F450686

General Info

Members Datasets Scaffolds Average Seq Length
471 246 942 125

Family's Representative Sequence

Representative Sequence 3300053151|Ga0500604_0187708|Ga0500604_0187708_169_561
Length 123
Sequence MDIKLELVVLPVSDVDAAIDFYVNKVGFNLDQDNKVNEGVRFVQLTPPGSACSIAFGKGITEPVKPGSVKGLQVVVKDARKAREYLVSKGVEASEIQEFPWGNFTFFNDPDGNRWAVQQIVRK

Samples

Sample ID Description Type Environment
1 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
162 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
239 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
240 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
241 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
242 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
243 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
244 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
245 2922554459 Rhodococcus sp. 66b Isolate Unclassified
246 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.42
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0
Rhizoplane 6.16
Rhizosphere 90.02
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500604_0187708 3300053151 Unclassified 709
2 JGI25406J46586_10008329 3300003203 Bacteria 4702
3 JGI25406J46586_10264794 3300003203 Bacteria 506
4 JGI25407J50210_10007716 3300003373 Bacteria 2700
5 JGI25407J50210_10074881 3300003373 Bacteria 844
6 Ga0070658_11138109 3300005327 Bacteria 679
7 Ga0070683_100095659 3300005329 Bacteria 2793
8 Ga0070683_100428160 3300005329 Bacteria 1263
9 Ga0070683_101215831 3300005329 Bacteria 724
10 Ga0070683_101320587 3300005329 Bacteria 693
11 Ga0070690_100225620 3300005330 Bacteria 1315
12 Ga0068869_100749862 3300005334 Bacteria 836
13 Ga0070682_101565846 3300005337 Bacteria 569
14 Ga0068868_100117213 3300005338 Bacteria 2169
15 Ga0068868_100162614 3300005338 Bacteria 1844
16 Ga0070660_100999065 3300005339 Bacteria 707
17 Ga0070689_100175553 3300005340 Bacteria 1738
18 Ga0070691_10143951 3300005341 Bacteria 1217
19 Ga0070687_100104251 3300005343 Bacteria 1594
20 Ga0070692_10061223 3300005345 Bacteria 1983
21 Ga0070692_10976551 3300005345 Bacteria 591
22 Ga0070669_100462970 3300005353 Bacteria 1047
23 Ga0070674_100295849 3300005356 Bacteria 1289
24 Ga0070688_101246359 3300005365 Bacteria 599
25 Ga0070688_101622311 3300005365 Bacteria 528
26 Ga0070659_100010320 3300005366 Bacteria 6869
27 Ga0070659_100112378 3300005366 Bacteria 2200
28 Ga0070659_100671383 3300005366 Bacteria 894
29 Ga0070659_101092755 3300005366 Bacteria 703
30 Ga0070711_100140319 3300005439 Bacteria 1811
31 Ga0070700_100121079 3300005441 Bacteria 1753
32 Ga0070700_100166359 3300005441 Bacteria 1523
33 Ga0070700_100576486 3300005441 Bacteria 878
34 Ga0070663_100274362 3300005455 Bacteria 1342
35 Ga0070662_100348635 3300005457 Bacteria 1212
36 Ga0070662_100811695 3300005457 Bacteria 795
37 Ga0068867_100268034 3300005459 Bacteria 1395
38 Ga0070685_10062696 3300005466 Bacteria 2180
39 Ga0070679_100523446 3300005530 Bacteria 1130
40 Ga0070684_100191523 3300005535 Bacteria 1861
41 Ga0070684_100826190 3300005535 Bacteria 867
42 Ga0068853_100523974 3300005539 Bacteria 1121
43 Ga0070672_100481576 3300005543 Bacteria 1071
44 Ga0070665_100060497 3300005548 Bacteria 3796
45 Ga0070704_101836965 3300005549 Bacteria 561
46 Ga0068855_100599463 3300005563 Bacteria 1188
47 Ga0070664_100112388 3300005564 Bacteria 2379
48 Ga0070664_100363659 3300005564 Bacteria 1318
49 Ga0070664_101203952 3300005564 Bacteria 714
50 Ga0068857_100244059 3300005577 Bacteria 1645
51 Ga0068854_100053703 3300005578 Bacteria 2895
52 Ga0068854_100283172 3300005578 Bacteria 1335
53 Ga0070702_100009996 3300005615 Bacteria 4658
54 Ga0070702_100172690 3300005615 Bacteria 1407
55 Ga0068852_100258595 3300005616 Bacteria 1671
56 Ga0068852_100395452 3300005616 Bacteria 1358
57 Ga0068852_101682014 3300005616 Bacteria 657
58 Ga0068864_100265668 3300005618 Bacteria 1597
59 Ga0068866_10099175 3300005718 Bacteria 1604
60 Ga0068866_10396550 3300005718 Bacteria 889
61 Ga0068861_100042181 3300005719 Bacteria 3419
62 Ga0068861_100676703 3300005719 Bacteria 956
63 Ga0068861_101164985 3300005719 Bacteria 744
64 Ga0068851_10135130 3300005834 Bacteria 1337
65 Ga0068851_10232764 3300005834 Bacteria 1039
66 Ga0068870_10852747 3300005840 Bacteria 640
67 Ga0068858_100351024 3300005842 Bacteria 1413
68 Ga0068858_100854967 3300005842 Bacteria 888
69 Ga0068858_100881511 3300005842 Bacteria 875
70 Ga0068860_100337338 3300005843 Bacteria 1482
71 Ga0068860_100452632 3300005843 Bacteria 1276
72 Ga0068860_101494838 3300005843 Bacteria 697
73 Ga0068862_100213897 3300005844 Bacteria 1742
74 Ga0068862_100650259 3300005844 Bacteria 1017
75 Ga0068862_100705840 3300005844 Bacteria 977
76 Ga0081455_10057865 3300005937 Bacteria 3283
77 Ga0081538_10002584 3300005981 Bacteria 17565
78 Ga0081538_10004897 3300005981 Bacteria 12196
79 Ga0081538_10006371 3300005981 Bacteria 10412
80 Ga0081538_10013124 3300005981 Bacteria 6581
81 Ga0081538_10041336 3300005981 Bacteria 2928
82 Ga0081538_10056272 3300005981 Bacteria 2305
83 Ga0081538_10346489 3300005981 Bacteria 538
84 Ga0081540_1018574 3300005983 Bacteria 4259
85 Ga0081539_10006429 3300005985 Bacteria 11280
86 Ga0081539_10025107 3300005985 Bacteria 3848
87 Ga0081539_10082461 3300005985 Bacteria 1686
88 Ga0070717_11594100 3300006028 Bacteria 592
89 Ga0075363_100482651 3300006048 Bacteria 735
90 Ga0075364_10016428 3300006051 Bacteria 4605
91 Ga0070712_100269709 3300006175 Bacteria 1367
92 Ga0075367_10208696 3300006178 Bacteria 1221
93 Ga0097621_101021477 3300006237 Bacteria 774
94 Ga0075370_10014670 3300006353 Bacteria 4184
95 Ga0075428_100010563 3300006844 Bacteria 10263
96 Ga0075428_100022618 3300006844 Bacteria 6961
97 Ga0075428_100380255 3300006844 Bacteria 1514
98 Ga0075428_101948380 3300006844 Bacteria 610
99 Ga0075430_100006183 3300006846 Bacteria 10092
100 Ga0075431_100000780 3300006847 Bacteria 27711
101 Ga0075431_100208708 3300006847 Bacteria 1996
102 Ga0075431_100209397 3300006847 Bacteria 1992
103 Ga0075431_100644434 3300006847 Bacteria 1040
104 Ga0075431_101390090 3300006847 Bacteria 662
105 Ga0075434_100057126 3300006871 Bacteria 3878
106 Ga0075429_100002230 3300006880 Bacteria 16198
107 Ga0068865_100083816 3300006881 Bacteria 2295
108 Ga0075436_100008072 3300006914 Bacteria 7205
109 Ga0105251_10383369 3300009011 Bacteria 644
110 Ga0111539_10069808 3300009094 Bacteria 4148
111 Ga0111539_10193294 3300009094 Bacteria 2374
112 Ga0111539_11196539 3300009094 Bacteria 883
113 Ga0111539_11802663 3300009094 Bacteria 710
114 Ga0105245_10037217 3300009098 Bacteria 4326
115 Ga0105245_10174699 3300009098 Bacteria 2048
116 Ga0105245_10188610 3300009098 Bacteria 1974
117 Ga0105245_10950789 3300009098 Bacteria 902
118 Ga0105247_10153444 3300009101 Bacteria 1519
119 Ga0114129_10222800 3300009147 Bacteria 2544
120 Ga0114129_10372013 3300009147 Bacteria 1888
121 Ga0114129_10452588 3300009147 Bacteria 1683
122 Ga0114129_10498768 3300009147 Bacteria 1590
123 Ga0105243_10013615 3300009148 Bacteria 6152
124 Ga0105243_10137527 3300009148 Bacteria 2080
125 Ga0105243_10396264 3300009148 Bacteria 1281
126 Ga0105241_10633443 3300009174 Bacteria 969
127 Ga0105241_11247070 3300009174 Bacteria 706
128 Ga0105242_10104244 3300009176 Bacteria 2407
129 Ga0105242_10656936 3300009176 Bacteria 1020
130 Ga0105248_10041618 3300009177 Bacteria 5151
131 Ga0105237_12470952 3300009545 Bacteria 530
132 Ga0105238_10366187 3300009551 Bacteria 1431
133 Ga0105238_10470278 3300009551 Bacteria 1256
134 Ga0105249_10547240 3300009553 Bacteria 1208
135 Ga0105028_100571 3300009993 Bacteria 3909
136 Ga0105239_10085973 3300010375 Bacteria 3466
137 Ga0105239_10265483 3300010375 Bacteria 1930
138 Ga0105239_10326660 3300010375 Bacteria 1730
139 Ga0105246_11648448 3300011119 Bacteria 608
140 Ga0157369_10539494 3300013105 Bacteria 1206
141 Ga0157374_10263163 3300013296 Bacteria 1699
142 Ga0157374_12589324 3300013296 Bacteria 535
143 Ga0157378_10170246 3300013297 Bacteria 2042
144 Ga0163162_10265150 3300013306 Bacteria 1849
145 Ga0163162_10507348 3300013306 Bacteria 1336
146 Ga0157372_10145767 3300013307 Bacteria 2730
147 Ga0157372_10277180 3300013307 Bacteria 1950
148 Ga0157372_10899730 3300013307 Bacteria 1027
149 Ga0157375_10115865 3300013308 Bacteria 2783
150 Ga0157375_10787766 3300013308 Bacteria 1100
151 Ga0157375_11771449 3300013308 Bacteria 732
152 Ga0157375_13007678 3300013308 Bacteria 563
153 Ga0163163_10180300 3300014325 Bacteria 2159
154 Ga0163163_11271337 3300014325 Bacteria 798
155 Ga0163163_11278550 3300014325 Bacteria 796
156 Ga0163163_11788217 3300014325 Bacteria 675
157 Ga0163163_12202091 3300014325 Bacteria 610
158 Ga0157380_10170791 3300014326 Bacteria 1900
159 Ga0157380_12076675 3300014326 Bacteria 631
160 Ga0157380_12632910 3300014326 Bacteria 569
161 Ga0182008_10083284 3300014497 Bacteria 1575
162 Ga0157377_10096329 3300014745 Bacteria 1755
163 Ga0157377_10129537 3300014745 Bacteria 1539
164 Ga0157376_10382046 3300014969 Bacteria 1357
165 Ga0163161_11014514 3300017792 Bacteria 709
166 Ga0163161_11216977 3300017792 Bacteria 652
167 Ga0206349_1879138 3300020075 Bacteria 799
168 Ga0206355_1134430 3300020076 Bacteria 1092
169 Ga0207426_1012630 3300025302 Bacteria 3166
170 Ga0207656_10076572 3300025321 Bacteria 1496
171 Ga0207642_10291941 3300025899 Bacteria 942
172 Ga0207642_10620639 3300025899 Bacteria 675
173 Ga0207710_10086903 3300025900 Bacteria 1458
174 Ga0207688_10006318 3300025901 Bacteria 6449
175 Ga0207688_10011275 3300025901 Bacteria 4865
176 Ga0207645_10219474 3300025907 Bacteria 1253
177 Ga0207643_10311703 3300025908 Bacteria 981
178 Ga0207643_10501388 3300025908 Bacteria 776
179 Ga0207654_10751376 3300025911 Bacteria 703
180 Ga0207663_10234484 3300025916 Bacteria 1343
181 Ga0207657_10037696 3300025919 Bacteria 4313
182 Ga0207657_10332584 3300025919 Bacteria 1200
183 Ga0207681_10333349 3300025923 Bacteria 1210
184 Ga0207694_10295320 3300025924 Bacteria 1333
185 Ga0207650_10703736 3300025925 Unclassified 853
186 Ga0207650_11124711 3300025925 Bacteria 668
187 Ga0207659_10835041 3300025926 Bacteria 792
188 Ga0207687_10014881 3300025927 Bacteria 5095
189 Ga0207687_10070390 3300025927 Bacteria 2497
190 Ga0207687_10081598 3300025927 Bacteria 2337
191 Ga0207687_10124507 3300025927 Bacteria 1933
192 Ga0207687_10594520 3300025927 Bacteria 932
193 Ga0207687_10708800 3300025927 Bacteria 854
194 Ga0207690_10025823 3300025932 Bacteria 3693
195 Ga0207690_10210978 3300025932 Bacteria 1480
196 Ga0207690_11416534 3300025932 Bacteria 581
197 Ga0207706_10059394 3300025933 Bacteria 3367
198 Ga0207686_10296765 3300025934 Bacteria 1199
199 Ga0207709_10001671 3300025935 Bacteria 14945
200 Ga0207709_10011302 3300025935 Bacteria 4925
201 Ga0207709_10093197 3300025935 Bacteria 1974
202 Ga0207670_10045726 3300025936 Bacteria 2904
203 Ga0207669_11091569 3300025937 Bacteria 673
204 Ga0207665_11560582 3300025939 Bacteria 524
205 Ga0207691_10286760 3300025940 Bacteria 1416
206 Ga0207711_10272447 3300025941 Bacteria 1557
207 Ga0207689_10011175 3300025942 Bacteria 7703
208 Ga0207661_10227996 3300025944 Bacteria 1649
209 Ga0207661_11127062 3300025944 Bacteria 722
210 Ga0207661_11365498 3300025944 Bacteria 650
211 Ga0207679_10402837 3300025945 Bacteria 1204
212 Ga0207679_12036372 3300025945 Bacteria 522
213 Ga0207712_10776524 3300025961 Bacteria 841
214 Ga0207668_10316413 3300025972 Bacteria 1294
215 Ga0207640_10074660 3300025981 Bacteria 2295
216 Ga0207640_10186723 3300025981 Bacteria 1559
217 Ga0207703_10210085 3300026035 Bacteria 1735
218 Ga0207703_10346943 3300026035 Bacteria 1366
219 Ga0207639_11105856 3300026041 Bacteria 743
220 Ga0207678_10290325 3300026067 Bacteria 1404
221 Ga0207678_10435491 3300026067 Bacteria 1138
222 Ga0207708_10005793 3300026075 Bacteria 9133
223 Ga0207708_10160557 3300026075 Bacteria 1775
224 Ga0207708_10670757 3300026075 Bacteria 884
225 Ga0207708_10752667 3300026075 Bacteria 836
226 Ga0207648_10039553 3300026089 Bacteria 4146
227 Ga0207648_10110101 3300026089 Bacteria 2418
228 Ga0207676_10124203 3300026095 Bacteria 2182
229 Ga0207676_11056666 3300026095 Bacteria 802
230 Ga0207674_10373635 3300026116 Bacteria 1378
231 Ga0207674_10905593 3300026116 Bacteria 850
232 Ga0207675_100010200 3300026118 Bacteria 8805
233 Ga0207675_100026804 3300026118 Bacteria 5363
234 Ga0207675_100590306 3300026118 Bacteria 1113
235 Ga0207683_10547802 3300026121 Bacteria 1069
236 Ga0207428_10114714 3300027907 Bacteria 2070
237 Ga0207428_10790413 3300027907 Bacteria 675
238 Ga0268266_10493410 3300028379 Bacteria 1168
239 Ga0268266_10561095 3300028379 Bacteria 1095
240 Ga0268265_12277737 3300028380 Bacteria 548
241 Ga0268265_12431682 3300028380 Bacteria 530
242 Ga0268264_10372550 3300028381 Bacteria 1365
243 Ga0307408_100011587 3300031548 Bacteria 5828
244 Ga0307408_100155109 3300031548 Bacteria 1812
245 Ga0307408_100736153 3300031548 Bacteria 889
246 Ga0307408_101252026 3300031548 Bacteria 694
247 Ga0307405_10000246 3300031731 Bacteria 19781
248 Ga0307405_10017594 3300031731 Bacteria 3926
249 Ga0307405_10090415 3300031731 Bacteria 2025
250 Ga0307405_10233523 3300031731 Bacteria 1357
251 Ga0307413_10218575 3300031824 Bacteria 1390
252 Ga0307413_10349934 3300031824 Bacteria 1140
253 Ga0307413_11462675 3300031824 Bacteria 603
254 Ga0307410_10004974 3300031852 Bacteria 6969
255 Ga0307410_10011461 3300031852 Bacteria 5072
256 Ga0307410_10273965 3300031852 Bacteria 1321
257 Ga0307410_10473739 3300031852 Bacteria 1026
258 Ga0307410_10572944 3300031852 Bacteria 938
259 Ga0307406_10005009 3300031901 Bacteria 7218
260 Ga0307406_10018909 3300031901 Bacteria 4035
261 Ga0307406_10026369 3300031901 Bacteria 3489
262 Ga0307406_10049079 3300031901 Bacteria 2670
263 Ga0307406_10064043 3300031901 Bacteria 2384
264 Ga0307406_10258763 3300031901 Bacteria 1315
265 Ga0307406_11011763 3300031901 Bacteria 713
266 Ga0307407_10015327 3300031903 Bacteria 3785
267 Ga0307407_10015844 3300031903 Bacteria 3739
268 Ga0307407_10036368 3300031903 Bacteria 2713
269 Ga0307407_10097354 3300031903 Bacteria 1818
270 Ga0307407_10320011 3300031903 Bacteria 1088
271 Ga0307407_10850318 3300031903 Bacteria 697
272 Ga0307412_10022788 3300031911 Bacteria 3845
273 Ga0307412_10245278 3300031911 Bacteria 1388
274 Ga0307412_10298050 3300031911 Bacteria 1273
275 Ga0307412_10969682 3300031911 Bacteria 749
276 Ga0307412_11553039 3300031911 Bacteria 603
277 Ga0307409_100000692 3300031995 Bacteria 14981
278 Ga0307409_100033524 3300031995 Bacteria 3738
279 Ga0307409_100056739 3300031995 Bacteria 3030
280 Ga0307409_100116462 3300031995 Bacteria 2252
281 Ga0307409_100278103 3300031995 Bacteria 1545
282 Ga0307409_100290544 3300031995 Bacteria 1516
283 Ga0307409_100324426 3300031995 Bacteria 1442
284 Ga0307409_100344919 3300031995 Bacteria 1403
285 Ga0307409_100440182 3300031995 Bacteria 1255
286 Ga0307409_100715609 3300031995 Bacteria 1002
287 Ga0307409_101003832 3300031995 Bacteria 853
288 Ga0307416_100000702 3300032002 Bacteria 17383
289 Ga0307416_100007805 3300032002 Bacteria 6839
290 Ga0307416_100043004 3300032002 Bacteria 3533
291 Ga0307416_100130871 3300032002 Bacteria 2258
292 Ga0307416_100218011 3300032002 Bacteria 1827
293 Ga0307416_100325089 3300032002 Bacteria 1542
294 Ga0307416_100385065 3300032002 Bacteria 1434
295 Ga0307416_100418338 3300032002 Bacteria 1383
296 Ga0307416_101538618 3300032002 Bacteria 771
297 Ga0307416_101909128 3300032002 Bacteria 697
298 Ga0307416_102164546 3300032002 Bacteria 658
299 Ga0307416_103770900 3300032002 Bacteria 507
300 Ga0307414_10402486 3300032004 Bacteria 1189
301 Ga0307414_10641184 3300032004 Bacteria 957
302 Ga0307414_11802658 3300032004 Bacteria 571
303 Ga0307411_10005689 3300032005 Bacteria 6155
304 Ga0307411_10338130 3300032005 Bacteria 1222
305 Ga0307411_10487371 3300032005 Bacteria 1039
306 Ga0307411_10511910 3300032005 Bacteria 1017
307 Ga0307415_100000106 3300032126 Bacteria 35422
308 Ga0307415_100001756 3300032126 Bacteria 10584
309 Ga0307415_100033137 3300032126 Bacteria 3351
310 Ga0307415_100041347 3300032126 Bacteria 3060
311 Ga0307415_100066446 3300032126 Bacteria 2516
312 Ga0307415_100091912 3300032126 Bacteria 2199
313 Ga0307415_100101325 3300032126 Bacteria 2113
314 Ga0307415_100411654 3300032126 Bacteria 1157
315 Ga0307415_100492303 3300032126 Bacteria 1070
316 Ga0307415_101148075 3300032126 Bacteria 729
317 Ga0307415_101676834 3300032126 Bacteria 612
318 Ga0373960_0230626 3300035121 Bacteria 666
319 Ga0373947_0970385 3300035725 Bacteria 580
320 Ga0395900_0221658 3300037418 Bacteria 1906
321 Ga0395900_0323057 3300037418 Bacteria 1523
322 Ga0395898_0172700 3300037466 Bacteria 2066
323 Ga0395898_0962894 3300037466 Bacteria 790
324 Ga0395905_0102804 3300037471 Bacteria 2683
325 Ga0395905_0396236 3300037471 Bacteria 1275
326 Ga0395901_0251810 3300038443 Bacteria 1840
327 Ga0395901_0315960 3300038443 Bacteria 1617
328 Ga0395901_0349959 3300038443 Bacteria 1525
329 Ga0436361_0693495 3300039447 Unclassified 739
330 Ga0436362_0582912 3300039453 Bacteria 936
331 Ga0451791_1382277 3300041451 Bacteria 1383
332 Ga0451800_1345787 3300041459 Bacteria 723
333 Ga0439448_0018565 3300042005 Bacteria 2134
334 Ga0439450_012142 3300042008 Bacteria 1704
335 Ga0439450_046872 3300042008 Bacteria 1018
336 Ga0439455_0222315 3300042012 Bacteria 549
337 Ga0439455_0248912 3300042012 Bacteria 520
338 Ga0439463_018977 3300042016 Bacteria 1713
339 Ga0439463_033823 3300042016 Bacteria 1293
340 Ga0439463_062561 3300042016 Bacteria 951
341 Ga0439459_0017914 3300042438 Bacteria 1326
342 Ga0439464_0184246 3300042439 Bacteria 662
343 Ga0439460_0114633 3300042461 Bacteria 877
344 Ga0439460_0211698 3300042461 Bacteria 663
345 Ga0439440_0003336 3300042993 Bacteria 3090
346 Ga0466961_0947958 3300044693 Bacteria 512
347 Ga0466970_0157798 3300044765 Bacteria 1254
348 Ga0466959_0392618 3300045049 Bacteria 944
349 Ga0466967_0364843 3300045976 Bacteria 1400
350 Ga0466967_2612357 3300045976 Bacteria 500
351 Ga0495590_0322456 3300046457 Bacteria 584
352 Ga0495641_0270344 3300046461 Bacteria 765
353 Ga0495641_0453162 3300046461 Bacteria 584
354 Ga0495594_0054643 3300046499 Bacteria 2201
355 Ga0495656_0156101 3300046615 Bacteria 1106
356 Ga0495668_0000407 3300046616 Bacteria 56229
357 Ga0495672_0044656 3300047320 Bacteria 2657
358 Ga0496100_0002946 3300048903 Bacteria 8756
359 Ga0496100_0238913 3300048903 Bacteria 1340
360 Ga0496100_0385994 3300048903 Bacteria 1064
361 Ga0496101_0006045 3300048904 Bacteria 7768
362 Ga0496101_0194197 3300048904 Bacteria 1567
363 Ga0496102_0004837 3300048905 Bacteria 11388
364 Ga0496102_0059715 3300048905 Bacteria 3488
365 Ga0496102_0969191 3300048905 Bacteria 771
366 Ga0496103_0177803 3300048906 Bacteria 1367
367 Ga0496104_0134712 3300048907 Bacteria 2373
368 Ga0496105_0233459 3300048908 Bacteria 1494
369 Ga0496106_0000253 3300048909 Bacteria 37605
370 Ga0496106_0115604 3300048909 Bacteria 2092
371 Ga0496107_0019795 3300048910 Bacteria 4751
372 Ga0496108_0012758 3300048911 Bacteria 6842
373 Ga0496109_0393408 3300048912 Bacteria 1309
374 Ga0496109_0590873 3300048912 Bacteria 1046
375 Ga0496110_0103408 3300048913 Bacteria 2555
376 Ga0496110_0326547 3300048913 Bacteria 1397
377 Ga0496112_0131042 3300048915 Bacteria 2478
378 Ga0496113_0072308 3300048916 Bacteria 2624
379 Ga0496113_0953457 3300048916 Bacteria 677
380 Ga0496114_0007329 3300048917 Bacteria 8714
381 Ga0496114_0014769 3300048917 Bacteria 6277
382 Ga0496114_0329018 3300048917 Bacteria 1351
383 Ga0496115_0127919 3300048918 Bacteria 2093
384 Ga0496115_0276687 3300048918 Bacteria 1378
385 Ga0496125_0046185 3300048928 Bacteria 3656
386 Ga0496126_0138865 3300048929 Bacteria 2094
387 Ga0501032_0045998 3300049569 Bacteria 2950
388 Ga0501033_0014119 3300049570 Bacteria 6072
389 Ga0501033_0014800 3300049570 Bacteria 5923
390 Ga0501034_1605695 3300049571 Bacteria 523
391 Ga0501036_0005979 3300049572 Bacteria 9867
392 Ga0501036_0006475 3300049572 Bacteria 9513
393 Ga0501037_0011284 3300049573 Bacteria 6575
394 Ga0501037_0023322 3300049573 Bacteria 4577
395 Ga0501038_0015282 3300049574 Bacteria 6979
396 Ga0501038_0041116 3300049574 Bacteria 4032
397 Ga0501039_0001000 3300049575 Bacteria 20589
398 Ga0501039_0019483 3300049575 Bacteria 5202
399 Ga0501040_0000324 3300049576 Bacteria 27985
400 Ga0501040_0001435 3300049576 Bacteria 15084
401 Ga0501041_0000228 3300049577 Bacteria 26144
402 Ga0501041_0001553 3300049577 Bacteria 12783
403 Ga0501042_0001486 3300049578 Bacteria 13835
404 Ga0501042_0001507 3300049578 Bacteria 13759
405 Ga0501043_0008986 3300049579 Bacteria 7863
406 Ga0501046_0000277 3300049580 Bacteria 51940
407 Ga0501048_0000231 3300049582 Bacteria 36818
408 Ga0501068_0017976 3300049584 Bacteria 4093
409 Ga0501069_0375498 3300049585 Bacteria 839
410 Ga0501071_0001188 3300049587 Bacteria 14677
411 Ga0501071_0003902 3300049587 Bacteria 9395
412 Ga0501072_0000488 3300049588 Bacteria 28505
413 Ga0501073_0517288 3300049589 Bacteria 825
414 Ga0501074_0000208 3300049590 Bacteria 32231
415 Ga0501074_0012130 3300049590 Bacteria 6265
416 Ga0501075_0000599 3300049591 Bacteria 22019
417 Ga0501075_0001038 3300049591 Bacteria 17835
418 Ga0501076_0001080 3300049592 Bacteria 17913
419 Ga0501076_0006220 3300049592 Bacteria 8642
420 Ga0501077_0005150 3300049593 Bacteria 7940
421 Ga0501077_0009428 3300049593 Bacteria 6067
422 Ga0501079_0001248 3300049741 Bacteria 17835
423 Ga0501079_0005029 3300049741 Bacteria 9815
424 Ga0501081_0002731 3300049743 Bacteria 11175
425 Ga0501083_0014901 3300049744 Bacteria 5438
426 Ga0501035_0436299 3300049822 Bacteria 1085
427 Ga0501044_0843979 3300049823 Bacteria 793
428 Ga0501045_0000033 3300049824 Bacteria 58983
429 Ga0501045_0001103 3300049824 Bacteria 17834
430 nmdc:mga03n38_450333_c1 3300050490 Bacteria 716
431 nmdc:mga00v17_166741_c1 3300050491 Bacteria 1419
432 nmdc:mga0yw44_54614_c1 3300050492 Bacteria 2428
433 nmdc:mga06z11_479373_c1 3300050494 Bacteria 753
434 nmdc:mga07m45_25885_c1 3300050496 Bacteria 3222
435 nmdc:mga05p37_1395603_c1 3300050507 Bacteria 706
436 nmdc:mga05p37_1428924_c1 3300050507 Bacteria 694
437 nmdc:mga05p37_199973_c1 3300050507 Bacteria 2421
438 nmdc:mga09592_262135_c1 3300050508 Bacteria 1499
439 nmdc:mga09592_4946_c1 3300050508 Bacteria 10803
440 nmdc:mga09592_722642_c1 3300050508 Bacteria 846
441 nmdc:mga0qj67_3100_c1 3300050509 Bacteria 11959
442 nmdc:mga0qj67_417119_c1 3300050509 Bacteria 1082
443 nmdc:mga06r32_105924_c1 3300050510 Bacteria 2763
444 nmdc:mga06r32_1107_c1 3300050510 Bacteria 24165
445 nmdc:mga06r32_164338_c1 3300050510 Bacteria 2202
446 nmdc:mga08y16_1547886_c1 3300050511 Bacteria 622
447 nmdc:mga08y16_165336_c1 3300050511 Bacteria 2299
448 nmdc:mga08y16_26859_c1 3300050511 Bacteria 6067
449 nmdc:mga08y16_332442_c1 3300050511 Bacteria 1563
450 nmdc:mga08y16_398608_c1 3300050511 Bacteria 1409
451 nmdc:mga08y16_925394_c1 3300050511 Bacteria 856
452 nmdc:mga0n895_1672987_c1 3300050512 Bacteria 599
453 nmdc:mga0rr50_1044039_c1 3300050513 Bacteria 696
454 nmdc:mga08x19_59306_c1 3300050514 Bacteria 2477
455 nmdc:mga0a205_150265_c1 3300050515 Bacteria 2229
456 Ga0495595_0170149 3300053084 Bacteria 1078
457 Ga0501084_0003339 3300054114 Bacteria 12996
458 Ga0501084_0015043 3300054114 Bacteria 6416
459 Ga0501082_0000388 3300060353 Bacteria 39025
460 Ga0501082_0001640 3300060353 Bacteria 19729
461 Ga0530510_0002194 3300061734 Bacteria 13388
462 Ga0530510_0006157 3300061734 Bacteria 8334
463 2566992577 2565956761 Bacteria 6601618
464 2738887583 2738541308 Bacteria 7020677
465 2739240139 2738543011 Bacteria 5731169
466 2795792091 2795385472 Bacteria 6627535
467 2839986266 2839986021 Bacteria 3685650
468 2889303376 2889300758 Bacteria 5690814
469 2904541561 2904535858 Bacteria 6308016
470 2922560063 2922554459 Bacteria 6683962
471 2939748570 2939743619 Bacteria 5762299
472 Ga0500604_0187708
473 JGI25406J46586_10008329
474 JGI25406J46586_10264794
475 JGI25407J50210_10007716
476 JGI25407J50210_10074881
477 Ga0070658_11138109
478 Ga0070683_100095659
479 Ga0070683_100428160
480 Ga0070683_101215831
481 Ga0070683_101320587
482 Ga0070690_100225620
483 Ga0068869_100749862
484 Ga0070682_101565846
485 Ga0068868_100117213
486 Ga0068868_100162614
487 Ga0070660_100999065
488 Ga0070689_100175553
489 Ga0070691_10143951
490 Ga0070687_100104251
491 Ga0070692_10061223
492 Ga0070692_10976551
493 Ga0070669_100462970
494 Ga0070674_100295849
495 Ga0070688_101246359
496 Ga0070688_101622311
497 Ga0070659_100010320
498 Ga0070659_100112378
499 Ga0070659_100671383
500 Ga0070659_101092755
501 Ga0070711_100140319
502 Ga0070700_100121079
503 Ga0070700_100166359
504 Ga0070700_100576486
505 Ga0070663_100274362
506 Ga0070662_100348635
507 Ga0070662_100811695
508 Ga0068867_100268034
509 Ga0070685_10062696
510 Ga0070679_100523446
511 Ga0070684_100191523
512 Ga0070684_100826190
513 Ga0068853_100523974
514 Ga0070672_100481576
515 Ga0070665_100060497
516 Ga0070704_101836965
517 Ga0068855_100599463
518 Ga0070664_100112388
519 Ga0070664_100363659
520 Ga0070664_101203952
521 Ga0068857_100244059
522 Ga0068854_100053703
523 Ga0068854_100283172
524 Ga0070702_100009996
525 Ga0070702_100172690
526 Ga0068852_100258595
527 Ga0068852_100395452
528 Ga0068852_101682014
529 Ga0068864_100265668
530 Ga0068866_10099175
531 Ga0068866_10396550
532 Ga0068861_100042181
533 Ga0068861_100676703
534 Ga0068861_101164985
535 Ga0068851_10135130
536 Ga0068851_10232764
537 Ga0068870_10852747
538 Ga0068858_100351024
539 Ga0068858_100854967
540 Ga0068858_100881511
541 Ga0068860_100337338
542 Ga0068860_100452632
543 Ga0068860_101494838
544 Ga0068862_100213897
545 Ga0068862_100650259
546 Ga0068862_100705840
547 Ga0081455_10057865
548 Ga0081538_10002584
549 Ga0081538_10004897
550 Ga0081538_10006371
551 Ga0081538_10013124
552 Ga0081538_10041336
553 Ga0081538_10056272
554 Ga0081538_10346489
555 Ga0081540_1018574
556 Ga0081539_10006429
557 Ga0081539_10025107
558 Ga0081539_10082461
559 Ga0070717_11594100
560 Ga0075363_100482651
561 Ga0075364_10016428
562 Ga0070712_100269709
563 Ga0075367_10208696
564 Ga0097621_101021477
565 Ga0075370_10014670
566 Ga0075428_100010563
567 Ga0075428_100022618
568 Ga0075428_100380255
569 Ga0075428_101948380
570 Ga0075430_100006183
571 Ga0075431_100000780
572 Ga0075431_100208708
573 Ga0075431_100209397
574 Ga0075431_100644434
575 Ga0075431_101390090
576 Ga0075434_100057126
577 Ga0075429_100002230
578 Ga0068865_100083816
579 Ga0075436_100008072
580 Ga0105251_10383369
581 Ga0111539_10069808
582 Ga0111539_10193294
583 Ga0111539_11196539
584 Ga0111539_11802663
585 Ga0105245_10037217
586 Ga0105245_10174699
587 Ga0105245_10188610
588 Ga0105245_10950789
589 Ga0105247_10153444
590 Ga0114129_10222800
591 Ga0114129_10372013
592 Ga0114129_10452588
593 Ga0114129_10498768
594 Ga0105243_10013615
595 Ga0105243_10137527
596 Ga0105243_10396264
597 Ga0105241_10633443
598 Ga0105241_11247070
599 Ga0105242_10104244
600 Ga0105242_10656936
601 Ga0105248_10041618
602 Ga0105237_12470952
603 Ga0105238_10366187
604 Ga0105238_10470278
605 Ga0105249_10547240
606 Ga0105028_100571
607 Ga0105239_10085973
608 Ga0105239_10265483
609 Ga0105239_10326660
610 Ga0105246_11648448
611 Ga0157369_10539494
612 Ga0157374_10263163
613 Ga0157374_12589324
614 Ga0157378_10170246
615 Ga0163162_10265150
616 Ga0163162_10507348
617 Ga0157372_10145767
618 Ga0157372_10277180
619 Ga0157372_10899730
620 Ga0157375_10115865
621 Ga0157375_10787766
622 Ga0157375_11771449
623 Ga0157375_13007678
624 Ga0163163_10180300
625 Ga0163163_11271337
626 Ga0163163_11278550
627 Ga0163163_11788217
628 Ga0163163_12202091
629 Ga0157380_10170791
630 Ga0157380_12076675
631 Ga0157380_12632910
632 Ga0182008_10083284
633 Ga0157377_10096329
634 Ga0157377_10129537
635 Ga0157376_10382046
636 Ga0163161_11014514
637 Ga0163161_11216977
638 Ga0206349_1879138
639 Ga0206355_1134430
640 Ga0207426_1012630
641 Ga0207656_10076572
642 Ga0207642_10291941
643 Ga0207642_10620639
644 Ga0207710_10086903
645 Ga0207688_10006318
646 Ga0207688_10011275
647 Ga0207645_10219474
648 Ga0207643_10311703
649 Ga0207643_10501388
650 Ga0207654_10751376
651 Ga0207663_10234484
652 Ga0207657_10037696
653 Ga0207657_10332584
654 Ga0207681_10333349
655 Ga0207694_10295320
656 Ga0207650_10703736
657 Ga0207650_11124711
658 Ga0207659_10835041
659 Ga0207687_10014881
660 Ga0207687_10070390
661 Ga0207687_10081598
662 Ga0207687_10124507
663 Ga0207687_10594520
664 Ga0207687_10708800
665 Ga0207690_10025823
666 Ga0207690_10210978
667 Ga0207690_11416534
668 Ga0207706_10059394
669 Ga0207686_10296765
670 Ga0207709_10001671
671 Ga0207709_10011302
672 Ga0207709_10093197
673 Ga0207670_10045726
674 Ga0207669_11091569
675 Ga0207665_11560582
676 Ga0207691_10286760
677 Ga0207711_10272447
678 Ga0207689_10011175
679 Ga0207661_10227996
680 Ga0207661_11127062
681 Ga0207661_11365498
682 Ga0207679_10402837
683 Ga0207679_12036372
684 Ga0207712_10776524
685 Ga0207668_10316413
686 Ga0207640_10074660
687 Ga0207640_10186723
688 Ga0207703_10210085
689 Ga0207703_10346943
690 Ga0207639_11105856
691 Ga0207678_10290325
692 Ga0207678_10435491
693 Ga0207708_10005793
694 Ga0207708_10160557
695 Ga0207708_10670757
696 Ga0207708_10752667
697 Ga0207648_10039553
698 Ga0207648_10110101
699 Ga0207676_10124203
700 Ga0207676_11056666
701 Ga0207674_10373635
702 Ga0207674_10905593
703 Ga0207675_100010200
704 Ga0207675_100026804
705 Ga0207675_100590306
706 Ga0207683_10547802
707 Ga0207428_10114714
708 Ga0207428_10790413
709 Ga0268266_10493410
710 Ga0268266_10561095
711 Ga0268265_12277737
712 Ga0268265_12431682
713 Ga0268264_10372550
714 Ga0307408_100011587
715 Ga0307408_100155109
716 Ga0307408_100736153
717 Ga0307408_101252026
718 Ga0307405_10000246
719 Ga0307405_10017594
720 Ga0307405_10090415
721 Ga0307405_10233523
722 Ga0307413_10218575
723 Ga0307413_10349934
724 Ga0307413_11462675
725 Ga0307410_10004974
726 Ga0307410_10011461
727 Ga0307410_10273965
728 Ga0307410_10473739
729 Ga0307410_10572944
730 Ga0307406_10005009
731 Ga0307406_10018909
732 Ga0307406_10026369
733 Ga0307406_10049079
734 Ga0307406_10064043
735 Ga0307406_10258763
736 Ga0307406_11011763
737 Ga0307407_10015327
738 Ga0307407_10015844
739 Ga0307407_10036368
740 Ga0307407_10097354
741 Ga0307407_10320011
742 Ga0307407_10850318
743 Ga0307412_10022788
744 Ga0307412_10245278
745 Ga0307412_10298050
746 Ga0307412_10969682
747 Ga0307412_11553039
748 Ga0307409_100000692
749 Ga0307409_100033524
750 Ga0307409_100056739
751 Ga0307409_100116462
752 Ga0307409_100278103
753 Ga0307409_100290544
754 Ga0307409_100324426
755 Ga0307409_100344919
756 Ga0307409_100440182
757 Ga0307409_100715609
758 Ga0307409_101003832
759 Ga0307416_100000702
760 Ga0307416_100007805
761 Ga0307416_100043004
762 Ga0307416_100130871
763 Ga0307416_100218011
764 Ga0307416_100325089
765 Ga0307416_100385065
766 Ga0307416_100418338
767 Ga0307416_101538618
768 Ga0307416_101909128
769 Ga0307416_102164546
770 Ga0307416_103770900
771 Ga0307414_10402486
772 Ga0307414_10641184
773 Ga0307414_11802658
774 Ga0307411_10005689
775 Ga0307411_10338130
776 Ga0307411_10487371
777 Ga0307411_10511910
778 Ga0307415_100000106
779 Ga0307415_100001756
780 Ga0307415_100033137
781 Ga0307415_100041347
782 Ga0307415_100066446
783 Ga0307415_100091912
784 Ga0307415_100101325
785 Ga0307415_100411654
786 Ga0307415_100492303
787 Ga0307415_101148075
788 Ga0307415_101676834
789 Ga0373960_0230626
790 Ga0373947_0970385
791 Ga0395900_0221658
792 Ga0395900_0323057
793 Ga0395898_0172700
794 Ga0395898_0962894
795 Ga0395905_0102804
796 Ga0395905_0396236
797 Ga0395901_0251810
798 Ga0395901_0315960
799 Ga0395901_0349959
800 Ga0436361_0693495
801 Ga0436362_0582912
802 Ga0451791_1382277
803 Ga0451800_1345787
804 Ga0439448_0018565
805 Ga0439450_012142
806 Ga0439450_046872
807 Ga0439455_0222315
808 Ga0439455_0248912
809 Ga0439463_018977
810 Ga0439463_033823
811 Ga0439463_062561
812 Ga0439459_0017914
813 Ga0439464_0184246
814 Ga0439460_0114633
815 Ga0439460_0211698
816 Ga0439440_0003336
817 Ga0466961_0947958
818 Ga0466970_0157798
819 Ga0466959_0392618
820 Ga0466967_0364843
821 Ga0466967_2612357
822 Ga0495590_0322456
823 Ga0495641_0270344
824 Ga0495641_0453162
825 Ga0495594_0054643
826 Ga0495656_0156101
827 Ga0495668_0000407
828 Ga0495672_0044656
829 Ga0496100_0002946
830 Ga0496100_0238913
831 Ga0496100_0385994
832 Ga0496101_0006045
833 Ga0496101_0194197
834 Ga0496102_0004837
835 Ga0496102_0059715
836 Ga0496102_0969191
837 Ga0496103_0177803
838 Ga0496104_0134712
839 Ga0496105_0233459
840 Ga0496106_0000253
841 Ga0496106_0115604
842 Ga0496107_0019795
843 Ga0496108_0012758
844 Ga0496109_0393408
845 Ga0496109_0590873
846 Ga0496110_0103408
847 Ga0496110_0326547
848 Ga0496112_0131042
849 Ga0496113_0072308
850 Ga0496113_0953457
851 Ga0496114_0007329
852 Ga0496114_0014769
853 Ga0496114_0329018
854 Ga0496115_0127919
855 Ga0496115_0276687
856 Ga0496125_0046185
857 Ga0496126_0138865
858 Ga0501032_0045998
859 Ga0501033_0014119
860 Ga0501033_0014800
861 Ga0501034_1605695
862 Ga0501036_0005979
863 Ga0501036_0006475
864 Ga0501037_0011284
865 Ga0501037_0023322
866 Ga0501038_0015282
867 Ga0501038_0041116
868 Ga0501039_0001000
869 Ga0501039_0019483
870 Ga0501040_0000324
871 Ga0501040_0001435
872 Ga0501041_0000228
873 Ga0501041_0001553
874 Ga0501042_0001486
875 Ga0501042_0001507
876 Ga0501043_0008986
877 Ga0501046_0000277
878 Ga0501048_0000231
879 Ga0501068_0017976
880 Ga0501069_0375498
881 Ga0501071_0001188
882 Ga0501071_0003902
883 Ga0501072_0000488
884 Ga0501073_0517288
885 Ga0501074_0000208
886 Ga0501074_0012130
887 Ga0501075_0000599
888 Ga0501075_0001038
889 Ga0501076_0001080
890 Ga0501076_0006220
891 Ga0501077_0005150
892 Ga0501077_0009428
893 Ga0501079_0001248
894 Ga0501079_0005029
895 Ga0501081_0002731
896 Ga0501083_0014901
897 Ga0501035_0436299
898 Ga0501044_0843979
899 Ga0501045_0000033
900 Ga0501045_0001103
901 nmdc:mga03n38_450333_c1
902 nmdc:mga00v17_166741_c1
903 nmdc:mga0yw44_54614_c1
904 nmdc:mga06z11_479373_c1
905 nmdc:mga07m45_25885_c1
906 nmdc:mga05p37_1395603_c1
907 nmdc:mga05p37_1428924_c1
908 nmdc:mga05p37_199973_c1
909 nmdc:mga09592_262135_c1
910 nmdc:mga09592_4946_c1
911 nmdc:mga09592_722642_c1
912 nmdc:mga0qj67_3100_c1
913 nmdc:mga0qj67_417119_c1
914 nmdc:mga06r32_105924_c1
915 nmdc:mga06r32_1107_c1
916 nmdc:mga06r32_164338_c1
917 nmdc:mga08y16_1547886_c1
918 nmdc:mga08y16_165336_c1
919 nmdc:mga08y16_26859_c1
920 nmdc:mga08y16_332442_c1
921 nmdc:mga08y16_398608_c1
922 nmdc:mga08y16_925394_c1
923 nmdc:mga0n895_1672987_c1
924 nmdc:mga0rr50_1044039_c1
925 nmdc:mga08x19_59306_c1
926 nmdc:mga0a205_150265_c1
927 Ga0495595_0170149
928 Ga0501084_0003339
929 Ga0501084_0015043
930 Ga0501082_0000388
931 Ga0501082_0001640
932 Ga0530510_0002194
933 Ga0530510_0006157
934 2566992577
935 2738887583
936 2739240139
937 2795792091
938 2839986266
939 2889303376
940 2904541561
941 2922560063
942 2939748570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

117

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.9123 2 120
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8968 4 118
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8894 4 118
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.8846 2 118
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8841 2 120
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8955 4 118 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8882 4 118 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8561 4 118 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8374 67 120 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8311 68 120 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7Y9LTR2-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9839 3 120 GO:0016829
AF-A0A7V9DV65-F1-model_v4 VOC family protein 0.9823 1 111
AF-A0A0Q9UH98-F1-model_v4 Glyoxalase 0.9818 1 120
AF-A0A3A5MHH8-F1-model_v4 Glyoxalase 0.9801 1 121
AF-A0A0Q5ASF3-F1-model_v4 Glyoxalase 0.9796 1 123

Map