteria 692
354 Ga0495605_0351178 3300046474 Bacteria 618
355 Ga0495606_0495863 3300046507 Bacteria 617
356 Ga0495610_0071123 3300046512 Bacteria 1623
357 Ga0495620_0207049 3300046515 Bacteria 753
358 Ga0495628_0576075 3300046516 Bacteria 806
359 Ga0495631_0170498 3300046518 Bacteria 933
360 Ga0495632_0003759 3300046519 Bacteria 10612
361 Ga0495632_0045323 3300046519 Bacteria 2191
362 Ga0495643_0061440 3300046522 Bacteria 1992
363 Ga0495643_0125927 3300046522 Bacteria 1290
364 Ga0495648_0169761 3300046524 Bacteria 1119
365 Ga0495648_0218931 3300046524 Bacteria 940
366 Ga0495663_0095988 3300046525 Bacteria 971
367 Ga0495642_0180078 3300046528 Bacteria 920
368 Ga0495586_0447323 3300046535 Bacteria 745
369 Ga0495597_0039065 3300046542 Bacteria 2126
370 Ga0495622_0332149 3300046557 Bacteria 659
371 Ga0495656_0093476 3300046615 Bacteria 1379
372 Ga0495656_0190273 3300046615 Bacteria 1013
373 Ga0495611_0250034 3300046648 Bacteria 822
374 Ga0495625_0073969 3300046660 Bacteria 2387
375 Ga0495646_0660368 3300046680 Bacteria 528
376 Ga0495647_0601555 3300046681 Bacteria 516
377 Ga0495658_0244470 3300046683 Bacteria 1127
378 Ga0495658_0363665 3300046683 Bacteria 920
379 Ga0495658_0950102 3300046683 Bacteria 549
380 Ga0495669_0197385 3300046684 Bacteria 961
381 Ga0495624_0332630 3300046690 Bacteria 914
382 Ga0495671_0274783 3300046692 Bacteria 812
383 Ga0495649_0001907 3300046694 Bacteria 15195
384 Ga0495649_0031639 3300046694 Bacteria 2916
385 Ga0495660_0034674 3300046810 Bacteria 2822
386 Ga0495676_0320976 3300047321 Bacteria 1040
387 Ga0495687_000315 3300047443 Bacteria 62841
388 Ga0495687_023052 3300047443 Bacteria 2980
389 Ga0495677_0000049 3300047445 Bacteria 68714
390 Ga0495685_105734 3300047447 Bacteria 928
391 Ga0495673_0197191 3300047469 Bacteria 755
392 Ga0495686_0689283 3300047472 Bacteria 522
393 Ga0495615_0023696 3300048090 Bacteria 1409
394 Ga0495626_0013264 3300048091 Bacteria 4286
395 Ga0495626_0100912 3300048091 Bacteria 1258
396 Ga0496102_0326682 3300048905 Bacteria 1445
397 Ga0496103_0454745 3300048906 Bacteria 821
398 Ga0496104_0312982 3300048907 Bacteria 1483
399 Ga0496106_0320040 3300048909 Bacteria 1245
400 Ga0496109_1352881 3300048912 Bacteria 648
401 Ga0496109_1815849 3300048912 Bacteria 543
402 Ga0496110_0477388 3300048913 Bacteria 1136
403 Ga0496113_0074327 3300048916 Bacteria 2591
404 Ga0496114_1288694 3300048917 Bacteria 617
405 Ga0495678_087061 3300049459 Bacteria 1109
406 Ga0501032_0000505 3300049569 Bacteria 31634
407 Ga0501033_0003054 3300049570 Bacteria 13919
408 Ga0501033_0212254 3300049570 Bacteria 1380
409 Ga0501036_0026432 3300049572 Bacteria 4900
410 Ga0501037_0000143 3300049573 Bacteria 66427
411 Ga0501038_0082451 3300049574 Bacteria 2708
412 Ga0501041_0174558 3300049577 Bacteria 1345
413 Ga0501042_0678548 3300049578 Bacteria 749
414 Ga0501042_1099636 3300049578 Bacteria 579
415 Ga0501043_0000032 3300049579 Bacteria 140037
416 Ga0501043_0000052 3300049579 Bacteria 106686
417 Ga0501046_0000327 3300049580 Bacteria 47741
418 Ga0501047_0000137 3300049581 Bacteria 89064
419 Ga0501047_0106334 3300049581 Bacteria 2687
420 Ga0501047_0424832 3300049581 Bacteria 1160
421 Ga0501048_0006049 3300049582 Bacteria 9213
422 Ga0501067_0027555 3300049583 Bacteria 3149
423 Ga0501068_0005779 3300049584 Bacteria 6784
424 Ga0501069_0000143 3300049585 Bacteria 31666
425 Ga0501070_0000715 3300049586 Bacteria 30313
426 Ga0501071_0003525 3300049587 Bacteria 9789
427 Ga0501073_0024657 3300049589 Bacteria 4319
428 Ga0501074_0000057 3300049590 Bacteria 55240
429 Ga0501076_0164929 3300049592 Bacteria 1806
430 Ga0501076_1311253 3300049592 Bacteria 595
431 Ga0501221_065358 3300049704 Bacteria 849
432 Ga0501080_0000098 3300049742 Bacteria 59158
433 Ga0501080_1677208 3300049742 Bacteria 537
434 Ga0501083_0000036 3300049744 Bacteria 95904
435 Ga0501083_0678901 3300049744 Bacteria 670
436 Ga0501035_0000025 3300049822 Bacteria 204195
437 Ga0501035_0107984 3300049822 Bacteria 2440
438 Ga0501035_0497868 3300049822 Bacteria 1003
439 Ga0501044_0000031 3300049823 Bacteria 173135
440 Ga0501044_0428527 3300049823 Bacteria 1232
441 Ga0501045_0045387 3300049824 Bacteria 3199
442 nmdc:mga03683_195621_c1 3300050489 Bacteria 926
443 nmdc:mga03n38_123118_c1 3300050490 Bacteria 1277
444 nmdc:mga03n38_321670_c1 3300050490 Bacteria 835
445 nmdc:mga0yw44_357984_c1 3300050492 Bacteria 983
446 nmdc:mga0k408_16397_c1 3300050493 Bacteria 4111
447 nmdc:mga0k408_19198_c1 3300050493 Bacteria 3818
448 nmdc:mga0k408_230900_c1 3300050493 Bacteria 1105
449 nmdc:mga0k408_238182_c1 3300050493 Bacteria 1087
450 nmdc:mga0k408_338492_c1 3300050493 Bacteria 897
451 nmdc:mga0k408_6696_c1 3300050493 Bacteria 6141
452 nmdc:mga06z11_151337_c1 3300050494 Bacteria 1319
453 nmdc:mga06z11_45821_c1 3300050494 Bacteria 2213
454 nmdc:mga06z11_54245_c1 3300050494 Bacteria 2065
455 nmdc:mga04h51_166199_c1 3300050495 Bacteria 852
456 nmdc:mga04h51_29808_c1 3300050495 Bacteria 1712
457 nmdc:mga07m45_276703_c1 3300050496 Bacteria 976
458 nmdc:mga07m45_2934_c1 3300050496 Bacteria 8096
459 nmdc:mga07m45_3444_c1 3300050496 Bacteria 7626
460 nmdc:mga07m45_546792_c1 3300050496 Bacteria 670
461 nmdc:mga07m45_56531_c1 3300050496 Bacteria 2218
462 nmdc:mga07m45_57101_c1 3300050496 Bacteria 2207
463 nmdc:mga07m45_605309_c1 3300050496 Bacteria 633
464 nmdc:mga07m45_721_c1 3300050496 Bacteria 14074
465 nmdc:mga0sz30_15347_c1 3300050516 Bacteria 3026
466 nmdc:mga0sz30_388717_c1 3300050516 Bacteria 625
467 Ga0500578_0033250 3300053086 Bacteria 3315
468 Ga0500578_0517927 3300053086 Bacteria 668
469 Ga0500658_0017010 3300053134 Bacteria 2713
470 Ga0500616_0277509 3300053153 Bacteria 705
471 Ga0500645_024178 3300053730 Bacteria 1858
472 Ga0501082_0010219 3300060353 Bacteria 8081
473 Ga0070676_10016132
474 JGI24033J26618_1063784
475 JGI25159J45721_1020594
476 rootL2_10023607
477 Ga0055534_1002655
478 Ga0055540_1051089
479 Ga0055531_10042708
480 Ga0065712_10222236
481 Ga0065715_10101265
482 Ga0065715_10904585
483 Ga0070658_11063882
484 Ga0070676_10013008
485 Ga0070676_10118566
486 Ga0070676_10258373
487 Ga0070670_100017395
488 Ga0070670_100321664
489 Ga0070677_10002731
490 Ga0070677_10539525
491 Ga0068869_100038694
492 Ga0068869_100683000
493 Ga0068869_100777082
494 Ga0068868_100038505
495 Ga0068868_100065870
496 Ga0068868_101271402
497 Ga0070689_101477275
498 Ga0070669_100020300
499 Ga0070669_100607251
500 Ga0070675_100001523
501 Ga0070675_100052924
502 Ga0070671_100001817
503 Ga0070671_100013339
504 Ga0070674_100004763
505 Ga0070674_100024673
506 Ga0070673_100149200
507 Ga0070673_100162114
508 Ga0070688_100595032
509 Ga0070667_100378389
510 Ga0070667_100381376
511 Ga0070701_10231430
512 Ga0070708_100912090
513 Ga0070663_100031961
514 Ga0070663_100252371
515 Ga0070663_100547406
516 Ga0070663_101696607
517 Ga0070678_100006035
518 Ga0070678_100372909
519 Ga0070662_100004592
520 Ga0070662_100089534
521 Ga0068867_100027400
522 Ga0068867_100237998
523 Ga0068867_101269052
524 Ga0068867_102020035
525 Ga0070685_10098806
526 Ga0070706_100004588
527 Ga0070707_100044228
528 Ga0070679_100786204
529 Ga0070684_100978321
530 Ga0068853_100904015
531 Ga0068853_101708428
532 Ga0070672_100000622
533 Ga0070672_100085623
534 Ga0070665_100064396
535 Ga0070664_100572433
536 Ga0070664_100662217
537 Ga0068857_100016674
538 Ga0068857_100130495
539 Ga0068856_102355606
540 Ga0068856_102594146
541 Ga0068852_100223490
542 Ga0068859_100391314
543 Ga0068859_101521796
544 Ga0068864_100032202
545 Ga0068864_100053800
546 Ga0068864_100102886
547 Ga0068864_102399747
548 Ga0068861_101689232
549 Ga0068861_102152789
550 Ga0068851_10169328
551 Ga0068863_100494796
552 Ga0068858_100302129
553 Ga0068860_100022349
554 Ga0068860_101274329
555 Ga0068860_102195956
556 Ga0075365_10389072
557 Ga0075365_10616021
558 Ga0075368_10079927
559 Ga0075368_10119515
560 Ga0075368_10150609
561 Ga0075363_100039920
562 Ga0075363_100231514
563 Ga0075362_10076729
564 Ga0075367_10031384
565 Ga0075367_10033502
566 Ga0075367_10057518
567 Ga0075367_10184839
568 Ga0075369_10069822
569 Ga0075366_10004645
570 Ga0075366_10012686
571 Ga0075366_10023357
572 Ga0075366_10065091
573 Ga0075366_10326653
574 Ga0075366_10332957
575 Ga0097621_100022055
576 Ga0097621_100134722
577 Ga0075370_10000751
578 Ga0075370_10001016
579 Ga0075370_10008874
580 Ga0075370_10021839
581 Ga0075370_10034523
582 Ga0075370_10304100
583 Ga0075370_10589122
584 Ga0068871_100013983
585 Ga0068871_100567710
586 Ga0068871_100905448
587 Ga0068871_102035853
588 Ga0068865_100054742
589 Ga0097620_100391306
590 Ga0097620_101521793
591 Ga0075435_101449032
592 Ga0105240_10074571
593 Ga0105245_10775638
594 Ga0105243_10118405
595 Ga0105243_12281768
596 Ga0105248_10037700
597 Ga0105248_10559580
598 Ga0105248_10985087
599 Ga0105237_10030351
600 Ga0105239_10009426
601 Ga0157326_1023074
602 Ga0157374_10315240
603 Ga0157374_11794736
604 Ga0157378_10329504
605 Ga0157378_10557968
606 Ga0163162_10267357
607 Ga0163162_10448001
608 Ga0163162_11173410
609 Ga0157375_10359113
610 Ga0157375_10408740
611 Ga0163163_11468538
612 Ga0157380_10966247
613 Ga0157379_12407671
614 Ga0157376_10104863
615 Ga0157376_11141108
616 Ga0163161_10012867
617 Ga0163161_10228064
618 Ga0213872_10000035
619 Ga0209673_1085373
620 Ga0209675_1003661
621 Ga0209676_1008534
622 Ga0209051_1012424
623 Ga0209257_1008346
624 Ga0207697_10010767
625 Ga0207656_10252762
626 Ga0207682_10004717
627 Ga0207682_10042146
628 Ga0207680_11141407
629 Ga0207645_10006912
630 Ga0207645_10114195
631 Ga0207645_10129955
632 Ga0207643_10250431
633 Ga0207684_10003996
634 Ga0207654_10867076
635 Ga0207695_10623119
636 Ga0207671_10065378
637 Ga0207649_11583559
638 Ga0207646_10101109
639 Ga0207681_10003674
640 Ga0207681_11411916
641 Ga0207694_10115695
642 Ga0207650_10000710
643 Ga0207650_10139439
644 Ga0207650_10848649
645 Ga0207659_10000755
646 Ga0207644_10009167
647 Ga0207644_10060664
648 Ga0207644_10266988
649 Ga0207690_11670986
650 Ga0207706_10005983
651 Ga0207706_10041643
652 Ga0207709_10440786
653 Ga0207709_10805628
654 Ga0207709_11182847
655 Ga0207669_10017625
656 Ga0207669_10277217
657 Ga0207704_10123434
658 Ga0207704_11523341
659 Ga0207691_10002176
660 Ga0207691_10005596
661 Ga0207711_10144759
662 Ga0207711_10310072
663 Ga0207689_10070812
664 Ga0207689_10295356
665 Ga0207651_10065830
666 Ga0207651_11363054
667 Ga0207640_10442913
668 Ga0207658_10000596
669 Ga0207658_10144401
670 Ga0207658_10187094
671 Ga0207658_10338213
672 Ga0207658_10461493
673 Ga0207658_10810258
674 Ga0207677_10003077
675 Ga0207677_10054776
676 Ga0207677_10794624
677 Ga0207703_10218935
678 Ga0207639_10666347
679 Ga0207678_10037587
680 Ga0207678_10227035
681 Ga0207678_11034366
682 Ga0207641_10386035
683 Ga0207641_10492065
684 Ga0207648_10027496
685 Ga0207648_10036825
686 Ga0207648_10052966
687 Ga0207648_10229722
688 Ga0207676_10082413
689 Ga0207676_10096934
690 Ga0207676_10596297
691 Ga0207676_10925723
692 Ga0207674_10026676
693 Ga0207674_10033573
694 Ga0207674_10118429
695 Ga0207674_10245211
696 Ga0207675_101888041
697 Ga0207683_10008284
698 Ga0207683_10149595
699 Ga0207683_11134515
700 Ga0207698_10522956
701 Ga0209813_10057559
702 Ga0209813_10131724
703 Ga0268266_10446898
704 Ga0268266_10488648
705 Ga0268266_11340799
706 Ga0268264_10029783
707 Ga0268264_10886677
708 Ga0268264_11717046
709 Ga0268264_11827897
710 Ga0307517_10149718
711 Ga0307515_10001163
712 Ga0307515_10017024
713 Ga0307515_10169382
714 Ga0307515_10394267
715 Ga0307515_10434686
716 Ga0307515_10487695
717 Ga0307515_10630809
718 Ga0265332_10016033
719 Ga0265329_10186818
720 Ga0307513_10211500
721 Ga0307513_10316211
722 Ga0307513_10414091
723 Ga0307513_10604179
724 Ga0307513_10753383
725 Ga0307509_10006562
726 Ga0307509_10051603
727 Ga0307509_10078613
728 Ga0307509_10090801
729 Ga0307509_10402316
730 Ga0307509_10961468
731 Ga0307408_100264820
732 Ga0307408_100317438
733 Ga0307408_100418535
734 Ga0307508_10000047
735 Ga0307508_10033444
736 Ga0307508_10040477
737 Ga0307508_10311711
738 Ga0307514_10003965
739 Ga0265314_10024895
740 Ga0265342_10284475
741 Ga0307516_10050071
742 Ga0307405_10006217
743 Ga0307405_10651820
744 Ga0307405_10992613
745 Ga0307413_10029061
746 Ga0307413_10100161
747 Ga0307410_10099598
748 Ga0307410_10105014
749 Ga0307410_10649633
750 Ga0307410_10764057
751 Ga0307410_11192030
752 Ga0307406_10003030
753 Ga0307406_10645229
754 Ga0307406_11272361
755 Ga0307407_10016740
756 Ga0307412_10015153
757 Ga0307412_10613195
758 Ga0307412_10627389
759 Ga0307409_100092727
760 Ga0307416_100064596
761 Ga0307416_100395564
762 Ga0307416_101017620
763 Ga0307416_101069641
764 Ga0307416_101163556
765 Ga0307416_101652840
766 Ga0307416_103277885
767 Ga0307414_10018316
768 Ga0307414_10047402
769 Ga0307414_10235977
770 Ga0307414_10524893
771 Ga0307411_10016616
772 Ga0307411_10289886
773 Ga0307411_10628570
774 Ga0307415_100294466
775 Ga0307415_100364485
776 Ga0307507_10050674
777 Ga0307507_10078721
778 Ga0373930_0094031
779 Ga0373944_0105516
780 Ga0373949_0107032
781 Ga0373939_0038486
782 Ga0373946_0376007
783 Ga0373931_0951192
784 Ga0373925_0418876
785 Ga0395900_0000025
786 Ga0395898_0000949
787 Ga0395905_0005121
788 Ga0395905_0042743
789 Ga0395905_0529968
790 Ga0395905_0940644
791 Ga0395901_0743162
792 Ga0395901_1607007
793 Ga0436365_1382151
794 Ga0436361_1219541
795 Ga0439453_0029577
796 Ga0439465_0176435
797 Ga0451795_0023604
798 Ga0451839_0122580
799 Ga0451839_1594168
800 Ga0451843_0199040
801 Ga0451853_0661535
802 Ga0439445_0038145
803 Ga0439451_105144
804 Ga0450888_032948
805 Ga0450899_003147
806 Ga0439446_0193459
807 Ga0466969_0000024
808 Ga0466972_0532840
809 Ga0466965_0045089
810 Ga0466966_0013307
811 Ga0466961_0030567
812 Ga0466963_0008285
813 Ga0466963_1203180
814 Ga0466964_0000368
815 Ga0453684_0226976
816 Ga0466971_0071419
817 Ga0466968_0112250
818 Ga0466970_0085969
819 Ga0466957_0212352
820 Ga0466959_0016878
821 Ga0466959_0017141
822 Ga0466958_0056024
823 Ga0495590_0064058
824 Ga0495629_0503375
825 Ga0495641_0327357
826 Ga0495605_0351178
827 Ga0495606_0495863
828 Ga0495610_0071123
829 Ga0495620_0207049
830 Ga0495628_0576075
831 Ga0495631_0170498
832 Ga0495632_0003759
833 Ga0495632_0045323
834 Ga0495643_0061440
835 Ga0495643_0125927
836 Ga0495648_0169761
837 Ga0495648_0218931
838 Ga0495663_0095988
839 Ga0495642_0180078
840 Ga0495586_0447323
841 Ga0495597_0039065
842 Ga0495622_0332149
843 Ga0495656_0093476
844 Ga0495656_0190273
845 Ga0495611_0250034
846 Ga0495625_0073969
847 Ga0495646_0660368
848 Ga0495647_0601555
849 Ga0495658_0244470
850 Ga0495658_0363665
851 Ga0495658_0950102
852 Ga0495669_0197385
853 Ga0495624_0332630
854 Ga0495671_0274783
855 Ga0495649_0001907
856 Ga0495649_0031639
857 Ga0495660_0034674
858 Ga0495676_0320976
859 Ga0495687_000315
860 Ga0495687_023052
861 Ga0495677_0000049
862 Ga0495685_105734
863 Ga0495673_0197191
864 Ga0495686_0689283
865 Ga0495615_0023696
866 Ga0495626_0013264
867 Ga0495626_0100912
868 Ga0496102_0326682
869 Ga0496103_0454745
870 Ga0496104_0312982
871 Ga0496106_0320040
872 Ga0496109_1352881
873 Ga0496109_1815849
874 Ga0496110_0477388
875 Ga0496113_0074327
876 Ga0496114_1288694
877 Ga0495678_087061
878 Ga0501032_0000505
879 Ga0501033_0003054
880 Ga0501033_0212254
881 Ga0501036_0026432
882 Ga0501037_0000143
883 Ga0501038_0082451
884 Ga0501041_0174558
885 Ga0501042_0678548
886 Ga0501042_1099636
887 Ga0501043_0000032
888 Ga0501043_0000052
889 Ga0501046_0000327
890 Ga0501047_0000137
891 Ga0501047_0106334
892 Ga0501047_0424832
893 Ga0501048_0006049
894 Ga0501067_0027555
895 Ga0501068_0005779
896 Ga0501069_0000143
897 Ga0501070_0000715
898 Ga0501071_0003525
899 Ga0501073_0024657
900 Ga0501074_0000057
901 Ga0501076_0164929
902 Ga0501076_1311253
903 Ga0501221_065358
904 Ga0501080_0000098
905 Ga0501080_1677208
906 Ga0501083_0000036
907 Ga0501083_0678901
908 Ga0501035_0000025
909 Ga0501035_0107984
910 Ga0501035_0497868
911 Ga0501044_0000031
912 Ga0501044_0428527
913 Ga0501045_0045387
914 nmdc:mga03683_195621_c1
915 nmdc:mga03n38_123118_c1
916 nmdc:mga03n38_321670_c1
917 nmdc:mga0yw44_357984_c1
918 nmdc:mga0k408_16397_c1
919 nmdc:mga0k408_19198_c1
920 nmdc:mga0k408_230900_c1
921 nmdc:mga0k408_238182_c1
922 nmdc:mga0k408_338492_c1
923 nmdc:mga0k408_6696_c1
924 nmdc:mga06z11_151337_c1
925 nmdc:mga06z11_45821_c1
926 nmdc:mga06z11_54245_c1
927 nmdc:mga04h51_166199_c1
928 nmdc:mga04h51_29808_c1
929 nmdc:mga07m45_276703_c1
930 nmdc:mga07m45_2934_c1
931 nmdc:mga07m45_3444_c1
932 nmdc:mga07m45_546792_c1
933 nmdc:mga07m45_56531_c1
934 nmdc:mga07m45_57101_c1
935 nmdc:mga07m45_605309_c1
936 nmdc:mga07m45_721_c1
937 nmdc:mga0sz30_15347_c1
938 nmdc:mga0sz30_388717_c1
939 Ga0500578_0033250
940 Ga0500578_0517927
941 Ga0500658_0017010
942 Ga0500616_0277509
943 Ga0500645_024178
944 Ga0501082_0010219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

25

143

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8723 2 128
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8478 2 128
3mqw-assembly2.cif.gz_F crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.8408 15 128
3m1x-assembly1.cif.gz_A crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form 0.8397 15 128
3k12-assembly1.cif.gz_C crystal structure of an uncharacterized protein a6v7t0 from pseudomonas aeruginosa 0.8365 21 127
ID Description Score Start End Superfamily
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8397 15 128 3.30.1330.40
3k12C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8296 21 127 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8291 16 128 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8273 13 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.822 16 128 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2N7VD55-F1-model_v4 Enamine deaminase RidA 0.9963 2 130
AF-A0A0S4WKM9-F1-model_v4 4-hydroxybenzoyl CoA thioesterase (Modular protein) (EC 3.1.2.23) 0.9921 2 130 GO:0018739
AF-A0A2V3XDH3-F1-model_v4 deleted 0.9909 2 130
AF-A0A2S8H7D0-F1-model_v4 deleted 0.987 1 130
AF-A0A7C2EE91-F1-model_v4 RidA family protein 0.9869 2 130

Map